Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|078080
Gene name
Locationscaffold_4:3072215..3075329
Strand-
Gene length (bp)3114
Transcript length (bp)2595
Coding sequence length (bp)2595
Protein length (aa) 865

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07971 Glyco_hydro_92 Glycosyl hydrolase family 92 3.8E-140 322 799
PF17678 Glyco_hydro_92N Glycosyl hydrolase family 92 N-terminal domain 1.5E-49 47 316

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O86365|Y584_MYCTU Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0584 PE=3 SV=1 29 807 5.0E-48
sp|D4ATR3|A7629_ARTBC Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07629 PE=1 SV=1 43 806 5.0E-44

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 30.14 17.64 42.65
Initials Initials knots 16.57 9.56 23.59
Pileal_Stipeal_center Stage I stipe center 31.95 19.13 44.78
Pileal_Stipeal_shell Stage I stipe shell 30.34 18.17 42.52
DIF_stipe_center Stage II stipe center 32.77 19.66 45.89
DIF_stipe_shell Stage II stipe shell 26.93 16.00 37.86
DIF_stipe_skin Stage II stipe skin 28.20 16.84 39.56
DIF_cap_skin Stage II cap skin 29.06 17.33 40.78
DIF_cap_tissue Stage II cap tissue 37.28 22.43 52.13
DIF_gill_tissue Stage II gill tissue 34.76 20.90 48.61
YFB_stipe_center Young fruiting body stipe center 28.10 16.63 39.57
YFB_stipe_shell Young fruiting body stipe shell 25.52 15.15 35.89
YFB_stipe_skin Young fruiting body stipe skin 29.69 17.55 41.83
YFB_cap_skin Young fruiting body cap skin 25.51 15.07 35.95
YFB_cap_tissue Young fruiting body cap tissue 23.60 13.93 33.27
YFB_gill_tissue Young fruiting body gill tissue 30.44 18.10 42.78
YFB_veil Young fruiting body veil 34.73 20.89 48.58

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.741770 no
Casing YFB_stipe_center 0.891225 no
Casing YFB_stipe_shell 0.686886 no
Casing YFB_stipe_skin 0.979633 no
Casing YFB_cap_skin 0.684104 no
Casing YFB_cap_tissue 0.491489 no
Casing YFB_gill_tissue 0.986870 no
Casing YFB_veil 0.739283 no
Casing Initials 0.027451 yes
Casing Pileal_Stipeal_center 0.911894 no
Casing Pileal_Stipeal_shell 0.990021 no
Casing DIF_stipe_center 0.866473 no
Casing DIF_stipe_shell 0.805537 no
Casing DIF_stipe_skin 0.899454 no
Casing DIF_cap_skin 0.947574 no
Casing DIF_cap_tissue 0.565879 no
DIF_gill_tissue YFB_stipe_center 0.555105 no
DIF_gill_tissue YFB_stipe_shell 0.323417 no
DIF_gill_tissue YFB_stipe_skin 0.697145 no
DIF_gill_tissue YFB_cap_skin 0.318419 no
DIF_gill_tissue YFB_cap_tissue 0.184203 no
DIF_gill_tissue YFB_gill_tissue 0.759269 no
DIF_gill_tissue YFB_veil 0.998441 no
YFB_stipe_center YFB_stipe_shell 0.841447 no
YFB_stipe_center YFB_stipe_skin 0.918236 no
YFB_stipe_center YFB_cap_skin 0.840476 no
YFB_stipe_center YFB_cap_tissue 0.658032 no
YFB_stipe_center YFB_gill_tissue 0.875967 no
YFB_stipe_center YFB_veil 0.556593 no
YFB_stipe_shell YFB_stipe_skin 0.714955 no
YFB_stipe_shell YFB_cap_skin 0.999257 no
YFB_stipe_shell YFB_cap_tissue 0.872978 no
YFB_stipe_shell YFB_gill_tissue 0.659777 no
YFB_stipe_shell YFB_veil 0.330649 no
YFB_stipe_skin YFB_cap_skin 0.714430 no
YFB_stipe_skin YFB_cap_tissue 0.516765 no
YFB_stipe_skin YFB_gill_tissue 0.964907 no
YFB_stipe_skin YFB_veil 0.694887 no
YFB_cap_skin YFB_cap_tissue 0.874207 no
YFB_cap_skin YFB_gill_tissue 0.655821 no
YFB_cap_skin YFB_veil 0.329752 no
YFB_cap_tissue YFB_gill_tissue 0.460644 no
YFB_cap_tissue YFB_veil 0.177188 no
YFB_gill_tissue YFB_veil 0.756767 no
Initials DIF_gill_tissue 0.004928 yes
Initials YFB_stipe_center 0.059906 no
Initials YFB_stipe_shell 0.151524 no
Initials YFB_stipe_skin 0.034142 yes
Initials YFB_cap_skin 0.148238 no
Initials YFB_cap_tissue 0.262684 no
Initials YFB_gill_tissue 0.028675 yes
Initials YFB_veil 0.004928 yes
Initials Pileal_Stipeal_center 0.012274 yes
Initials Pileal_Stipeal_shell 0.025205 yes
Initials DIF_stipe_center 0.012577 yes
Initials DIF_stipe_shell 0.092841 no
Initials DIF_stipe_skin 0.057350 no
Initials DIF_cap_skin 0.041164 yes
Initials DIF_cap_tissue 0.001625 yes
Pileal_Stipeal_center DIF_gill_tissue 0.860488 no
Pileal_Stipeal_center YFB_stipe_center 0.764841 no
Pileal_Stipeal_center YFB_stipe_shell 0.528175 no
Pileal_Stipeal_center YFB_stipe_skin 0.881770 no
Pileal_Stipeal_center YFB_cap_skin 0.524448 no
Pileal_Stipeal_center YFB_cap_tissue 0.339569 no
Pileal_Stipeal_center YFB_gill_tissue 0.928873 no
Pileal_Stipeal_center YFB_veil 0.860635 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.919450 no
Pileal_Stipeal_center DIF_stipe_center 0.962135 no
Pileal_Stipeal_center DIF_stipe_shell 0.659777 no
Pileal_Stipeal_center DIF_stipe_skin 0.770869 no
Pileal_Stipeal_center DIF_cap_skin 0.841539 no
Pileal_Stipeal_center DIF_cap_tissue 0.696988 no
Pileal_Stipeal_shell DIF_gill_tissue 0.745713 no
Pileal_Stipeal_shell YFB_stipe_center 0.873805 no
Pileal_Stipeal_shell YFB_stipe_shell 0.656433 no
Pileal_Stipeal_shell YFB_stipe_skin 0.968853 no
Pileal_Stipeal_shell YFB_cap_skin 0.655052 no
Pileal_Stipeal_shell YFB_cap_tissue 0.456734 no
Pileal_Stipeal_shell YFB_gill_tissue 0.994966 no
Pileal_Stipeal_shell YFB_veil 0.742851 no
Pileal_Stipeal_shell DIF_stipe_center 0.873714 no
Pileal_Stipeal_shell DIF_stipe_shell 0.782786 no
Pileal_Stipeal_shell DIF_stipe_skin 0.881924 no
Pileal_Stipeal_shell DIF_cap_skin 0.935222 no
Pileal_Stipeal_shell DIF_cap_tissue 0.563024 no
DIF_stipe_center DIF_gill_tissue 0.907378 no
DIF_stipe_center YFB_stipe_center 0.701519 no
DIF_stipe_center YFB_stipe_shell 0.461123 no
DIF_stipe_center YFB_stipe_skin 0.828473 no
DIF_stipe_center YFB_cap_skin 0.456993 no
DIF_stipe_center YFB_cap_tissue 0.288793 no
DIF_stipe_center YFB_gill_tissue 0.883828 no
DIF_stipe_center YFB_veil 0.907552 no
DIF_stipe_center DIF_stipe_shell 0.591877 no
DIF_stipe_center DIF_stipe_skin 0.706858 no
DIF_stipe_center DIF_cap_skin 0.782113 no
DIF_stipe_center DIF_cap_tissue 0.756737 no
DIF_stipe_shell DIF_gill_tissue 0.453374 no
DIF_stipe_shell YFB_stipe_center 0.936465 no
DIF_stipe_shell YFB_stipe_shell 0.917613 no
DIF_stipe_shell YFB_stipe_skin 0.835043 no
DIF_stipe_shell YFB_cap_skin 0.916509 no
DIF_stipe_shell YFB_cap_tissue 0.758505 no
DIF_stipe_shell YFB_gill_tissue 0.784523 no
DIF_stipe_shell YFB_veil 0.446415 no
DIF_stipe_shell DIF_stipe_skin 0.930418 no
DIF_stipe_shell DIF_cap_skin 0.878816 no
DIF_stipe_shell DIF_cap_tissue 0.288793 no
DIF_stipe_skin DIF_gill_tissue 0.570990 no
DIF_stipe_skin YFB_stipe_center 0.994143 no
DIF_stipe_skin YFB_stipe_shell 0.829547 no
DIF_stipe_skin YFB_stipe_skin 0.921595 no
DIF_stipe_skin YFB_cap_skin 0.828585 no
DIF_stipe_skin YFB_cap_tissue 0.647397 no
DIF_stipe_skin YFB_gill_tissue 0.879835 no
DIF_stipe_skin YFB_veil 0.566542 no
DIF_stipe_skin DIF_cap_skin 0.956568 no
DIF_stipe_skin DIF_cap_tissue 0.393804 no
DIF_cap_skin DIF_gill_tissue 0.648786 no
DIF_cap_skin YFB_stipe_center 0.951836 no
DIF_cap_skin YFB_stipe_shell 0.765464 no
DIF_cap_skin YFB_stipe_skin 0.969574 no
DIF_cap_skin YFB_cap_skin 0.764433 no
DIF_cap_skin YFB_cap_tissue 0.577760 no
DIF_cap_skin YFB_gill_tissue 0.932806 no
DIF_cap_skin YFB_veil 0.648163 no
DIF_cap_skin DIF_cap_tissue 0.464847 no
DIF_cap_tissue DIF_gill_tissue 0.885120 no
DIF_cap_tissue YFB_stipe_center 0.382133 no
DIF_cap_tissue YFB_stipe_shell 0.199869 no
DIF_cap_tissue YFB_stipe_skin 0.517309 no
DIF_cap_tissue YFB_cap_skin 0.196757 no
DIF_cap_tissue YFB_cap_tissue 0.102187 no
DIF_cap_tissue YFB_gill_tissue 0.585078 no
DIF_cap_tissue YFB_veil 0.881955 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|078080
MITRTIVLGALLAVVSKAYIFQPDKTSFGRFLPFDQHRIPRSEAVDHVNLLIGNGGDTPNGSGGMIPSTGPPFAM
TRWVAQTQESYVSATPYNVTKKTVHGFQATRQPAIWMGESGSIALVPGVAAEGNTANIKWEFDKRGLPFDDTFRV
PGEEIISPAYYAIELSDEMGGHIRVEQASTSRAAHFRMRFELANSNDHPYLYIDVARPSVTGSDPANRTQPMGYV
EINPETREICGFSTERQDDIITPVSGRETASSFHGYFCARFDVNINSHGIIKSGEVLHGANKAFGGPLGAYVLFA
RPKNQPISFTPRVGTSFISIDQARMNLELEIPNPQPDLTNSHGMMLGTLEHTAAGVRQQWKDKLELFKLEGATDI
QKEIFYTAVAHTFQYPSEQHEFKKYWSGYVGEVLPLVAGEQSYTGYSIWDTFRAAWAWQILFAPERLPGFVHSML
LDYKQSGWLPMWKNIVETNIMIGTHADSLIAEAVKKGVTGFDRELAWEAVWKDATVAPKDDATTQYDDRQENVDY
EARAGLSSSYNVEGKGWVADDLHSESASRTLDYAYDDYAAYVLAKELGKPEAEFLLERSKRTPFTLWNEKTGFFE
ARNDDGSWAGEDRGWTEGDKWAYSFDVVHDIPQLIEKRGGNVGFVKSLEEHFNGGHNDHTNEPSHHIPYLYALSG
AAWKTQERVREIAQNDYMNTPTGLSGNEDCGQMSAWYLFTSLGFYPVNPVSGEYVIGSPLLDRVDIELPPPPGEV
HGKNLTIVSLGGSKLPYVKSVQVNGVYLEKPIITHEQIMEGGVIVFTMSGRIEEWGNDPQVLQALDANVGQLAAE
LADSEMAKKMEKGHDTAKKETVAQQKESQQNPLPDRNEL*
Coding >AgabiH97|078080
ATGATAACTCGTACAATTGTTCTCGGCGCTCTGCTTGCTGTCGTCTCAAAAGCCTACATATTCCAACCTGACAAA
ACGTCATTTGGTCGTTTCCTACCCTTCGACCAACATCGAATTCCTAGGAGCGAGGCCGTCGACCATGTTAATCTC
CTGATAGGAAACGGCGGCGACACGCCCAACGGTTCTGGTGGCATGATTCCTTCTACAGGACCGCCTTTTGCCATG
ACACGCTGGGTAGCTCAGACTCAAGAGAGCTATGTCTCGGCAACGCCGTATAATGTAACAAAGAAGACTGTCCAC
GGGTTCCAGGCAACCCGTCAGCCAGCGATCTGGATGGGTGAGAGCGGAAGTATTGCTCTCGTTCCCGGTGTTGCC
GCAGAGGGAAACACAGCGAACATCAAATGGGAGTTTGATAAACGCGGACTACCCTTTGACGATACCTTCCGCGTT
CCAGGGGAGGAAATCATTAGTCCCGCGTATTACGCCATTGAGTTGTCCGACGAGATGGGTGGACATATTCGAGTT
GAGCAAGCTTCCACTTCGCGCGCTGCCCATTTTCGTATGCGTTTTGAGCTCGCCAATTCCAATGACCACCCCTAC
CTTTATATTGACGTTGCCCGACCCTCCGTAACTGGCTCCGATCCAGCTAATCGTACCCAACCAATGGGTTACGTC
GAAATCAACCCTGAAACCCGAGAAATTTGCGGGTTCTCAACTGAGCGTCAAGACGACATTATCACGCCCGTCTCT
GGTCGTGAAACCGCCTCTAGCTTCCATGGATATTTCTGTGCCCGGTTCGACGTTAACATTAATTCGCATGGTATC
ATCAAAAGTGGTGAAGTTCTCCACGGTGCCAACAAGGCCTTTGGTGGTCCACTTGGCGCATACGTCCTCTTCGCT
CGTCCCAAGAACCAGCCCATTTCATTCACACCTCGCGTCGGCACTTCTTTCATATCTATCGATCAAGCGAGAATG
AACCTAGAACTTGAAATACCCAACCCTCAACCGGACTTGACTAACAGTCATGGCATGATGCTGGGGACGTTAGAG
CACACGGCTGCGGGTGTCAGACAACAGTGGAAGGATAAACTCGAATTATTCAAATTAGAGGGTGCGACGGATATC
CAAAAAGAGATTTTTTACACAGCCGTGGCCCATACATTTCAATACCCAAGCGAGCAGCATGAATTCAAGAAGTAC
TGGTCTGGTTACGTGGGCGAGGTTCTTCCGCTGGTGGCCGGCGAACAGTCGTATACAGGCTATTCGATTTGGGAT
ACTTTCCGCGCCGCTTGGGCATGGCAAATCCTTTTTGCACCTGAACGTCTTCCAGGCTTTGTCCATTCCATGTTA
CTGGATTACAAACAGAGCGGATGGCTACCGATGTGGAAAAATATCGTGGAGACCAACATCATGATCGGAACCCAT
GCCGACTCACTCATAGCTGAAGCTGTCAAGAAGGGAGTCACCGGTTTTGATCGTGAACTCGCCTGGGAAGCAGTT
TGGAAGGATGCGACTGTGGCCCCCAAGGATGACGCTACGACTCAATATGATGATCGTCAGGAGAATGTTGACTAC
GAAGCTCGAGCCGGGCTTAGCTCCTCATACAACGTGGAAGGTAAAGGTTGGGTCGCTGATGACCTTCATTCCGAA
AGTGCTTCTCGCACCCTAGATTATGCCTATGATGATTATGCTGCTTACGTTCTCGCAAAAGAGCTGGGTAAACCT
GAAGCCGAATTCCTACTTGAGCGCTCCAAGCGTACACCATTCACGCTTTGGAACGAAAAGACCGGTTTCTTCGAG
GCTAGGAATGATGATGGTAGTTGGGCGGGTGAGGATCGTGGATGGACGGAGGGAGATAAATGGGCCTACTCATTC
GACGTTGTTCATGATATCCCTCAACTTATTGAGAAGCGTGGAGGGAATGTAGGATTCGTGAAGAGTTTGGAGGAA
CATTTTAACGGCGGGCATAATGATCACACTAACGAACCTTCGCATCACATTCCGTATCTCTATGCACTTTCCGGA
GCGGCCTGGAAAACTCAAGAACGTGTTCGAGAGATCGCACAGAACGACTACATGAACACTCCCACTGGTCTCTCG
GGTAACGAGGATTGTGGTCAAATGAGCGCATGGTACCTGTTCACCAGTCTCGGCTTTTATCCAGTCAATCCCGTT
TCAGGAGAATACGTCATTGGATCGCCTCTTCTCGATCGCGTCGACATCGAACTTCCACCTCCACCAGGCGAAGTA
CATGGGAAAAATCTTACTATAGTATCTCTGGGTGGTTCAAAACTTCCATACGTTAAATCCGTACAGGTGAATGGC
GTATACCTGGAAAAGCCGATTATCACACATGAGCAGATTATGGAGGGAGGTGTAATCGTGTTTACTATGAGCGGG
AGAATTGAGGAATGGGGAAATGATCCGCAAGTGCTCCAGGCTTTGGATGCGAATGTTGGTCAACTTGCAGCGGAA
TTGGCTGATAGTGAAATGGCCAAAAAAATGGAAAAGGGGCATGATACCGCGAAGAAGGAGACGGTTGCTCAGCAG
AAGGAGTCCCAACAGAATCCCTTACCGGATCGTAATGAGCTATAA
Transcript >AgabiH97|078080
ATGATAACTCGTACAATTGTTCTCGGCGCTCTGCTTGCTGTCGTCTCAAAAGCCTACATATTCCAACCTGACAAA
ACGTCATTTGGTCGTTTCCTACCCTTCGACCAACATCGAATTCCTAGGAGCGAGGCCGTCGACCATGTTAATCTC
CTGATAGGAAACGGCGGCGACACGCCCAACGGTTCTGGTGGCATGATTCCTTCTACAGGACCGCCTTTTGCCATG
ACACGCTGGGTAGCTCAGACTCAAGAGAGCTATGTCTCGGCAACGCCGTATAATGTAACAAAGAAGACTGTCCAC
GGGTTCCAGGCAACCCGTCAGCCAGCGATCTGGATGGGTGAGAGCGGAAGTATTGCTCTCGTTCCCGGTGTTGCC
GCAGAGGGAAACACAGCGAACATCAAATGGGAGTTTGATAAACGCGGACTACCCTTTGACGATACCTTCCGCGTT
CCAGGGGAGGAAATCATTAGTCCCGCGTATTACGCCATTGAGTTGTCCGACGAGATGGGTGGACATATTCGAGTT
GAGCAAGCTTCCACTTCGCGCGCTGCCCATTTTCGTATGCGTTTTGAGCTCGCCAATTCCAATGACCACCCCTAC
CTTTATATTGACGTTGCCCGACCCTCCGTAACTGGCTCCGATCCAGCTAATCGTACCCAACCAATGGGTTACGTC
GAAATCAACCCTGAAACCCGAGAAATTTGCGGGTTCTCAACTGAGCGTCAAGACGACATTATCACGCCCGTCTCT
GGTCGTGAAACCGCCTCTAGCTTCCATGGATATTTCTGTGCCCGGTTCGACGTTAACATTAATTCGCATGGTATC
ATCAAAAGTGGTGAAGTTCTCCACGGTGCCAACAAGGCCTTTGGTGGTCCACTTGGCGCATACGTCCTCTTCGCT
CGTCCCAAGAACCAGCCCATTTCATTCACACCTCGCGTCGGCACTTCTTTCATATCTATCGATCAAGCGAGAATG
AACCTAGAACTTGAAATACCCAACCCTCAACCGGACTTGACTAACAGTCATGGCATGATGCTGGGGACGTTAGAG
CACACGGCTGCGGGTGTCAGACAACAGTGGAAGGATAAACTCGAATTATTCAAATTAGAGGGTGCGACGGATATC
CAAAAAGAGATTTTTTACACAGCCGTGGCCCATACATTTCAATACCCAAGCGAGCAGCATGAATTCAAGAAGTAC
TGGTCTGGTTACGTGGGCGAGGTTCTTCCGCTGGTGGCCGGCGAACAGTCGTATACAGGCTATTCGATTTGGGAT
ACTTTCCGCGCCGCTTGGGCATGGCAAATCCTTTTTGCACCTGAACGTCTTCCAGGCTTTGTCCATTCCATGTTA
CTGGATTACAAACAGAGCGGATGGCTACCGATGTGGAAAAATATCGTGGAGACCAACATCATGATCGGAACCCAT
GCCGACTCACTCATAGCTGAAGCTGTCAAGAAGGGAGTCACCGGTTTTGATCGTGAACTCGCCTGGGAAGCAGTT
TGGAAGGATGCGACTGTGGCCCCCAAGGATGACGCTACGACTCAATATGATGATCGTCAGGAGAATGTTGACTAC
GAAGCTCGAGCCGGGCTTAGCTCCTCATACAACGTGGAAGGTAAAGGTTGGGTCGCTGATGACCTTCATTCCGAA
AGTGCTTCTCGCACCCTAGATTATGCCTATGATGATTATGCTGCTTACGTTCTCGCAAAAGAGCTGGGTAAACCT
GAAGCCGAATTCCTACTTGAGCGCTCCAAGCGTACACCATTCACGCTTTGGAACGAAAAGACCGGTTTCTTCGAG
GCTAGGAATGATGATGGTAGTTGGGCGGGTGAGGATCGTGGATGGACGGAGGGAGATAAATGGGCCTACTCATTC
GACGTTGTTCATGATATCCCTCAACTTATTGAGAAGCGTGGAGGGAATGTAGGATTCGTGAAGAGTTTGGAGGAA
CATTTTAACGGCGGGCATAATGATCACACTAACGAACCTTCGCATCACATTCCGTATCTCTATGCACTTTCCGGA
GCGGCCTGGAAAACTCAAGAACGTGTTCGAGAGATCGCACAGAACGACTACATGAACACTCCCACTGGTCTCTCG
GGTAACGAGGATTGTGGTCAAATGAGCGCATGGTACCTGTTCACCAGTCTCGGCTTTTATCCAGTCAATCCCGTT
TCAGGAGAATACGTCATTGGATCGCCTCTTCTCGATCGCGTCGACATCGAACTTCCACCTCCACCAGGCGAAGTA
CATGGGAAAAATCTTACTATAGTATCTCTGGGTGGTTCAAAACTTCCATACGTTAAATCCGTACAGGTGAATGGC
GTATACCTGGAAAAGCCGATTATCACACATGAGCAGATTATGGAGGGAGGTGTAATCGTGTTTACTATGAGCGGG
AGAATTGAGGAATGGGGAAATGATCCGCAAGTGCTCCAGGCTTTGGATGCGAATGTTGGTCAACTTGCAGCGGAA
TTGGCTGATAGTGAAATGGCCAAAAAAATGGAAAAGGGGCATGATACCGCGAAGAAGGAGACGGTTGCTCAGCAG
AAGGAGTCCCAACAGAATCCCTTACCGGATCGTAATGAGCTATAA
Gene >AgabiH97|078080
ATGATAACTCGTACAATTGTTCTCGGCGCTCTGCTTGCTGTCGTCTCAAAAGCCTACATATTCCAACCTGACAAA
ACGTCATTTGGTCGTTTCCTACCCTTCGACCAACATCGAATTCCTAGGAGCGAGGCCGTCGACCATGTTAATCTG
TAAGTCGCTGTACTGCGTAGAGTCAATCCTTCTTCTGATGTTCCTAAAGCCTGATAGGAAACGGCGGCGACACGC
CCAACGGTTCTGGTGGCATGATTCCTTCTACAGGACCGCCTTTTGCCATGACACGCTGGGTAGCTCAGACTCAAG
AGAGCTATGTCTCGGCAACGCCGTATAATGTAACAAAGAAGACTGTCCACGGGTTCCAGGCAACCCGTCAGCCAG
CGATCTGGATGGGTGAGAGCGGAAGTATTGCTCTCGTTCCCGGTGTTGCCGCAGAGGGAAACACAGCGAACATCA
AATGGGAGTTTGATAAACGCGGACTACCCTTTGACGATACCTTCCGCGTTCCAGGGGAGGAAATCATTAGTCCCG
CGTATTACGCCATTGAGTTGTCCGACGAGATGGGTGGACATATTCGAGTTGAGCAAGCTTCCAGTACGTCAATGC
CCTCGTCCCAGCCTATGCCTGATGCTAATACAAACTCGAATAGCTTCGCGCGCTGCCCATTTTCGTATGCGTTTT
GAGCTCGCCAATTCCAATGACCACCCCTACCTTTATATTGACGTTGCCCGACCCTCCGTAACTGGCTCCGATCCA
GCTAATCGTACCCAACCAATGGGTTACGTCGAAATCAACCCTGAAACCCGAGAAATTTGCGGGTTCTCAACTGAG
CGTCAAGACGACATTATCACGCCCGTCTCTGGTCGTGAAACCGCCTCTAGCTTCCATGGATATTTCTGTGCCCGG
TTCGACGTTAACATTAATTCGCATGGTATCATCAAAAGTGGTGAAGTTCTCCACGGTGCCAACAAGGCCTTTGGT
GGTCCACTTGGCGCATACGTCCTCTTCGCTCGTCCCAAGAACCAGCCCATTTCATTCACACCTCGCGTCGGCACT
TCTTTCATATCTATCGATCAAGCGAGAATGAACCTAGAACTTGAAATACCCAACCCTCAACCGGACTTGACTAAC
AGTCATGGCATGATGCTGGGGACGTTAGAGCACACGGCTGCGGGTGTCAGACAACAGTGGAAGGATAAACTCGAA
TTATTCAAATTAGAGGGTGCGACGGATATCCAAAAAGAGATTTTTTACACAGCCGTGGCCCATACATTTCAATAC
CCAAGCGAGCAGCATGAATTCAAGAAGTACTGGTCTGGTTACGTGGGCGAGGTTCTTCCGCTGGTGGCCGGCGAA
CAGTCGTATACAGGCTATTCGATTTGGGATACTTTCCGCGCCGCTTGGGCATGGCAAATCCTTTTTGCACCTGAA
CGTCTTCCAGGCTTTGTCCATTCCATGTTACTGGATTACAAACAGGTAACACACTCATGTCCTACCTTTTGAGCA
GTGCATACTAACAGTTTAGTAGAGCGGATGGCTACCGATGTGGAAAAATATCGTGGAGACCAACATCATGATCGG
AACCCATGCCGACTCACTCATAGCTGAAGCTGTCAAGAAGGGAGTCACCGGTTTTGATCGTGAACTCGCCTGGGA
AGCAGTTTGGAAGGATGCGACTGTGGCCCCCAAGGATGACGCTACGACTCAATATGATGATCGTCAGGAGGTAGC
TTTACTCAGCTCTCTCTCTTCTTCCAATCTCGTTTACAATTATTCCTCTGTAGAATGTTGACTACGAAGCTCGAG
CCGGGCTTAGCTCCTCATACAACGTGGAAGGTAAAGGTTGGGTCGCTGATGACCTTCATTCCGAAAGTGCTTCTC
GCACCCTAGATTATGCCTGTGAGTTCCATTTTTGCCGCAAGGTTGCAAAAAATGTGAATCTTTTCACTAGATGAT
GATTATGCTGCTTACGTTCTCGCAAAAGAGCTGGGTAAACCTGAAGCCGAATTCCTACTTGAGCGCTCCAAGCGT
ACACCATTCACGCTTTGGAACGAAAAGACCGGTTTCTTCGAGGCTAGGAATGATGATGGTAGTTGGGCGGGTGAG
GATCGTGGATGGACGGAGGGAGATAAATGGGCCTACTCATTCGACGTTGTTCATGATATCCCTCAACTTATTGAG
AAGCGTGGAGGGAATGTAGGATTCGTGAAGAGTTTGGAGGAACATTTTAACGGCGGGCATAATGATCACACTAAC
GAAGTACGTTCGAGTTTATTCAAACTGGAACTTGCCCTCAATGGTTTGGATAGCCTTCGCATCACATTCCGTATC
TCTATGCACTTTCCGGAGCGGCCTGGAAAACTCAAGAACGTGTTCGAGAGATCGCACAGAACGACTACATGAACA
CTCCCACTGGTCTCTCGGGTGTACGTTGATTGTTCACATGCATATTGAATTCTGCCTTCTTACTCAATATGACTA
TGTTTTTACCAGAACGAGGATTGTGGTCAAATGAGCGCATGGTACCTGTTCACCAGTCTCGGCTTTTATCCAGTC
AATCCCGTTTCAGGAGAATACGTCATTGGATCGTATGTGCCTCATCTCTTCTATCAAACAATTTCTTGACCGATT
TGGTTTCTGCCCATTCTCATTATCGCTATAGGCCTCTTCTCGATCGCGTCGACATCGAACTTCCACCTCCACCAG
GCGAAGTACATGGGAAAAATCTTACTATAGTATCTCTGGGTGGTTCAAAACTTCCATACGTTAAATCCGTACAGG
TGAATGGCGTATACCTGGAAAAGCCGATTATCACACATGAGCAGATTATGGAGGGAGGTGTAATCGTGTTTACTA
TGAGCGGGAGAATTGAGGAATGGGGAAATGATCCGCAAGTGCTCCAGGCTTTGGATGCGAATGTTGGTCAACTTG
TAAGTGCTCGTATCTCCTCCATCGTCAAGGAACATAAGCTTAAGACTGACAACCACATAGGCAGCGGAATTGGCT
GATAGTGAAATGGCCAAAAAAATGGAAAAGGGGCATGATACCGCGAAGAAGGAGACGGTTGCTCAGCAGAAGGAG
TCCCAACAGAATCCCTTACCGGATCGTAATGAGCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail