Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|078180
Gene name
Locationscaffold_4:3098825..3099418
Strand+
Gene length (bp)593
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 3.1E-10 60 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SK39|SBP3_ARATH Probable steroid-binding protein 3 OS=Arabidopsis thaliana GN=MP3 PE=1 SV=1 59 154 4.0E-26
sp|Q9M2Z4|MSBP2_ARATH Membrane steroid-binding protein 2 OS=Arabidopsis thaliana GN=MSBP2 PE=1 SV=1 40 162 2.0E-21
sp|O13995|DAP1_SCHPO Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dap1 PE=1 SV=1 4 154 4.0E-20
sp|Q60YT6|NEUFC_CAEBR Neuferricin homolog OS=Caenorhabditis briggsae GN=tag-131 PE=3 SV=1 23 156 7.0E-19
sp|Q6IUR5|NENF_RAT Neudesin OS=Rattus norvegicus GN=Nenf PE=2 SV=1 22 152 9.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SK39|SBP3_ARATH Probable steroid-binding protein 3 OS=Arabidopsis thaliana GN=MP3 PE=1 SV=1 59 154 4.0E-26
sp|Q9M2Z4|MSBP2_ARATH Membrane steroid-binding protein 2 OS=Arabidopsis thaliana GN=MSBP2 PE=1 SV=1 40 162 2.0E-21
sp|O13995|DAP1_SCHPO Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dap1 PE=1 SV=1 4 154 4.0E-20
sp|Q60YT6|NEUFC_CAEBR Neuferricin homolog OS=Caenorhabditis briggsae GN=tag-131 PE=3 SV=1 23 156 7.0E-19
sp|Q6IUR5|NENF_RAT Neudesin OS=Rattus norvegicus GN=Nenf PE=2 SV=1 22 152 9.0E-19
sp|Q9XXA7|NEUFC_CAEEL Neuferricin homolog OS=Caenorhabditis elegans GN=tag-131 PE=3 SV=1 30 156 2.0E-18
sp|Q9CQ45|NENF_MOUSE Neudesin OS=Mus musculus GN=Nenf PE=1 SV=1 45 152 6.0E-18
sp|Q9XFM6|MSBP1_ARATH Membrane steroid-binding protein 1 OS=Arabidopsis thaliana GN=MSBP1 PE=1 SV=2 59 154 1.0E-17
sp|Q1JQA5|NENF_BOVIN Neudesin OS=Bos taurus GN=NENF PE=2 SV=1 27 152 1.0E-16
sp|Q9UMX5|NENF_HUMAN Neudesin OS=Homo sapiens GN=NENF PE=1 SV=1 45 152 2.0E-16
sp|Q5XIU9|PGRC2_RAT Membrane-associated progesterone receptor component 2 OS=Rattus norvegicus GN=Pgrmc2 PE=1 SV=1 1 154 7.0E-15
sp|Q80UU9|PGRC2_MOUSE Membrane-associated progesterone receptor component 2 OS=Mus musculus GN=Pgrmc2 PE=1 SV=2 1 154 7.0E-15
sp|Q5ZKN2|PGRC1_CHICK Membrane-associated progesterone receptor component 1 OS=Gallus gallus GN=PGRMC1 PE=2 SV=3 31 154 4.0E-14
sp|Q2HIW2|MAPR4_ARATH Membrane-associated progesterone-binding protein 4 OS=Arabidopsis thaliana GN=MAPR4 PE=2 SV=1 59 154 1.0E-13
sp|O15173|PGRC2_HUMAN Membrane-associated progesterone receptor component 2 OS=Homo sapiens GN=PGRMC2 PE=1 SV=1 45 154 1.0E-13
sp|Q95250|PGRC1_PIG Membrane-associated progesterone receptor component 1 OS=Sus scrofa GN=PGRMC1 PE=1 SV=3 59 154 1.0E-12
sp|Q5RED0|PGRC1_PONAB Membrane-associated progesterone receptor component 1 OS=Pongo abelii GN=PGRMC1 PE=2 SV=3 59 154 1.0E-12
sp|O00264|PGRC1_HUMAN Membrane-associated progesterone receptor component 1 OS=Homo sapiens GN=PGRMC1 PE=1 SV=3 59 154 1.0E-12
sp|A2CES0|NEUFC_DANRE Neuferricin OS=Danio rerio GN=cyb5d2 PE=3 SV=1 59 154 2.0E-12
sp|Q28FI8|NEUFC_XENTR Neuferricin OS=Xenopus tropicalis GN=cyb5d2 PE=2 SV=1 59 155 2.0E-12
sp|O55022|PGRC1_MOUSE Membrane-associated progesterone receptor component 1 OS=Mus musculus GN=Pgrmc1 PE=1 SV=4 59 154 3.0E-12
sp|Q17QC0|PGRC1_BOVIN Membrane-associated progesterone receptor component 1 OS=Bos taurus GN=PGRMC1 PE=2 SV=3 59 154 3.0E-12
sp|P70580|PGRC1_RAT Membrane-associated progesterone receptor component 1 OS=Rattus norvegicus GN=Pgrmc1 PE=1 SV=3 59 154 1.0E-11
sp|Q8WUJ1|NEUFC_HUMAN Neuferricin OS=Homo sapiens GN=CYB5D2 PE=2 SV=1 59 155 3.0E-11
sp|Q9W376|NEUFC_DROME Neuferricin homolog OS=Drosophila melanogaster GN=CG12056 PE=2 SV=1 59 154 1.0E-10
sp|Q6AY62|NEUFC_RAT Neuferricin OS=Rattus norvegicus GN=Cyb5d2 PE=2 SV=1 59 154 5.0E-10
sp|Q5SSH8|NEUFC_MOUSE Neuferricin OS=Mus musculus GN=Cyb5d2 PE=1 SV=1 59 154 8.0E-10
sp|Q29HF1|NEUFC_DROPS Neuferricin homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA11364 PE=3 SV=1 59 156 2.0E-09
sp|Q12091|DAP1_YEAST Damage response protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAP1 PE=1 SV=1 59 161 3.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 2 19 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|078180
MLVLVYVLVIFLPPTYLAYRHYWHRPLTPSIPAEDPKKAPKSIMQPPRTDLAPPKDDPFTTEQLKEFDGSDSSKP
IYVAIKGDIFDVSHKADSYGKGHSYNIFAGKDGSRGLGKSSLKSEDAIADYSTLDDKERKVLDDWHSFFSKRYNI
VGRISDGPKVES*
Coding >AgabiH97|078180
ATGTTGGTTTTGGTCTACGTGCTCGTGATATTCCTGCCTCCCACCTACCTCGCTTATCGTCACTACTGGCACCGT
CCTCTCACCCCCTCAATACCCGCGGAAGACCCCAAAAAGGCGCCTAAATCCATCATGCAACCGCCCAGAACAGAT
CTTGCACCTCCAAAAGACGATCCATTCACTACCGAGCAATTGAAGGAATTCGACGGAAGCGATTCGTCTAAGCCG
ATTTATGTCGCTATCAAAGGTGACATCTTCGACGTCTCGCACAAAGCTGATTCGTACGGAAAGGGACATTCCTAT
AATATATTCGCTGGAAAAGATGGGTCTCGTGGACTCGGAAAATCGAGTTTGAAATCGGAGGATGCGATAGCGGAT
TACAGTACGCTGGATGATAAGGAGCGCAAGGTGTTGGATGACTGGCATTCGTTCTTTTCTAAACGCTACAATATT
GTTGGGCGCATTAGTGATGGTCCCAAAGTTGAATCGTAA
Transcript >AgabiH97|078180
ATGTTGGTTTTGGTCTACGTGCTCGTGATATTCCTGCCTCCCACCTACCTCGCTTATCGTCACTACTGGCACCGT
CCTCTCACCCCCTCAATACCCGCGGAAGACCCCAAAAAGGCGCCTAAATCCATCATGCAACCGCCCAGAACAGAT
CTTGCACCTCCAAAAGACGATCCATTCACTACCGAGCAATTGAAGGAATTCGACGGAAGCGATTCGTCTAAGCCG
ATTTATGTCGCTATCAAAGGTGACATCTTCGACGTCTCGCACAAAGCTGATTCGTACGGAAAGGGACATTCCTAT
AATATATTCGCTGGAAAAGATGGGTCTCGTGGACTCGGAAAATCGAGTTTGAAATCGGAGGATGCGATAGCGGAT
TACAGTACGCTGGATGATAAGGAGCGCAAGGTGTTGGATGACTGGCATTCGTTCTTTTCTAAACGCTACAATATT
GTTGGGCGCATTAGTGATGGTCCCAAAGTTGAATCGTAA
Gene >AgabiH97|078180
ATGTTGGTTTTGGTCTACGTGCTCGTGATATTCCTGCCTCCCACCTACCTCGCTTATCGTCACTACTGGCACCGT
CCTCTCACCCCCTCAATACCCGCGGAAGACCCCAAAAAGGCGCCTAAATCCATCATGCAACCGCCCAGAACAGAT
CTTGCACCTCCAAAAGACGATCCATTCACTACCGAGCAATTGAAGGAATTCGACGGAAGCGATTCGTCTAAGCCG
ATTTATGTCGCTATCAAAGGTTTCATAAGTTGAAATTCTTCAGTCCTTCACCTTACTGACTCTTTGTGTTAGGTG
ACATCTTCGACGTCTCGCACAAAGCTGATTCGTACGGAAAGGGACATTCCTATAATATATTCGCTGGAAAAGATG
GGTCTCGTGGACTCGGAAAATCGAGTTTGAAATCGGAGGATGCGATAGCGGATTACAGTACGCTGGATGATAAGG
AGCGCAAGGTGTTGGATGACTGGCATTCGTTCTTTTCGTGCGTAACCTTGTTCTCTGGCACAGCGTGAATCTGAT
GTCGTGTCCGCAGTAAACGCTACAATATTGTTGGGCGCATTAGTGATGGTCCCAAAGTTGAATCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail