Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|078900
Gene name
Locationscaffold_5:174632..176410
Strand+
Gene length (bp)1778
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 5.6E-21 37 157
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 1.4E-12 80 188
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 1.2E-08 32 101
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 1.4E-10 80 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 28 157 3.0E-12
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 28 157 3.0E-12
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 45 157 4.0E-12
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 45 157 5.0E-11
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 43 157 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 28 157 3.0E-12
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 28 157 3.0E-12
sp|O54161|EABF_STRCO Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=abfB PE=1 SV=1 45 157 4.0E-12
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 45 157 5.0E-11
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 43 157 1.0E-09
sp|P96463|EABF_STRLI Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces lividans GN=abfB PE=1 SV=2 83 157 3.0E-07
sp|P26514|XYNA_STRLI Endo-1,4-beta-xylanase A OS=Streptomyces lividans GN=xlnA PE=1 SV=2 45 114 3.0E-07
sp|A8W969|AGB34_AGAAL Beta-agarase AgaB34 OS=Agarivorans albus GN=agaB34 PE=3 SV=1 81 157 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|078900
MMQESFARKVVLAALIGALGVLAQQPDVPTYTGELVIQNIFDNGKCMTAASNSDGAAVTLQGCTGAASQKWVFQD
GSVKVHGNKCLDVSSGADANGTKMQIFTCSSGNANQQWSYDVWSKRLSWKGHNKCLDLSAGSTADGNRLQIWDCV
WNPNQFWNTGYLSNSLPQTSQAEQFGTNNCGTSSDQNSKCQTAWINSADDFCVWAPPALEAIGSSERYEVAWCTK
SGRGTRVIPDGTLKGVHFVETPDYVQITGQGDFTKINIPAGDAGGELDNRGADGRGNPIGGLVYGNSFGQGQQFH
EWTNFMSDHEFCFRACRGPRAMELCNHVFDEMGCYWNMPANYDPGFENCEGVDAEPMGVYTVDGQRSTYTQGQSP
TPPPHPAPSSSNCQALPTVSSSPVQARRALDRKFVPKFPEHTPAPSYF*
Coding >AgabiH97|078900
ATGATGCAGGAATCCTTTGCGCGTAAAGTTGTGCTTGCTGCTTTGATTGGAGCTTTGGGTGTTTTGGCGCAACAG
CCTGATGTTCCTACATACACCGGCGAGCTCGTTATTCAGAACATCTTCGATAATGGCAAATGCATGACCGCCGCA
TCCAACTCCGATGGCGCCGCTGTGACCCTCCAAGGCTGTACCGGTGCTGCTTCTCAAAAATGGGTTTTCCAAGAT
GGGAGCGTCAAAGTTCATGGAAACAAATGCTTGGACGTCTCTAGCGGCGCTGATGCCAATGGAACGAAGATGCAG
ATTTTCACTTGTAGCTCGGGTAATGCGAATCAACAGTGGTCGTATGATGTTTGGAGTAAACGCTTATCCTGGAAA
GGACATAACAAGTGTCTTGATCTTTCTGCTGGTAGCACCGCAGATGGAAATCGACTTCAAATCTGGGATTGTGTC
TGGAACCCCAATCAATTCTGGAATACAGGATACCTGTCCAATAGCCTCCCTCAAACAAGTCAAGCAGAACAGTTC
GGCACGAACAACTGTGGGACGAGTTCCGATCAAAATTCCAAGTGTCAAACCGCTTGGATCAATTCTGCCGATGAC
TTTTGCGTCTGGGCACCGCCTGCTCTGGAAGCCATTGGGAGTAGTGAACGCTACGAAGTCGCTTGGTGTACCAAA
TCCGGGCGAGGTACCCGCGTCATTCCAGACGGTACCCTTAAAGGCGTCCATTTCGTCGAAACACCCGATTATGTA
CAAATAACCGGCCAGGGCGATTTCACGAAGATTAACATCCCAGCCGGTGATGCTGGAGGTGAACTTGATAACCGT
GGTGCTGATGGTAGAGGTAACCCCATTGGTGGATTAGTCTATGGCAATTCTTTCGGTCAAGGCCAGCAATTCCAT
GAATGGACCAACTTTATGTCGGATCATGAGTTCTGTTTCCGCGCTTGTCGAGGACCAAGAGCCATGGAGCTCTGT
AACCATGTGTTTGACGAGATGGGCTGTTACTGGAACATGCCCGCGAACTATGACCCCGGTTTTGAGAATTGTGAA
GGTGTCGACGCTGAACCGATGGGTGTATACACCGTTGATGGTCAACGCAGCACTTACACTCAAGGTCAAAGCCCG
ACTCCCCCGCCTCATCCTGCTCCTTCCTCTTCAAACTGTCAAGCTTTACCTACTGTTTCGTCTTCCCCGGTTCAA
GCCCGACGTGCACTTGACAGGAAGTTTGTGCCGAAGTTCCCTGAACACACTCCCGCTCCATCCTACTTCTGA
Transcript >AgabiH97|078900
ATGATGCAGGAATCCTTTGCGCGTAAAGTTGTGCTTGCTGCTTTGATTGGAGCTTTGGGTGTTTTGGCGCAACAG
CCTGATGTTCCTACATACACCGGCGAGCTCGTTATTCAGAACATCTTCGATAATGGCAAATGCATGACCGCCGCA
TCCAACTCCGATGGCGCCGCTGTGACCCTCCAAGGCTGTACCGGTGCTGCTTCTCAAAAATGGGTTTTCCAAGAT
GGGAGCGTCAAAGTTCATGGAAACAAATGCTTGGACGTCTCTAGCGGCGCTGATGCCAATGGAACGAAGATGCAG
ATTTTCACTTGTAGCTCGGGTAATGCGAATCAACAGTGGTCGTATGATGTTTGGAGTAAACGCTTATCCTGGAAA
GGACATAACAAGTGTCTTGATCTTTCTGCTGGTAGCACCGCAGATGGAAATCGACTTCAAATCTGGGATTGTGTC
TGGAACCCCAATCAATTCTGGAATACAGGATACCTGTCCAATAGCCTCCCTCAAACAAGTCAAGCAGAACAGTTC
GGCACGAACAACTGTGGGACGAGTTCCGATCAAAATTCCAAGTGTCAAACCGCTTGGATCAATTCTGCCGATGAC
TTTTGCGTCTGGGCACCGCCTGCTCTGGAAGCCATTGGGAGTAGTGAACGCTACGAAGTCGCTTGGTGTACCAAA
TCCGGGCGAGGTACCCGCGTCATTCCAGACGGTACCCTTAAAGGCGTCCATTTCGTCGAAACACCCGATTATGTA
CAAATAACCGGCCAGGGCGATTTCACGAAGATTAACATCCCAGCCGGTGATGCTGGAGGTGAACTTGATAACCGT
GGTGCTGATGGTAGAGGTAACCCCATTGGTGGATTAGTCTATGGCAATTCTTTCGGTCAAGGCCAGCAATTCCAT
GAATGGACCAACTTTATGTCGGATCATGAGTTCTGTTTCCGCGCTTGTCGAGGACCAAGAGCCATGGAGCTCTGT
AACCATGTGTTTGACGAGATGGGCTGTTACTGGAACATGCCCGCGAACTATGACCCCGGTTTTGAGAATTGTGAA
GGTGTCGACGCTGAACCGATGGGTGTATACACCGTTGATGGTCAACGCAGCACTTACACTCAAGGTCAAAGCCCG
ACTCCCCCGCCTCATCCTGCTCCTTCCTCTTCAAACTGTCAAGCTTTACCTACTGTTTCGTCTTCCCCGGTTCAA
GCCCGACGTGCACTTGACAGGAAGTTTGTGCCGAAGTTCCCTGAACACACTCCCGCTCCATCCTACTTCTGA
Gene >AgabiH97|078900
ATGATGCAGGAATCCTTTGCGCGTAAAGTTGTGCTTGCTGCTTTGATTGGAGCTTTGGGTGTTTTGGCGCAACAG
CCTGATGTTCCTACGTTTGTCTTGATTGCGATTTTTCGACGTGTTTCTCTTGATGATTTTCTTTCAGATACACCG
GCGAGCTCGTTATTCAGAACATCTTCGATAATGGTGCGTGGCATGGTGCTCTTTCACTACATTGATTATTGATGC
CATCTTATTCTTTTAGGCAAATGCATGACCGCCGCATCCAACTCCGATGGCGCCGCTGTGACCCTCCAAGGCTGT
ACCGGTGCTGCTTCTCAAAAATGGGTTTTCCAAGATGGGAGCGTCAAAGTTCATGGAAACAAATGCTTGGACGTC
TCTAGCGGCGCTGATGCCAATGGAACGAAGATGCAGATTTTCACTTGTAGCTCGGGTAATGCGAATCAACAGTGG
TCGTATGATGTTGTGAGTTGTTCGGTTATATGCTACTCTTGACGTGATGAGCGAGCATTGTTTTTAGTGGAGTAA
ACGCTTATCCTGGAAAGGACATAACAAGTGTCTTGATCTTTCTGCTGGTAGCACCGCAGATGGAAATCGAGTAAG
TACTTTGGTTTACACTTTCGTCTGTTCGCGATGTCATTCTTATGTGCACTTTTCAAAGCTTCAAATCTGGGATTG
TGTCTGGAACCCCAATCAATTCTGGAATACAGGATACCTGTCCAATAGCCTCCCTCAAACAAGTCAAGCAGAACA
GTTCGGCACGAACAACTGTGGGACGAGTTCCGATCAAAATTCCAAGTGTCAAACCGCTTGGATCAAGTACGTTAA
TGAATGGTTCATTAATTTAACTTTAATCTCATTTAATTTAGTTCTGCCGATGACTTTTGCGTCTGGGCACCGCGT
AAGCCTTGATCATTAAGAAGCGTTAACCCTATACTTAATTATATTCGGTTAGCTGCTCTGGAAGCCATTGGGAGT
AGTGAACGCTACGAAGTCGCTTGGTGTACCAAATCCGGGCGAGGTACCCGCGTCATTCCAGACGGTACCCTTAAA
GGCGTCCATTTCGTCGAAACACCCGATTATGTACAAATAACCGGCCAGGGCGATTTCACGAAGATTAACATCCCA
GCCGGTGATGCTGGAGGTGAACTTGATAACCGTGGTGCTGATGGTAGAGGTAACCCCAGTACGTTTTATCACCTC
TTCATGTTACTTCCGAAAGACTGAGATATGGTTCTTGATAGTTGGTGGATTAGTCTATGGCAATTCTTTCGGTCA
AGGCCAGCAATTCCATGAATGGACCAACTTTATGTCGGATCATGAGTTCTGTTTCCGCGCTTGTCGAGGACCAAG
AGCCATGGAGCTCTGTAACCATGTGTTTGACGAGATGGGCTGTTACTGGGTACGTCGGTTGTTTATCCACTGCGA
ATTAGCCGAAATTTGACATTGAATGGTATAGAACATGCCCGCGAACTATGACCCCGGTTTTGAGAATTGTGAAGG
TGTCGACGCGTAAGTTGCTCCCGTCTTGTCATCGCATAGATATAATGCTCATAACATCTTGCGCCAGTGAACCGA
TGGGTGTATACACCGTTGATGGTCAACGCAGCACTTACACTCAAGGTCAAAGCCCGACTCCCCCGCCTCATCCTG
CTCCTTCCTCTTCAAACTGTCAAGCTTTACCTACTGTTTCGTCTTCCCCGGTTCAAGCCCGACGTGCACTTGACA
GGAAGTTTGTGCCGAAGTTCCCTGAACACACTCCCGCTCCATCCTACTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail