Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|078070
Gene name
Locationscaffold_4:3068161..3071351
Strand-
Gene length (bp)3190
Transcript length (bp)2508
Coding sequence length (bp)2508
Protein length (aa) 836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07971 Glyco_hydro_92 Glycosyl hydrolase family 92 1.1E-117 337 809
PF17678 Glyco_hydro_92N Glycosyl hydrolase family 92 N-terminal domain 1.9E-38 53 331

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O86365|Y584_MYCTU Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0584 PE=3 SV=1 161 812 3.0E-44
sp|D4ATR3|A7629_ARTBC Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07629 PE=1 SV=1 127 816 8.0E-30

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|078070
MLGPGMLLLHLVLLPLAVISGSVPGLALDRYSTGRILPPKQFRVPKSAQVDAVNGLIGNGGIAPSHTGGMSPTTG
PPFAMHRWVAQTRPNYVSRLAYNITASTPKIHGFQCTMQPAIWMGESRSHAVVPGVAPTGNLAEIKSNFTDRGLF
FVGGPEKRGNEVISPSYYSIELEDGVGGTILAEMTSTSRAGYLRFTYKAGAKSPKTATPYVLIDGARRSVQSSTG
DNYTFPIGHIDISVANNEVTGYSSERQDSILTPISIKPFAEQFKGYFVAQFDPPLNSPNVKTGLIVNDTLVDGSN
STGSMLNAYAMYEGMEKSHKPFVLTVKMGLSLISVDQARKNLEMEIPDASNGSVPKKGEFAPGSFDATAQKTRSE
WAEKLDRVKIEGGTPEQLEIYYTSMVHGLTYPYETHEYGRYYSACDNDVHDGVSYNGYSNWDTYRQEWGYLMIMA
PERIGDMVTSMLNDYKECGRTPMWKNIVETNIMIGTHGSSMIGETIAKNFTNFDRELAWEAVLKDVTVAPVNESD
TVYSDRQENVDFEANAGLDSVYSQNGWVANDVHSESGSRDLGYSYVMWAAYHIARTLEKPNNITSLLYTRAKENP
LKIWNNDTGFFETRNASGAWGGPDNGWTEGTKYIYLYDFVQDVEKLIDLKGGKSGFVQSLENHYNGNHDAFTNEP
SLHISYLYNYGGAAMRTQERVRDLVAQNYNNTPQGISGNEDCGQMSAFYLMSAMGMYAVSPVDKNYSMTAPFHDK
MTIDLPQLDGSSKRLSITSPGALKNQYVKSITLNGQPLDKPFLAYEQFIGGGDIVYELSDKPETFGNDPEIVKTL
GPYVTVPMPT*
Coding >AgabiH97|078070
ATGTTAGGCCCCGGAATGTTGCTACTTCACTTGGTGTTGTTGCCTTTGGCCGTCATTTCGGGCTCAGTTCCTGGT
CTTGCTCTGGATCGCTATTCAACTGGTCGTATTCTTCCACCCAAGCAGTTTAGGGTCCCTAAAAGTGCTCAAGTT
GACGCAGTTAATGGATTGATAGGAAACGGTGGCATCGCGCCAAGCCACACGGGAGGTATGAGCCCAACCACTGGT
CCGCCGTTTGCCATGCATCGCTGGGTTGCTCAAACCCGTCCCAACTACGTGTCTCGTCTCGCATATAACATCACG
GCATCGACACCGAAGATCCACGGTTTCCAGTGCACTATGCAACCAGCCATTTGGATGGGCGAGAGCCGTTCTCAC
GCCGTTGTTCCTGGAGTTGCACCCACGGGAAACCTTGCAGAGATCAAGTCTAACTTCACGGACCGTGGTTTATTC
TTTGTTGGGGGGCCCGAGAAGAGAGGTAACGAGGTCATTAGTCCGTCATATTATAGTATCGAGTTGGAAGATGGC
GTCGGTGGAACGATCTTGGCTGAAATGACTTCAACTTCACGTGCTGGTTACCTTCGTTTCACCTACAAAGCCGGT
GCTAAGTCTCCGAAAACGGCTACTCCCTACGTTCTGATTGACGGTGCCCGCCGATCGGTCCAATCGTCTACTGGC
GACAACTACACATTCCCTATCGGACATATCGATATTTCGGTAGCCAACAATGAAGTCACTGGTTATTCAAGCGAA
CGTCAAGACTCTATCCTTACACCCATCTCAATTAAGCCATTCGCAGAGCAATTCAAAGGCTATTTTGTCGCTCAA
TTCGATCCTCCTTTGAATTCCCCGAATGTGAAGACAGGTCTTATCGTTAACGACACTCTCGTAGATGGCTCAAAT
TCCACTGGCTCGATGTTGAATGCGTACGCGATGTACGAAGGGATGGAAAAGTCGCATAAACCGTTCGTTTTGACT
GTGAAGATGGGACTCAGTTTGATTTCCGTAGATCAGGCGAGGAAGAATCTAGAAATGGAAATTCCAGATGCCTCT
AACGGTTCCGTGCCCAAGAAAGGCGAATTCGCTCCAGGAAGTTTCGATGCAACCGCTCAGAAAACCAGAAGCGAG
TGGGCAGAGAAACTTGATCGCGTCAAAATCGAGGGAGGGACACCAGAGCAACTCGAAATTTACTACACTTCTATG
GTCCACGGTCTGACTTACCCATATGAGACACACGAATATGGCCGTTACTACTCGGCATGCGACAACGATGTTCAC
GATGGTGTGAGTTATAATGGATACTCCAACTGGGACACGTATAGGCAAGAGTGGGGTTATTTGATGATAATGGCA
CCGGAGAGGATAGGTGATATGGTTACCAGTATGCTTAACGATTATAAGGAGTGTGGGAGGACGCCTATGTGGAAG
AATATTGTTGAGACGAATATTATGATCGGAACGCACGGATCCTCCATGATAGGAGAGACCATCGCCAAGAATTTT
ACCAACTTTGACCGTGAACTAGCATGGGAGGCTGTACTGAAAGATGTAACGGTCGCACCTGTAAACGAATCGGAC
ACAGTTTACTCTGACCGCCAGGAGAATGTTGACTTTGAAGCAAATGCCGGTTTAGACAGTGTTTATTCGCAAAAT
GGATGGGTGGCGAATGACGTTCATTCAGAGTCTGGTTCGCGGGACCTAGGGTATAGCTACGTTATGTGGGCGGCA
TACCACATCGCCAGAACATTAGAGAAACCAAACAACATTACTTCTTTGCTCTATACGCGTGCTAAAGAAAACCCA
CTCAAAATATGGAATAATGACACAGGATTTTTCGAGACCCGCAACGCTAGTGGAGCCTGGGGAGGGCCAGATAAT
GGTTGGACAGAAGGCACCAAATACATATATCTATACGATTTTGTTCAGGACGTTGAAAAACTTATTGACCTCAAG
GGGGGAAAATCTGGCTTCGTGCAAAGTCTGGAGAACCACTATAATGGCAATCACGATGCGTTCACGAACGAGCCT
TCCCTACACATATCTTATCTATACAACTATGGTGGGGCTGCAATGAGGACGCAAGAGAGGGTGCGCGATTTGGTT
GCCCAAAACTACAACAACACTCCCCAAGGGATCTCTGGTAATGAAGATTGCGGTCAAATGAGTGCTTTTTACCTC
ATGAGCGCGATGGGAATGTACGCAGTCAGTCCTGTCGACAAAAACTACTCCATGACGGCACCTTTCCACGACAAG
ATGACCATTGACTTGCCCCAGCTTGATGGTAGCTCCAAACGCCTGAGCATCACATCACCTGGGGCATTGAAAAAC
CAATACGTCAAGTCGATAACATTAAATGGTCAGCCTCTAGACAAGCCTTTCTTGGCATATGAGCAATTTATTGGA
GGGGGTGACATCGTCTATGAGCTGAGTGACAAGCCGGAAACCTTCGGGAATGACCCGGAAATAGTGAAAACCTTG
GGACCATACGTGACAGTACCTATGCCTACATGA
Transcript >AgabiH97|078070
ATGTTAGGCCCCGGAATGTTGCTACTTCACTTGGTGTTGTTGCCTTTGGCCGTCATTTCGGGCTCAGTTCCTGGT
CTTGCTCTGGATCGCTATTCAACTGGTCGTATTCTTCCACCCAAGCAGTTTAGGGTCCCTAAAAGTGCTCAAGTT
GACGCAGTTAATGGATTGATAGGAAACGGTGGCATCGCGCCAAGCCACACGGGAGGTATGAGCCCAACCACTGGT
CCGCCGTTTGCCATGCATCGCTGGGTTGCTCAAACCCGTCCCAACTACGTGTCTCGTCTCGCATATAACATCACG
GCATCGACACCGAAGATCCACGGTTTCCAGTGCACTATGCAACCAGCCATTTGGATGGGCGAGAGCCGTTCTCAC
GCCGTTGTTCCTGGAGTTGCACCCACGGGAAACCTTGCAGAGATCAAGTCTAACTTCACGGACCGTGGTTTATTC
TTTGTTGGGGGGCCCGAGAAGAGAGGTAACGAGGTCATTAGTCCGTCATATTATAGTATCGAGTTGGAAGATGGC
GTCGGTGGAACGATCTTGGCTGAAATGACTTCAACTTCACGTGCTGGTTACCTTCGTTTCACCTACAAAGCCGGT
GCTAAGTCTCCGAAAACGGCTACTCCCTACGTTCTGATTGACGGTGCCCGCCGATCGGTCCAATCGTCTACTGGC
GACAACTACACATTCCCTATCGGACATATCGATATTTCGGTAGCCAACAATGAAGTCACTGGTTATTCAAGCGAA
CGTCAAGACTCTATCCTTACACCCATCTCAATTAAGCCATTCGCAGAGCAATTCAAAGGCTATTTTGTCGCTCAA
TTCGATCCTCCTTTGAATTCCCCGAATGTGAAGACAGGTCTTATCGTTAACGACACTCTCGTAGATGGCTCAAAT
TCCACTGGCTCGATGTTGAATGCGTACGCGATGTACGAAGGGATGGAAAAGTCGCATAAACCGTTCGTTTTGACT
GTGAAGATGGGACTCAGTTTGATTTCCGTAGATCAGGCGAGGAAGAATCTAGAAATGGAAATTCCAGATGCCTCT
AACGGTTCCGTGCCCAAGAAAGGCGAATTCGCTCCAGGAAGTTTCGATGCAACCGCTCAGAAAACCAGAAGCGAG
TGGGCAGAGAAACTTGATCGCGTCAAAATCGAGGGAGGGACACCAGAGCAACTCGAAATTTACTACACTTCTATG
GTCCACGGTCTGACTTACCCATATGAGACACACGAATATGGCCGTTACTACTCGGCATGCGACAACGATGTTCAC
GATGGTGTGAGTTATAATGGATACTCCAACTGGGACACGTATAGGCAAGAGTGGGGTTATTTGATGATAATGGCA
CCGGAGAGGATAGGTGATATGGTTACCAGTATGCTTAACGATTATAAGGAGTGTGGGAGGACGCCTATGTGGAAG
AATATTGTTGAGACGAATATTATGATCGGAACGCACGGATCCTCCATGATAGGAGAGACCATCGCCAAGAATTTT
ACCAACTTTGACCGTGAACTAGCATGGGAGGCTGTACTGAAAGATGTAACGGTCGCACCTGTAAACGAATCGGAC
ACAGTTTACTCTGACCGCCAGGAGAATGTTGACTTTGAAGCAAATGCCGGTTTAGACAGTGTTTATTCGCAAAAT
GGATGGGTGGCGAATGACGTTCATTCAGAGTCTGGTTCGCGGGACCTAGGGTATAGCTACGTTATGTGGGCGGCA
TACCACATCGCCAGAACATTAGAGAAACCAAACAACATTACTTCTTTGCTCTATACGCGTGCTAAAGAAAACCCA
CTCAAAATATGGAATAATGACACAGGATTTTTCGAGACCCGCAACGCTAGTGGAGCCTGGGGAGGGCCAGATAAT
GGTTGGACAGAAGGCACCAAATACATATATCTATACGATTTTGTTCAGGACGTTGAAAAACTTATTGACCTCAAG
GGGGGAAAATCTGGCTTCGTGCAAAGTCTGGAGAACCACTATAATGGCAATCACGATGCGTTCACGAACGAGCCT
TCCCTACACATATCTTATCTATACAACTATGGTGGGGCTGCAATGAGGACGCAAGAGAGGGTGCGCGATTTGGTT
GCCCAAAACTACAACAACACTCCCCAAGGGATCTCTGGTAATGAAGATTGCGGTCAAATGAGTGCTTTTTACCTC
ATGAGCGCGATGGGAATGTACGCAGTCAGTCCTGTCGACAAAAACTACTCCATGACGGCACCTTTCCACGACAAG
ATGACCATTGACTTGCCCCAGCTTGATGGTAGCTCCAAACGCCTGAGCATCACATCACCTGGGGCATTGAAAAAC
CAATACGTCAAGTCGATAACATTAAATGGTCAGCCTCTAGACAAGCCTTTCTTGGCATATGAGCAATTTATTGGA
GGGGGTGACATCGTCTATGAGCTGAGTGACAAGCCGGAAACCTTCGGGAATGACCCGGAAATAGTGAAAACCTTG
GGACCATACGTGACAGTACCTATGCCTACATGA
Gene >AgabiH97|078070
ATGTTAGGCCCCGGAATGTTGCTACTTCACTTGGTGTTGTTGCCTTTGGCCGTCATTTCGGGCTCAGTTCCTGGT
CTTGCTCTGGATCGCTATTCAACTGGTCGTATTCTTCCACCCAAGCAGTTTAGGGTCCCTAAAAGTGCTCAAGTT
GACGCAGTTAATGGGTTCGTTTTTTTACTTGGAGTTTAGATTCACATCCTGATCTCTTTGGTAGATTGATAGGAA
ACGGTGGCATCGCGCCAAGCCACACGGGAGGTATGAGCCCAACCACTGGTCCGCCGTTTGCCATGCATCGCTGGG
TTGCTCAAACCCGTCCCAACTACGTGTCTCGTCTCGCATATAACATCACGGCATCGACACCGAAGATCCACGGTT
TCCAGTGCACTATGCAACCAGCCATTTGGATGGGCGAGAGCCGTTCTCACGCCGTTGTTCCTGGAGTTGCACCCA
CGGGAAACCTTGCAGAGATCAAGTCTAACTTCACGGACCGTGGTTTATTCTTTGTTGGGGGGCCCGAGAAGAGAG
GTAACGAGGTCATTAGTCCGTCATATTATAGTATCGAGTTGGAAGATGGCGTCGGTGGAACGATCTTGGCTGAAA
TGACTTCAAGTGAGTTGGGACTGACTTGCGTTCGTCGCATTTCGTTAAAACACTTTCAGCTTCACGTGCTGGTTA
CCTTCGTTTCACCTACAAAGCCGGTGCTAAGTCTCCGAAAACGGCTACTCCCTACGTTCTGATTGACGGTGCCCG
CCGATCGGTCCAATCGTCTACTGGCGACAACTACACATTCCCTATCGGACATATCGATATTTCGGTAGCCAACAA
TGAAGTCACTGGTTATTCAAGCGAACGTCAAGACTCTATCCTTACACCCATCTCAATTAAGCCATTCGCAGAGCA
ATTCAAAGGCTATTTTGTCGCTCAATTCGATCCTCCTTTGAATTCCCCGAATGTGAAGACAGGTCTTATCGTTAA
CGACACTCTCGTAGATGGCTCAAATTCCACTGGCTCGATGTTGAATGCGTACGCGATGTACGAAGGGATGGAAAA
GTCGCATAAACCGTTCGTTTTGACTGTGAAGATGGGACTCAGTTTGATTTCCGTAGATCAGGCGAGGAAGAATCT
AGAAATGGAAATTCCAGATGCCTCTAACGGTTCCGGTATGTTGAAGTATCCAGGACGTTTAGATTGGTGCTGAAA
TGTCCCTTCGTCTAGTGCCCAAGAAAGGCGAATTCGCTCCAGGAAGTTTCGATGCAACCGCTCAGAAAACCAGAA
GCGAGTGGGCAGAGAAACTTGATCGCGTCAAAATCGAGGGAGGGACACCAGAGCAACTCGAAATTTACTACACTT
CTATGGTCCACGGTCTGACTTACCCATATGAGACACACGAATATGGCCGTTACTACTCGGCATGCGACAACGATG
TTCACGATGGTGTGAGTTATAATGGATACTCCAACTGGGTGAGAGAAATGTAAACTTCAGCGTTTTATGTTTCTG
ACAAAATCACTGCGATTAGGACACGTATAGGCAAGAGTGGGGTTATTTGATGATAATGGCACCGGAGAGGATAGG
TGATATGGTTACCAGTATGCTTAACGATTATAAGGAGGTATGTCATTCCTACATTATATCGTTCTGCTTTTCACT
AACGATTACCCGATAGTGTGGGAGGACGCCTATGTGGAAGAATATTGTTGAGACGAATATTATGGTGAGCACTTC
ATATAAGGAGTGGAGTTTACTTTGATATGAATGCTGTCGACAGATCGGAACGCACGGATCCTCCATGATAGGAGA
GACCATCGCCAAGAATTTTACCAACTTTGACCGTGAACTAGCATGGGAGGCTGTACTGAAAGATGTAACGGTCGC
ACCTGTAAACGAATCGGACACAGTGTAAGGTTGATCGCGATAGAGTTTCATTTTATGCTAATGCATATCAATAGT
TACTCTGACCGCCAGGAGGTAAGTCTAATGGAGTCGTACCTTGAAGTTATCCGCTAACCTTCAGTGTAGAATGTT
GACTTTGAAGCAAATGCCGGTTTAGACAGTGTTTATTCGCAAAATGGATGGGTGGCGAATGACGTTCATTCAGAG
TCTGGTTCGCGGGACCTAGGGTATAGCTGTGAGATCCCAATAAACGAGTTTATCCAGCCACTCAATATTGTTCGA
AACAGACGTTATGTGGGCGGCATACCACATCGCCAGAACATTAGAGAAACCAAACAACATTACTTCTTTGCTCTA
TACGCGTGCTAAAGAAAACCCACTCAAAATATGGAATAATGACACAGGATTTTTCGAGACCCGCAACGCTAGTGG
AGCCTGGGGAGGGCCAGATAATGGTTGGACAGAAGGTGATTATCTATCTGTTTCTCTTAAACGCGCCACTCACCT
AGGATCTAAGGCACCAAATACATATATCTATACGATTTTGTTCAGGACGTTGAAAAACTTATTGACCTCAAGGGG
GGAAAATCTGGCTTCGTGCAAAGTCTGGAGAACCACTATAATGGCAATCACGATGCGTTCACGAACGAGGTATTC
TTGTTTTTCAATTCGAAACTTGGCACCCTGATCCAAAATTCATAGCCTTCCCTACACATATCTTATCTATACAAC
TATGGTGGGGCTGCAATGAGGACGCAAGAGAGGGTGCGCGATTTGGTTGCCCAAAACTACAACAACACTCCCCAA
GGGATCTCTGGTGTGAGTTTGCGTTATTGATGGCTCTAATTATACTCAAAATTTATTCTTGTTTAGAATGAAGAT
TGCGGTCAAATGAGTGCTTTTTACCTCATGAGCGCGATGGGAATGTACGCAGTCAGTCCTGTCGACAAAAACTAC
TCCATGACGGCGTAAGCTTTTTCCTTTTGGCGTACTCGTGGGAAAAGACTTATGTATATCTAAAAGACCTTTCCA
CGACAAGATGACCATTGACTTGCCCCAGCTTGATGGTAGCTCCAAACGCCTGAGCATCACATCACCTGGGGCATT
GAAAAACCAATACGTCAAGTCGATAACATTAAATGGTCAGCCTCTAGACAAGCCTTTCTTGGCATATGAGCAATT
TATTGGAGGGGGTGACATCGTCTATGAGCTGAGTGACAAGCCGGAAACCTTCGGGAATGACCCGGAAATAGTGAA
AACCTTGGGACCATACGTGACAGTACCTATGCCTACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail