Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|078190
Gene name
Locationscaffold_4:3099613..3100215
Strand-
Gene length (bp)602
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.3E-10 48 101

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|078190
MQASNLILFTSLAILAARAQSHDDSPSSFGLPPATFTPRPTSKGSYPLPPCVLKCLTDALQSSDCKVNDQACACT
NPAYQNASKACIETRCLPEDQEKAARLQDHCSDISDDRIVSSTQPQTPTIINYAEETGRVVNVAFSVNELQGWRK
GVIAALSLFLAV*
Coding >AgabiH97|078190
ATGCAAGCCTCCAACCTCATTTTATTCACATCCCTTGCCATCCTTGCCGCTCGAGCACAAAGTCACGACGATTCA
CCATCCTCATTCGGGCTACCTCCGGCCACATTTACTCCCCGTCCCACATCCAAGGGAAGCTATCCACTTCCCCCA
TGCGTGTTGAAATGCCTTACCGACGCGCTGCAATCTTCCGATTGTAAAGTAAACGATCAAGCCTGCGCGTGCACC
AATCCAGCTTACCAGAACGCTAGTAAAGCTTGTATCGAAACGAGATGTCTACCAGAAGATCAAGAGAAAGCGGCT
CGCCTTCAAGATCACTGCTCGGATATATCGGATGACAGGATTGTTTCTTCAACCCAACCTCAGACTCCAACGATC
ATCAATTACGCAGAAGAGACGGGGCGCGTGGTGAATGTTGCTTTCAGTGTCAATGAACTTCAAGGCTGGAGGAAG
GGGGTGATAGCAGCGCTGTCGCTTTTCCTAGCAGTTTGA
Transcript >AgabiH97|078190
ATGCAAGCCTCCAACCTCATTTTATTCACATCCCTTGCCATCCTTGCCGCTCGAGCACAAAGTCACGACGATTCA
CCATCCTCATTCGGGCTACCTCCGGCCACATTTACTCCCCGTCCCACATCCAAGGGAAGCTATCCACTTCCCCCA
TGCGTGTTGAAATGCCTTACCGACGCGCTGCAATCTTCCGATTGTAAAGTAAACGATCAAGCCTGCGCGTGCACC
AATCCAGCTTACCAGAACGCTAGTAAAGCTTGTATCGAAACGAGATGTCTACCAGAAGATCAAGAGAAAGCGGCT
CGCCTTCAAGATCACTGCTCGGATATATCGGATGACAGGATTGTTTCTTCAACCCAACCTCAGACTCCAACGATC
ATCAATTACGCAGAAGAGACGGGGCGCGTGGTGAATGTTGCTTTCAGTGTCAATGAACTTCAAGGCTGGAGGAAG
GGGGTGATAGCAGCGCTGTCGCTTTTCCTAGCAGTTTGA
Gene >AgabiH97|078190
ATGCAAGCCTCCAACCTCATTTTATTCACATCCCTTGCCATCCTTGCCGCTCGAGCACAAAGTCACGACGATTCA
CCATCCTCATTCGGGCTACCTCCGGCCACATTTACTCCCCGTCCCACATCCAAGGGAAGCTATCCACTTCCCCCA
TGCGTGTTGAAATGCCTTACCGACGCGCTGCAATCTTCCGATTGTAAAGTGTATGAACTCTTACTTTCCTTTGTC
CGTGATAAAGTTGTATTCAAAGTAACCTAGAAACGATCAAGCCTGCGCGTGCACCAATCCAGCTTACCAGAACGC
TAGTAAAGCTTGTATCGAAACGAGATGTCTACCAGAAGATCAAGAGAAAGCGGCTCGCCTTCAAGATCACTGCTC
GGATATATGTATGTTCGCATCCTACAATCGATCCGGGATGAATTGAACATGTCCGTTATTTATTAGCGGATGACA
GGATTGTTTCTTCAACCCAACCTCAGACTCCAACGATCATCAATTACGCAGAAGAGACGGGGCGCGTGGTGAATG
TTGCTTTCAGTGTCAATGAACTTCAAGGCTGGAGGAAGGGGGTGATAGCAGCGCTGTCGCTTTTCCTAGCAGTTT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail