Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|078690
Gene name
Locationscaffold_5:116654..118748
Strand-
Gene length (bp)2094
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16862 Glyco_hydro_79C Glycosyl hydrolase family 79 C-terminal beta domain 2.3E-13 405 503

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 61.65 36.28 87.02
Initials Initials knots 38.06 22.53 53.59
Pileal_Stipeal_center Stage I stipe center 38.04 22.54 53.55
Pileal_Stipeal_shell Stage I stipe shell 34.33 19.99 48.67
DIF_stipe_center Stage II stipe center 26.10 15.01 37.19
DIF_stipe_shell Stage II stipe shell 37.64 22.29 52.99
DIF_stipe_skin Stage II stipe skin 37.89 22.15 53.63
DIF_cap_skin Stage II cap skin 50.48 30.22 70.75
DIF_cap_tissue Stage II cap tissue 41.22 24.19 58.24
DIF_gill_tissue Stage II gill tissue 31.16 18.20 44.12
YFB_stipe_center Young fruiting body stipe center 39.86 23.65 56.07
YFB_stipe_shell Young fruiting body stipe shell 41.27 24.57 57.98
YFB_stipe_skin Young fruiting body stipe skin 34.48 20.14 48.81
YFB_cap_skin Young fruiting body cap skin 52.80 31.64 73.97
YFB_cap_tissue Young fruiting body cap tissue 60.88 36.36 85.40
YFB_gill_tissue Young fruiting body gill tissue 55.14 32.83 77.45
YFB_veil Young fruiting body veil 44.97 26.73 63.21

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.008791 yes
Casing YFB_stipe_center 0.134864 no
Casing YFB_stipe_shell 0.181805 no
Casing YFB_stipe_skin 0.036455 yes
Casing YFB_cap_skin 0.711090 no
Casing YFB_cap_tissue 0.981291 no
Casing YFB_gill_tissue 0.808936 no
Casing YFB_veil 0.328438 no
Casing Initials 0.087251 no
Casing Pileal_Stipeal_center 0.092165 no
Casing Pileal_Stipeal_shell 0.029890 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.082455 no
Casing DIF_stipe_skin 0.090151 no
Casing DIF_cap_skin 0.596803 no
Casing DIF_cap_tissue 0.187799 no
DIF_gill_tissue YFB_stipe_center 0.487194 no
DIF_gill_tissue YFB_stipe_shell 0.409296 no
DIF_gill_tissue YFB_stipe_skin 0.835812 no
DIF_gill_tissue YFB_cap_skin 0.057747 no
DIF_gill_tissue YFB_cap_tissue 0.009446 yes
DIF_gill_tissue YFB_gill_tissue 0.036228 yes
DIF_gill_tissue YFB_veil 0.237009 no
YFB_stipe_center YFB_stipe_shell 0.950369 no
YFB_stipe_center YFB_stipe_skin 0.729738 no
YFB_stipe_center YFB_cap_skin 0.383625 no
YFB_stipe_center YFB_cap_tissue 0.128525 no
YFB_stipe_center YFB_gill_tissue 0.296701 no
YFB_stipe_center YFB_veil 0.787637 no
YFB_stipe_shell YFB_stipe_skin 0.652627 no
YFB_stipe_shell YFB_cap_skin 0.477576 no
YFB_stipe_shell YFB_cap_tissue 0.186180 no
YFB_stipe_shell YFB_gill_tissue 0.383961 no
YFB_stipe_shell YFB_veil 0.862221 no
YFB_stipe_skin YFB_cap_skin 0.138282 no
YFB_stipe_skin YFB_cap_tissue 0.036683 yes
YFB_stipe_skin YFB_gill_tissue 0.103148 no
YFB_stipe_skin YFB_veil 0.441575 no
YFB_cap_skin YFB_cap_tissue 0.720783 no
YFB_cap_skin YFB_gill_tissue 0.935521 no
YFB_cap_skin YFB_veil 0.690471 no
YFB_cap_tissue YFB_gill_tissue 0.832755 no
YFB_cap_tissue YFB_veil 0.340799 no
YFB_gill_tissue YFB_veil 0.588103 no
Initials DIF_gill_tissue 0.602887 no
Initials YFB_stipe_center 0.930887 no
Initials YFB_stipe_shell 0.870239 no
Initials YFB_stipe_skin 0.838100 no
Initials YFB_cap_skin 0.291341 no
Initials YFB_cap_tissue 0.086750 no
Initials YFB_gill_tissue 0.220561 no
Initials YFB_veil 0.681249 no
Initials Pileal_Stipeal_center 0.999212 no
Initials Pileal_Stipeal_shell 0.825985 no
Initials DIF_stipe_center 0.229585 no
Initials DIF_stipe_shell 0.984583 no
Initials DIF_stipe_skin 0.993056 no
Initials DIF_cap_skin 0.383711 no
Initials DIF_cap_tissue 0.874271 no
Pileal_Stipeal_center DIF_gill_tissue 0.602401 no
Pileal_Stipeal_center YFB_stipe_center 0.929662 no
Pileal_Stipeal_center YFB_stipe_shell 0.869389 no
Pileal_Stipeal_center YFB_stipe_skin 0.837663 no
Pileal_Stipeal_center YFB_cap_skin 0.287011 no
Pileal_Stipeal_center YFB_cap_tissue 0.086247 no
Pileal_Stipeal_center YFB_gill_tissue 0.215960 no
Pileal_Stipeal_center YFB_veil 0.680906 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.826353 no
Pileal_Stipeal_center DIF_stipe_center 0.225592 no
Pileal_Stipeal_center DIF_stipe_shell 0.984696 no
Pileal_Stipeal_center DIF_stipe_skin 0.993627 no
Pileal_Stipeal_center DIF_cap_skin 0.380464 no
Pileal_Stipeal_center DIF_cap_tissue 0.873422 no
Pileal_Stipeal_shell DIF_gill_tissue 0.844952 no
Pileal_Stipeal_shell YFB_stipe_center 0.725446 no
Pileal_Stipeal_shell YFB_stipe_shell 0.645443 no
Pileal_Stipeal_shell YFB_stipe_skin 0.992977 no
Pileal_Stipeal_shell YFB_cap_skin 0.132135 no
Pileal_Stipeal_shell YFB_cap_tissue 0.034837 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.096131 no
Pileal_Stipeal_shell YFB_veil 0.437079 no
Pileal_Stipeal_shell DIF_stipe_center 0.444784 no
Pileal_Stipeal_shell DIF_stipe_shell 0.850896 no
Pileal_Stipeal_shell DIF_stipe_skin 0.840593 no
Pileal_Stipeal_shell DIF_cap_skin 0.194492 no
Pileal_Stipeal_shell DIF_cap_tissue 0.649677 no
DIF_stipe_center DIF_gill_tissue 0.666610 no
DIF_stipe_center YFB_stipe_center 0.150164 no
DIF_stipe_center YFB_stipe_shell 0.115964 no
DIF_stipe_center YFB_stipe_skin 0.426897 no
DIF_stipe_center YFB_cap_skin 0.006387 yes
DIF_stipe_center YFB_cap_tissue 0.001140 yes
DIF_stipe_center YFB_gill_tissue 0.003365 yes
DIF_stipe_center YFB_veil 0.048422 yes
DIF_stipe_center DIF_stipe_shell 0.239320 no
DIF_stipe_center DIF_stipe_skin 0.236682 no
DIF_stipe_center DIF_cap_skin 0.011350 yes
DIF_stipe_center DIF_cap_tissue 0.122909 no
DIF_stipe_shell DIF_gill_tissue 0.627276 no
DIF_stipe_shell YFB_stipe_center 0.912425 no
DIF_stipe_shell YFB_stipe_shell 0.846437 no
DIF_stipe_shell YFB_stipe_skin 0.856961 no
DIF_stipe_shell YFB_cap_skin 0.261343 no
DIF_stipe_shell YFB_cap_tissue 0.077698 no
DIF_stipe_shell YFB_gill_tissue 0.195928 no
DIF_stipe_shell YFB_veil 0.652826 no
DIF_stipe_shell DIF_stipe_skin 0.990604 no
DIF_stipe_shell DIF_cap_skin 0.354742 no
DIF_stipe_shell DIF_cap_tissue 0.851345 no
DIF_stipe_skin DIF_gill_tissue 0.621431 no
DIF_stipe_skin YFB_stipe_center 0.923357 no
DIF_stipe_skin YFB_stipe_shell 0.863128 no
DIF_stipe_skin YFB_stipe_skin 0.847768 no
DIF_stipe_skin YFB_cap_skin 0.294143 no
DIF_stipe_skin YFB_cap_tissue 0.092841 no
DIF_stipe_skin YFB_gill_tissue 0.221711 no
DIF_stipe_skin YFB_veil 0.677181 no
DIF_stipe_skin DIF_cap_skin 0.385626 no
DIF_stipe_skin DIF_cap_tissue 0.867639 no
DIF_cap_skin DIF_gill_tissue 0.081238 no
DIF_cap_skin YFB_stipe_center 0.489780 no
DIF_cap_skin YFB_stipe_shell 0.582080 no
DIF_cap_skin YFB_stipe_skin 0.196516 no
DIF_cap_skin YFB_cap_skin 0.932506 no
DIF_cap_skin YFB_cap_tissue 0.604801 no
DIF_cap_skin YFB_gill_tissue 0.853532 no
DIF_cap_skin YFB_veil 0.796705 no
DIF_cap_skin DIF_cap_tissue 0.581813 no
DIF_cap_tissue DIF_gill_tissue 0.415294 no
DIF_cap_tissue YFB_stipe_center 0.951387 no
DIF_cap_tissue YFB_stipe_shell 0.997593 no
DIF_cap_tissue YFB_stipe_skin 0.660009 no
DIF_cap_tissue YFB_cap_skin 0.479466 no
DIF_cap_tissue YFB_cap_tissue 0.186312 no
DIF_cap_tissue YFB_gill_tissue 0.384654 no
DIF_cap_tissue YFB_veil 0.862154 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|078690
MAARYGLLLLTFLLSPVFAAASVNVTFPAQPPSVALLNTIEDNFIGISWELSSFDSLWGTTVDKQPSAMQNYLHN
LISRMSKPLRIRVGGNSMDGSSYVPDQTTPLVLTDPNAYFNDVPVNFGPALFDIMNGMSDKVGAMQFMIGLSMRF
PERWNEVLRLAQDTENKLGDRLDALLLGNEPDLYAGHGERGAYSIKDYVPEIDEVMGLLGNNSLLERPIIGGPTI
CCTWELDDLFKAGFDEFNYKYYTVQHYPNNICNGENESNTNLTYYLTHANIEGFLEWQKEGVIKAKKQNIPVLLT
EYNTVSCGGSKISSTFGAGLWAIDTGLKATTMNYSAVYLHTREHGVQYNLFDPPTPETSTEPGWITGSPYYSALF
LSEVADPSGSIVVDLNVNKSNTNQFATVAGYGIYDGSGQNRSGLVLINYASPTQEGDDKTQQFSIPANVTDKISY
RILTAPSVTEKTDITWAGQTVGVNGDLQGAQHTESLSCDEGCLIDVPGPGAVLAVFGKIGEQRLFTGNSTIAPLA
TDTSGSGVIFKMPPFSLSILVVLAFIFL*
Coding >AgabiH97|078690
ATGGCAGCACGATACGGCCTCCTCCTTCTCACCTTTTTGCTGTCACCTGTTTTCGCAGCGGCATCAGTCAATGTG
ACTTTTCCTGCCCAACCACCTTCTGTTGCACTCTTGAATACAATCGAGGATAATTTCATTGGGATCTCATGGGAA
TTGAGCTCATTCGATTCACTATGGGGCACGACCGTCGATAAGCAGCCGAGTGCTATGCAAAACTACCTACATAAT
CTAATAAGTCGAATGTCTAAGCCGCTCAGAATCCGTGTTGGTGGGAATTCCATGGATGGGTCAAGCTATGTACCC
GACCAGACGACACCGCTCGTATTGACCGACCCTAACGCATATTTCAACGATGTTCCTGTCAATTTCGGACCCGCG
CTATTTGACATCATGAATGGCATGTCGGATAAGGTGGGGGCCATGCAGTTCATGATCGGTCTCAGTATGCGCTTC
CCGGAGAGATGGAATGAGGTCCTACGACTGGCTCAGGACACGGAGAATAAACTTGGCGATAGATTAGATGCTTTG
CTCTTGGGCAACGAACCTGATTTATATGCTGGTCATGGAGAGCGCGGTGCTTACTCCATTAAGGATTATGTTCCT
GAGATCGACGAAGTGATGGGGCTACTGGGCAATAATAGTCTGCTGGAACGGCCTATTATCGGGGGTCCGACAATC
TGTTGCACTTGGGAGCTGGATGATCTTTTCAAGGCGGGTTTCGACGAATTCAACTATAAGTATTATACCGTTCAA
CACTATCCTAACAACATTTGCAACGGCGAAAACGAAAGCAATACTAACCTTACATATTACTTGACACATGCCAAT
ATCGAAGGATTCCTTGAATGGCAAAAGGAGGGCGTAATAAAAGCCAAAAAGCAGAACATACCAGTCCTCCTCACC
GAATATAACACTGTCTCATGTGGTGGTTCCAAGATATCGTCTACCTTCGGAGCGGGCCTCTGGGCAATAGATACC
GGTCTTAAAGCGACAACAATGAACTATTCCGCAGTCTACCTTCACACTCGCGAACATGGAGTTCAGTACAACCTA
TTTGATCCTCCGACCCCAGAGACGAGCACGGAACCTGGTTGGATTACGGGATCACCTTACTATTCCGCCCTCTTT
CTATCGGAAGTCGCCGATCCGTCTGGTTCCATTGTAGTTGACCTCAACGTCAACAAATCCAACACCAACCAATTT
GCCACTGTGGCCGGATATGGGATTTACGATGGATCAGGTCAAAACAGAAGCGGCCTTGTACTCATCAACTATGCA
AGTCCGACCCAAGAAGGGGATGACAAAACACAACAATTCAGTATACCTGCAAACGTCACTGACAAAATCAGTTAC
CGCATCCTTACTGCTCCCTCTGTGACGGAAAAGACGGACATCACCTGGGCGGGACAAACCGTTGGCGTAAATGGT
GATTTGCAAGGTGCCCAACATACAGAATCGTTGAGTTGCGATGAGGGTTGTTTAATCGATGTCCCTGGTCCTGGA
GCTGTGCTTGCTGTTTTCGGCAAAATTGGAGAACAGAGATTGTTCACTGGTAATTCGACCATTGCCCCACTGGCG
ACTGACACCTCTGGAAGCGGTGTAATATTTAAAATGCCCCCATTTTCGCTTTCTATTCTCGTTGTACTTGCTTTC
ATCTTTCTTTGA
Transcript >AgabiH97|078690
ATGGCAGCACGATACGGCCTCCTCCTTCTCACCTTTTTGCTGTCACCTGTTTTCGCAGCGGCATCAGTCAATGTG
ACTTTTCCTGCCCAACCACCTTCTGTTGCACTCTTGAATACAATCGAGGATAATTTCATTGGGATCTCATGGGAA
TTGAGCTCATTCGATTCACTATGGGGCACGACCGTCGATAAGCAGCCGAGTGCTATGCAAAACTACCTACATAAT
CTAATAAGTCGAATGTCTAAGCCGCTCAGAATCCGTGTTGGTGGGAATTCCATGGATGGGTCAAGCTATGTACCC
GACCAGACGACACCGCTCGTATTGACCGACCCTAACGCATATTTCAACGATGTTCCTGTCAATTTCGGACCCGCG
CTATTTGACATCATGAATGGCATGTCGGATAAGGTGGGGGCCATGCAGTTCATGATCGGTCTCAGTATGCGCTTC
CCGGAGAGATGGAATGAGGTCCTACGACTGGCTCAGGACACGGAGAATAAACTTGGCGATAGATTAGATGCTTTG
CTCTTGGGCAACGAACCTGATTTATATGCTGGTCATGGAGAGCGCGGTGCTTACTCCATTAAGGATTATGTTCCT
GAGATCGACGAAGTGATGGGGCTACTGGGCAATAATAGTCTGCTGGAACGGCCTATTATCGGGGGTCCGACAATC
TGTTGCACTTGGGAGCTGGATGATCTTTTCAAGGCGGGTTTCGACGAATTCAACTATAAGTATTATACCGTTCAA
CACTATCCTAACAACATTTGCAACGGCGAAAACGAAAGCAATACTAACCTTACATATTACTTGACACATGCCAAT
ATCGAAGGATTCCTTGAATGGCAAAAGGAGGGCGTAATAAAAGCCAAAAAGCAGAACATACCAGTCCTCCTCACC
GAATATAACACTGTCTCATGTGGTGGTTCCAAGATATCGTCTACCTTCGGAGCGGGCCTCTGGGCAATAGATACC
GGTCTTAAAGCGACAACAATGAACTATTCCGCAGTCTACCTTCACACTCGCGAACATGGAGTTCAGTACAACCTA
TTTGATCCTCCGACCCCAGAGACGAGCACGGAACCTGGTTGGATTACGGGATCACCTTACTATTCCGCCCTCTTT
CTATCGGAAGTCGCCGATCCGTCTGGTTCCATTGTAGTTGACCTCAACGTCAACAAATCCAACACCAACCAATTT
GCCACTGTGGCCGGATATGGGATTTACGATGGATCAGGTCAAAACAGAAGCGGCCTTGTACTCATCAACTATGCA
AGTCCGACCCAAGAAGGGGATGACAAAACACAACAATTCAGTATACCTGCAAACGTCACTGACAAAATCAGTTAC
CGCATCCTTACTGCTCCCTCTGTGACGGAAAAGACGGACATCACCTGGGCGGGACAAACCGTTGGCGTAAATGGT
GATTTGCAAGGTGCCCAACATACAGAATCGTTGAGTTGCGATGAGGGTTGTTTAATCGATGTCCCTGGTCCTGGA
GCTGTGCTTGCTGTTTTCGGCAAAATTGGAGAACAGAGATTGTTCACTGGTAATTCGACCATTGCCCCACTGGCG
ACTGACACCTCTGGAAGCGGTGTAATATTTAAAATGCCCCCATTTTCGCTTTCTATTCTCGTTGTACTTGCTTTC
ATCTTTCTTTGA
Gene >AgabiH97|078690
ATGGCAGCACGATACGGCCTCCTCCTTCTCACCTTTTTGCTGTCACCTGTTTTCGCAGCGGCATCAGTCAATGTG
ACTTTTCCTGCCCAACCACCTTCTGTTGCACTCTTGAATACAATCGAGGATAATTTCATTGGGATCTCATGGGAA
TTGAGCTCATTCGATTCACTATGTGAGTGGCGCCCATTCTCTACTCGCTGAGCGAGTTTTCTCATCGATGATGAA
GGGGGCACGACCGTCGATAAGCAGCCGAGTGCTATGCAAAACTACCTACATAATCTAATAAGTCGAATGTCTAAG
CCGCTCAGAATCCGTGTTGGTGGGAATTCCATGGATGGGTAAGTCTGCAAAGCTAGAATATCTGAATTTGACACT
TAATTTGCCCTAGGTCAAGCTATGTACCCGACCAGACGACACCGCTCGTATTGACCGACCCTAACGCATATTTCA
ACGATGTTCCTGTCAATTTCGGACCCGCGCTATTTGACATCATGAATGGCATGTCGGATAAGGTGGGGGCCATGC
AGTTCATGATCGGTCTCAGTATGCGCTTCCCGGAGAGATGGAATGAGGTCCTACGACTGGCTCAGGACACGGAGA
ATAAACTTGGCGATAGATTAGATGCTTTGCTCTTGGGCAACGTGAGTACAGGTGATTGATCGTAGGCTGAGCTCA
CGATCTCTGCCATAGGAACCTGATTTATATGCTGGTCATGGAGAGCGCGGTGCTTACTCCATTAAGGATTATGTT
AGTATACCCTGGTCGTAGCCCTATCTCTAACTGATCGAAAACCGATTCAATAGGTTCCTGAGATCGACGAAGTGA
TGGGGCTACTGGGCAATAATAGTCTGCTGGAACGGCCTATTATCGGGGGTCCGACAATCTGTTGCACTTGGTGCG
CCATGTTCCTCTATTATGCTTACCCTTGGAATTTACCGCGTTTGAAAGGGAGCTGGATGATCTTTTCAAGGCGGG
TTTCGACGAATTCAACTATAAGTATTATACGTCAGTTCAGTTCCAGTTATATTTTACTGGATAACATTTAACCAC
CTTTGAATAGCGTTCAACACTATCCTAACAACATTTGCAACGGCGAAAACGAAAGCAATACTAACCTTACATATT
ACTTGACACATGCCAATAGTACGCACCATCAATCATTTCTCGTTTGTCGCGTCTGATACTTAACATCTAATCAGT
CGAAGGATTCCTTGAATGGCAAAAGGAGGGCGTAATAAAAGCCAAAAAGCAGAACATACCAGTCCTCCTCACCGA
ATATAACACTGTCTCATGTGGTGGTTCCAAGATATCGTCTACCGTATGTATCTCACTTTTTCATTCTATTTTTTT
TTCTCTCAGTAATGACGAATTATGCAGTTCGGAGCGGGCCTCTGGGCAATAGATACCGGTCTTAAAGCGACAACA
ATGAACTATTCCGCAGTCTACCTTCACACTCGCGAACATGGAGTTCAGTACAACCTATTTGATCCTCCGACCCCA
GAGACGAGCACGGAACCTGGTTGGATTACGGGATCACCTTACTATTCCGCCCTCTTTCTATCGGAAGTCGCCGAT
CCGTCTGGTTCCATTGTAGTTGACCTCAACGTCAACAAATCCAACACCAACCAATTTGCCACTGTGGCCGGATAT
GGGATTTACGATGGATCAGGTCAAAACAGAAGCGGCCTTGTACTCATCAACTATGCAAGTCCGACCCAAGAAGGG
GATGACAAAACACAACAATTCAGTATACCTGCAAACGTCACTGACAAAATCAGTTACCGCATCCTTACTGCTCCC
TCTGTGACGGAAAAGACGGACATCACCTGGGCGGGACAAACCGTTGGCGTAAATGGTGATTTGCAAGGTGCCCAA
CATACAGAATCGTTGAGTTGCGATGAGGGTTGTTTAATCGATGTCCCTGGTCCTGGAGCTGTGCTTGCTGTTTTC
GGCAAAATTGGAGAACAGAGATTGTTCACTGGTAATTCGACCATTGCCCCACTGGCGACTGACACCTCTGGAAGC
GGTGTAATATTTAAAATGCCCCCATTTTCGCTTTCTATTCTCGTTGTACTTGCTTTCATCTTTCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail