© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|078060 |
| Gene name | |
| Location | scaffold_4:3066599..3067458 |
| Strand | - |
| Gene length (bp) | 859 |
| Transcript length (bp) | 810 |
| Coding sequence length (bp) | 810 |
| Protein length (aa) | 270 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01328 | Peroxidase_2 | Peroxidase, family 2 | 1.4E-50 | 33 | 236 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q00668|STCC_EMENI | Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 | 31 | 150 | 3.0E-12 |
| sp|P04963|PRXC_LEPFU | Chloroperoxidase OS=Leptoxyphium fumago GN=CPO PE=1 SV=3 | 35 | 235 | 5.0E-11 |
| sp|B9W4V6|APO1_AGRAE | Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 | 21 | 233 | 4.0E-08 |
| sp|B9W4V8|APO1_COPRA | Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 | 33 | 146 | 5.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0004601 | peroxidase activity | Yes |
| GO:0003674 | molecular_function | No |
| GO:0016491 | oxidoreductase activity | No |
| GO:0016209 | antioxidant activity | No |
| GO:0003824 | catalytic activity | No |
| GO:0016684 | oxidoreductase activity, acting on peroxide as acceptor | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 38 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 7.58 | 3.11 | 12.05 |
| Initials | Initials knots | 5.49 | 2.21 | 8.78 |
| Pileal_Stipeal_center | Stage I stipe center | 5.28 | 1.82 | 8.74 |
| Pileal_Stipeal_shell | Stage I stipe shell | 1.39 | 0.27 | 2.51 |
| DIF_stipe_center | Stage II stipe center | 1.21 | 0.21 | 2.20 |
| DIF_stipe_shell | Stage II stipe shell | 1.78 | 0.40 | 3.17 |
| DIF_stipe_skin | Stage II stipe skin | 13.48 | 6.36 | 20.60 |
| DIF_cap_skin | Stage II cap skin | 54.41 | 24.81 | 84.00 |
| DIF_cap_tissue | Stage II cap tissue | 27.55 | 11.31 | 43.78 |
| DIF_gill_tissue | Stage II gill tissue | 2.92 | 0.67 | 5.17 |
| YFB_stipe_center | Young fruiting body stipe center | 12.91 | 4.51 | 21.32 |
| YFB_stipe_shell | Young fruiting body stipe shell | 4.33 | 1.44 | 7.22 |
| YFB_stipe_skin | Young fruiting body stipe skin | 6.98 | 2.47 | 11.48 |
| YFB_cap_skin | Young fruiting body cap skin | 3.17 | 1.08 | 5.26 |
| YFB_cap_tissue | Young fruiting body cap tissue | 2.06 | 0.58 | 3.53 |
| YFB_gill_tissue | Young fruiting body gill tissue | 6.31 | 2.57 | 10.05 |
| YFB_veil | Young fruiting body veil | 2.00 | 0.46 | 3.54 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.048834 | yes |
| Casing | YFB_stipe_center | 0.244699 | no |
| Casing | YFB_stipe_shell | 0.234521 | no |
| Casing | YFB_stipe_skin | 0.919021 | no |
| Casing | YFB_cap_skin | 0.030134 | yes |
| Casing | YFB_cap_tissue | 0.002084 | yes |
| Casing | YFB_gill_tissue | 0.777356 | no |
| Casing | YFB_veil | 0.005302 | yes |
| Casing | Initials | 0.551402 | no |
| Casing | Pileal_Stipeal_center | 0.501943 | no |
| Casing | Pileal_Stipeal_shell | 0.001140 | yes |
| Casing | DIF_stipe_center | 0.000613 | yes |
| Casing | DIF_stipe_shell | 0.004928 | yes |
| Casing | DIF_stipe_skin | 0.154255 | no |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.002084 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.534262 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.085387 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.931530 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.612195 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.131698 | no |
| DIF_gill_tissue | YFB_veil | 0.600514 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.006387 | yes |
| YFB_stipe_center | YFB_stipe_skin | 0.182435 | no |
| YFB_stipe_center | YFB_cap_skin | 0.001140 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.093997 | no |
| YFB_stipe_center | YFB_veil | 0.000613 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.362309 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.608908 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.118094 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.494814 | no |
| YFB_stipe_shell | YFB_veil | 0.132274 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.075194 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.003765 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.898129 | no |
| YFB_stipe_skin | YFB_veil | 0.008457 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.449718 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.119910 | no |
| YFB_cap_skin | YFB_veil | 0.441983 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.004928 | yes |
| YFB_cap_tissue | YFB_veil | 0.977610 | no |
| YFB_gill_tissue | YFB_veil | 0.013782 | yes |
| Initials | DIF_gill_tissue | 0.227928 | no |
| Initials | YFB_stipe_center | 0.035765 | yes |
| Initials | YFB_stipe_shell | 0.710153 | no |
| Initials | YFB_stipe_skin | 0.703049 | no |
| Initials | YFB_cap_skin | 0.239648 | no |
| Initials | YFB_cap_tissue | 0.018896 | yes |
| Initials | YFB_gill_tissue | 0.841172 | no |
| Initials | YFB_veil | 0.038495 | yes |
| Initials | Pileal_Stipeal_center | 0.961758 | no |
| Initials | Pileal_Stipeal_shell | 0.007092 | yes |
| Initials | DIF_stipe_center | 0.002084 | yes |
| Initials | DIF_stipe_shell | 0.022369 | yes |
| Initials | DIF_stipe_skin | 0.016949 | yes |
| Initials | DIF_cap_skin | 0.000613 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.277689 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.028675 | yes |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.780337 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.656135 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.307966 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.026955 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.794316 | no |
| Pileal_Stipeal_center | YFB_veil | 0.047798 | yes |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.008121 | yes |
| Pileal_Stipeal_center | DIF_stipe_center | 0.003365 | yes |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.027451 | yes |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.013782 | yes |
| Pileal_Stipeal_center | DIF_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.222035 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.026215 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.003765 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.128955 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.580695 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.004548 | yes |
| Pileal_Stipeal_shell | YFB_veil | 0.640985 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.891148 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.779294 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_center | DIF_gill_tissue | 0.120521 | no |
| DIF_stipe_center | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_shell | 0.011041 | yes |
| DIF_stipe_center | YFB_stipe_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_skin | 0.061473 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.390497 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.001140 | yes |
| DIF_stipe_center | YFB_veil | 0.454351 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.608546 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.466993 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_shell | YFB_stipe_shell | 0.086585 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.008457 | yes |
| DIF_stipe_shell | YFB_cap_skin | 0.311274 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.877729 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.012577 | yes |
| DIF_stipe_shell | YFB_veil | 0.911831 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.954987 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.002525 | yes |
| DIF_stipe_skin | YFB_stipe_skin | 0.107603 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.048007 | yes |
| DIF_stipe_skin | YFB_veil | 0.000613 | yes |
| DIF_stipe_skin | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.057747 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_cap_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_gill_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_veil | 0.000613 | yes |
| DIF_cap_skin | DIF_cap_tissue | 0.079305 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_center | 0.064892 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_gill_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_veil | 0.000613 | yes |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|078060 MPSSLLSNKISLPDAHPPVHEHSSGRCPVADKHDFCPPQSGDSRSPCPALNTMANHGYINRDGKNVSAYDIHRGL KACYGLSTPLALFLSYVGFAMLRRARPIDLYQIGKHNVIEHDASLVHHDTPGGEEYAPIKIDEALVEELIEDVSG GHEAAKSEEPTPQSSLMDAVDVARSRVRREKLSKPLDPVHAEIARGEMAIILGVWEQKSKDKVGVPIDWMKQWLG HERLPDGWRPDHTEGLFDVIRRAKEMRAVMERMQEEEALLSKAS* |
| Coding | >AgabiH97|078060 ATGCCTTCTTCCCTTCTCTCCAACAAAATATCCCTCCCCGACGCTCACCCTCCTGTGCACGAGCATAGTAGCGGA AGATGTCCCGTTGCTGATAAACACGACTTCTGTCCTCCTCAGTCCGGTGACAGCCGTTCACCTTGCCCTGCTCTA AATACTATGGCAAATCATGGTTATATTAATCGTGATGGAAAAAATGTTTCGGCGTATGACATCCATCGTGGGTTG AAAGCATGTTACGGGCTTTCAACGCCACTTGCACTCTTCTTGAGCTACGTTGGCTTCGCTATGTTGCGGCGTGCG CGTCCAATCGACCTTTATCAAATCGGAAAGCACAATGTGATAGAACATGATGCTAGTCTTGTTCATCACGATACT CCCGGAGGGGAAGAATATGCACCAATCAAGATTGATGAGGCGCTTGTAGAAGAGTTGATCGAAGATGTGAGCGGC GGCCATGAAGCAGCAAAGTCCGAAGAACCGACGCCACAATCGTCGCTCATGGATGCCGTTGATGTGGCACGTTCT CGTGTTAGGCGTGAGAAATTATCTAAACCTTTGGACCCGGTACATGCAGAAATTGCTCGGGGGGAAATGGCTATC ATCCTCGGTGTATGGGAACAAAAGTCGAAAGATAAAGTCGGAGTGCCAATCGATTGGATGAAGCAGTGGCTTGGC CACGAGCGATTGCCCGATGGTTGGAGACCTGATCACACCGAGGGTTTGTTCGACGTAATCAGACGTGCCAAAGAG ATGAGAGCGGTCATGGAAAGGATGCAGGAGGAGGAAGCACTTCTATCAAAGGCCTCGTGA |
| Transcript | >AgabiH97|078060 ATGCCTTCTTCCCTTCTCTCCAACAAAATATCCCTCCCCGACGCTCACCCTCCTGTGCACGAGCATAGTAGCGGA AGATGTCCCGTTGCTGATAAACACGACTTCTGTCCTCCTCAGTCCGGTGACAGCCGTTCACCTTGCCCTGCTCTA AATACTATGGCAAATCATGGTTATATTAATCGTGATGGAAAAAATGTTTCGGCGTATGACATCCATCGTGGGTTG AAAGCATGTTACGGGCTTTCAACGCCACTTGCACTCTTCTTGAGCTACGTTGGCTTCGCTATGTTGCGGCGTGCG CGTCCAATCGACCTTTATCAAATCGGAAAGCACAATGTGATAGAACATGATGCTAGTCTTGTTCATCACGATACT CCCGGAGGGGAAGAATATGCACCAATCAAGATTGATGAGGCGCTTGTAGAAGAGTTGATCGAAGATGTGAGCGGC GGCCATGAAGCAGCAAAGTCCGAAGAACCGACGCCACAATCGTCGCTCATGGATGCCGTTGATGTGGCACGTTCT CGTGTTAGGCGTGAGAAATTATCTAAACCTTTGGACCCGGTACATGCAGAAATTGCTCGGGGGGAAATGGCTATC ATCCTCGGTGTATGGGAACAAAAGTCGAAAGATAAAGTCGGAGTGCCAATCGATTGGATGAAGCAGTGGCTTGGC CACGAGCGATTGCCCGATGGTTGGAGACCTGATCACACCGAGGGTTTGTTCGACGTAATCAGACGTGCCAAAGAG ATGAGAGCGGTCATGGAAAGGATGCAGGAGGAGGAAGCACTTCTATCAAAGGCCTCGTGA |
| Gene | >AgabiH97|078060 ATGCCTTCTTCCCTTCTCTCCAACAAAATATCCCTCCCCGACGCTCACCCTCCTGTGCACGAGCATAGTAGCGGA AGATGTCCCGTTGCTGATAAACACGACTTCTGTCCTCCTCAGTCCGGTGACAGCCGTTCACCTTGCCCTGCTCTA AATACTATGGCAAATCATGGTTATATGTATGTGTTGCCTTTTAATCATAAAATGCCCTTTCCTAAATTCTCGTAG TAATCGTGATGGAAAAAATGTTTCGGCGTATGACATCCATCGTGGGTTGAAAGCATGTTACGGGCTTTCAACGCC ACTTGCACTCTTCTTGAGCTACGTTGGCTTCGCTATGTTGCGGCGTGCGCGTCCAATCGACCTTTATCAAATCGG AAAGCACAATGTGATAGAACATGATGCTAGTCTTGTTCATCACGATACTCCCGGAGGGGAAGAATATGCACCAAT CAAGATTGATGAGGCGCTTGTAGAAGAGTTGATCGAAGATGTGAGCGGCGGCCATGAAGCAGCAAAGTCCGAAGA ACCGACGCCACAATCGTCGCTCATGGATGCCGTTGATGTGGCACGTTCTCGTGTTAGGCGTGAGAAATTATCTAA ACCTTTGGACCCGGTACATGCAGAAATTGCTCGGGGGGAAATGGCTATCATCCTCGGTGTATGGGAACAAAAGTC GAAAGATAAAGTCGGAGTGCCAATCGATTGGATGAAGCAGTGGCTTGGCCACGAGCGATTGCCCGATGGTTGGAG ACCTGATCACACCGAGGGTTTGTTCGACGTAATCAGACGTGCCAAAGAGATGAGAGCGGTCATGGAAAGGATGCA GGAGGAGGAAGCACTTCTATCAAAGGCCTCGTGA |