Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|078020
Gene name
Locationscaffold_4:3056194..3058042
Strand+
Gene length (bp)1848
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 1.9E-18 448 506
PF13181 TPR_8 Tetratricopeptide repeat 2.0E-01 32 60
PF13181 TPR_8 Tetratricopeptide repeat 8.0E-02 64 94
PF13181 TPR_8 Tetratricopeptide repeat 2.9E-02 99 129
PF13432 TPR_16 Tetratricopeptide repeat 2.8E-06 33 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YW3|DNJC3_MOUSE DnaJ homolog subfamily C member 3 OS=Mus musculus GN=Dnajc3 PE=1 SV=1 38 551 2.0E-56
sp|Q13217|DNJC3_HUMAN DnaJ homolog subfamily C member 3 OS=Homo sapiens GN=DNAJC3 PE=1 SV=1 38 551 6.0E-55
sp|Q27968|DNJC3_BOVIN DnaJ homolog subfamily C member 3 OS=Bos taurus GN=DNAJC3 PE=1 SV=1 38 551 6.0E-55
sp|Q9R0T3|DNJC3_RAT DnaJ homolog subfamily C member 3 OS=Rattus norvegicus GN=Dnajc3 PE=1 SV=3 38 551 2.0E-53
sp|Q5ZI13|DNJC3_CHICK DnaJ homolog subfamily C member 3 OS=Gallus gallus GN=DNAJC3 PE=2 SV=1 38 551 4.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YW3|DNJC3_MOUSE DnaJ homolog subfamily C member 3 OS=Mus musculus GN=Dnajc3 PE=1 SV=1 38 551 2.0E-56
sp|Q13217|DNJC3_HUMAN DnaJ homolog subfamily C member 3 OS=Homo sapiens GN=DNAJC3 PE=1 SV=1 38 551 6.0E-55
sp|Q27968|DNJC3_BOVIN DnaJ homolog subfamily C member 3 OS=Bos taurus GN=DNAJC3 PE=1 SV=1 38 551 6.0E-55
sp|Q9R0T3|DNJC3_RAT DnaJ homolog subfamily C member 3 OS=Rattus norvegicus GN=Dnajc3 PE=1 SV=3 38 551 2.0E-53
sp|Q5ZI13|DNJC3_CHICK DnaJ homolog subfamily C member 3 OS=Gallus gallus GN=DNAJC3 PE=2 SV=1 38 551 4.0E-50
sp|Q9HGM9|DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.02c PE=3 SV=1 393 523 9.0E-21
sp|Q54M21|DNJC3_DICDI DnaJ homolog subfamily C member 3 homolog OS=Dictyostelium discoideum GN=dnajc3 PE=3 SV=1 380 514 1.0E-18
sp|Q9LYW9|DNJ36_ARATH DnaJ protein P58IPK homolog OS=Arabidopsis thaliana GN=P58IPK PE=1 SV=1 380 523 6.0E-18
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 399 519 3.0E-16
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 399 519 4.0E-16
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 399 519 1.0E-15
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 395 535 1.0E-14
sp|B3WEQ6|DNAJ_LACCB Chaperone protein DnaJ OS=Lactobacillus casei (strain BL23) GN=dnaJ PE=3 SV=1 446 506 1.0E-14
sp|Q038N5|DNAJ_LACC3 Chaperone protein DnaJ OS=Lactobacillus casei (strain ATCC 334) GN=dnaJ PE=3 SV=1 446 506 1.0E-14
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 444 559 3.0E-13
sp|Q98PI9|DNAJ_MYCPU Chaperone protein DnaJ OS=Mycoplasma pulmonis (strain UAB CTIP) GN=dnaJ PE=3 SV=2 444 506 3.0E-13
sp|A7NS65|DNAJ_ROSCS Chaperone protein DnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1 446 543 3.0E-13
sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 446 543 6.0E-13
sp|Q114R3|DNAJ_TRIEI Chaperone protein DnaJ OS=Trichodesmium erythraeum (strain IMS101) GN=dnaJ PE=3 SV=1 447 506 6.0E-13
sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 447 506 8.0E-13
sp|A0KMI5|DNAJ_AERHH Chaperone protein DnaJ OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaJ PE=3 SV=1 446 506 1.0E-12
sp|Q3MG81|DNAJ_ANAVT Chaperone protein DnaJ OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaJ PE=3 SV=1 447 506 2.0E-12
sp|Q8YUA5|DNAJ_NOSS1 Chaperone protein DnaJ OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaJ PE=3 SV=1 447 506 2.0E-12
sp|B2J3J3|DNAJ_NOSP7 Chaperone protein DnaJ OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=dnaJ PE=3 SV=1 447 556 2.0E-12
sp|B8HLD2|DNAJ_CYAP4 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dnaJ PE=3 SV=1 447 506 2.0E-12
sp|A3DF24|DNAJ_CLOTH Chaperone protein DnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaJ PE=3 SV=1 446 512 4.0E-12
sp|Q6A997|DNAJ1_PROAC Chaperone protein DnaJ 1 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dnaJ1 PE=3 SV=1 448 512 4.0E-12
sp|Q55505|DNAJ1_SYNY3 Chaperone protein DnaJ 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaJ1 PE=3 SV=1 448 520 4.0E-12
sp|B0JW23|DNAJ_MICAN Chaperone protein DnaJ OS=Microcystis aeruginosa (strain NIES-843) GN=dnaJ PE=3 SV=1 448 545 6.0E-12
sp|Q5N0G1|DNAJ_SYNP6 Chaperone protein DnaJ OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaJ PE=3 SV=1 448 506 6.0E-12
sp|Q7NBW0|DNAJ_MYCGA Chaperone protein DnaJ OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=dnaJ PE=3 SV=2 444 544 8.0E-12
sp|B7KEJ8|DNAJ_CYAP7 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7424) GN=dnaJ PE=3 SV=1 448 506 9.0E-12
sp|Q97BG9|DNAJ_THEVO Chaperone protein DnaJ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaJ PE=3 SV=1 447 506 1.0E-11
sp|P40358|JEM1_YEAST DnaJ-like chaperone JEM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEM1 PE=1 SV=3 446 550 1.0E-11
sp|Q2JW78|DNAJ_SYNJA Chaperone protein DnaJ OS=Synechococcus sp. (strain JA-3-3Ab) GN=dnaJ PE=3 SV=1 447 506 1.0E-11
sp|Q84BU3|DNAJ_LACAC Chaperone protein DnaJ OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dnaJ PE=3 SV=1 446 506 1.0E-11
sp|Q9LCQ4|DNAJ_BRECH Chaperone protein DnaJ OS=Brevibacillus choshinensis GN=dnaJ PE=3 SV=1 446 538 1.0E-11
sp|Q049W7|DNAJ_LACDB Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=dnaJ PE=3 SV=1 447 506 1.0E-11
sp|Q1G9R3|DNAJ_LACDA Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=dnaJ PE=3 SV=1 447 506 1.0E-11
sp|B8I304|DNAJ_CLOCE Chaperone protein DnaJ OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaJ PE=3 SV=1 446 520 2.0E-11
sp|Q7V3Q3|DNAJ_PROMP Chaperone protein DnaJ OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dnaJ PE=3 SV=1 448 506 2.0E-11
sp|P42824|DNJH2_ALLPO DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1 442 506 2.0E-11
sp|Q2JH49|DNAJ_SYNJB Chaperone protein DnaJ OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=dnaJ PE=3 SV=1 447 506 3.0E-11
sp|Q67S53|DNAJ_SYMTH Chaperone protein DnaJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaJ PE=3 SV=1 446 506 4.0E-11
sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 443 539 4.0E-11
sp|Q6KHF9|DNAJ_MYCMO Chaperone protein DnaJ OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaJ PE=3 SV=1 446 547 4.0E-11
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 446 511 5.0E-11
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 446 506 5.0E-11
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 444 506 5.0E-11
sp|P75354|DNAJM_MYCPN DnaJ-like protein MG200 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_119 PE=3 SV=1 446 539 5.0E-11
sp|Q6G553|DNAJ_BARHE Chaperone protein DnaJ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaJ PE=3 SV=1 448 539 5.0E-11
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 442 506 5.0E-11
sp|Q8G6C6|DNAJ_BIFLO Chaperone protein DnaJ OS=Bifidobacterium longum (strain NCC 2705) GN=dnaJ PE=3 SV=1 448 515 5.0E-11
sp|Q6G1F8|DNAJ_BARQU Chaperone protein DnaJ OS=Bartonella quintana (strain Toulouse) GN=dnaJ PE=3 SV=1 448 539 5.0E-11
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 444 506 6.0E-11
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 446 506 6.0E-11
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 447 521 6.0E-11
sp|Q1RHG9|DNAJ_RICBR Chaperone protein DnaJ OS=Rickettsia bellii (strain RML369-C) GN=dnaJ PE=3 SV=1 447 535 6.0E-11
sp|Q2NVZ0|DNAJ_SODGM Chaperone protein DnaJ OS=Sodalis glossinidius (strain morsitans) GN=dnaJ PE=3 SV=1 448 506 7.0E-11
sp|A4SQ24|DNAJ_AERS4 Chaperone protein DnaJ OS=Aeromonas salmonicida (strain A449) GN=dnaJ PE=3 SV=1 446 506 7.0E-11
sp|Q7UA76|DNAJ_SYNPX Chaperone protein DnaJ OS=Synechococcus sp. (strain WH8102) GN=dnaJ PE=3 SV=1 448 506 8.0E-11
sp|Q6MT07|DNAJ_MYCMS Chaperone protein DnaJ OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=dnaJ PE=3 SV=1 445 537 8.0E-11
sp|A6VNB0|DNAJ_ACTSZ Chaperone protein DnaJ OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaJ PE=3 SV=1 446 506 9.0E-11
sp|A6WRU8|DNAJ_SHEB8 Chaperone protein DnaJ OS=Shewanella baltica (strain OS185) GN=dnaJ PE=3 SV=1 446 512 9.0E-11
sp|A3D7T3|DNAJ_SHEB5 Chaperone protein DnaJ OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaJ PE=3 SV=1 446 512 9.0E-11
sp|B8E4S2|DNAJ_SHEB2 Chaperone protein DnaJ OS=Shewanella baltica (strain OS223) GN=dnaJ PE=3 SV=1 446 512 9.0E-11
sp|A9L0R7|DNAJ_SHEB9 Chaperone protein DnaJ OS=Shewanella baltica (strain OS195) GN=dnaJ PE=3 SV=1 446 512 9.0E-11
sp|Q8DKR7|DNAJ_THEEB Chaperone protein DnaJ OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaJ PE=3 SV=2 447 506 1.0E-10
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 447 544 1.0E-10
sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 446 551 1.0E-10
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 421 552 1.0E-10
sp|B2G6W4|DNAJ_LACRJ Chaperone protein DnaJ OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaJ PE=3 SV=1 446 506 1.0E-10
sp|A5VJE8|DNAJ_LACRD Chaperone protein DnaJ OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaJ PE=3 SV=1 446 506 1.0E-10
sp|B0CAZ0|DNAJ_ACAM1 Chaperone protein DnaJ OS=Acaryochloris marina (strain MBIC 11017) GN=dnaJ PE=3 SV=1 447 506 1.0E-10
sp|A3QGW1|DNAJ_SHELP Chaperone protein DnaJ OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaJ PE=3 SV=1 446 512 1.0E-10
sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 421 552 1.0E-10
sp|B7JY68|DNAJ_CYAP8 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 8801) GN=dnaJ PE=3 SV=1 448 506 1.0E-10
sp|B5YAR4|DNAJ_DICT6 Chaperone protein DnaJ OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaJ PE=3 SV=1 446 548 1.0E-10
sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 441 506 1.0E-10
sp|A8GV67|DNAJ_RICB8 Chaperone protein DnaJ OS=Rickettsia bellii (strain OSU 85-389) GN=dnaJ PE=3 SV=1 447 535 1.0E-10
sp|B1XQF6|DNAJ_SYNP2 Chaperone protein DnaJ OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=dnaJ PE=3 SV=1 448 506 2.0E-10
sp|P71500|DNAJ_MYCCT Chaperone protein DnaJ OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=dnaJ PE=3 SV=2 445 537 2.0E-10
sp|A6LJ63|DNAJ_THEM4 Chaperone protein DnaJ OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaJ PE=3 SV=1 446 511 2.0E-10
sp|Q0HY10|DNAJ_SHESR Chaperone protein DnaJ OS=Shewanella sp. (strain MR-7) GN=dnaJ PE=3 SV=1 446 512 2.0E-10
sp|Q0HLM9|DNAJ_SHESM Chaperone protein DnaJ OS=Shewanella sp. (strain MR-4) GN=dnaJ PE=3 SV=1 446 512 2.0E-10
sp|Q8EHT6|DNAJ_SHEON Chaperone protein DnaJ OS=Shewanella oneidensis (strain MR-1) GN=dnaJ PE=3 SV=1 446 512 2.0E-10
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 446 506 2.0E-10
sp|Q5WHG0|DNAJ_BACSK Chaperone protein DnaJ OS=Bacillus clausii (strain KSM-K16) GN=dnaJ PE=3 SV=1 446 519 2.0E-10
sp|Q086J2|DNAJ_SHEFN Chaperone protein DnaJ OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaJ PE=3 SV=1 446 512 2.0E-10
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 446 512 2.0E-10
sp|A0KTS6|DNAJ_SHESA Chaperone protein DnaJ OS=Shewanella sp. (strain ANA-3) GN=dnaJ PE=3 SV=1 446 512 2.0E-10
sp|Q12Q07|DNAJ_SHEDO Chaperone protein DnaJ OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaJ PE=3 SV=1 446 512 2.0E-10
sp|Q05646|DNAJ_ERYRH Chaperone protein DnaJ OS=Erysipelothrix rhusiopathiae GN=dnaJ PE=2 SV=1 446 506 3.0E-10
sp|A8FYT9|DNAJ_SHESH Chaperone protein DnaJ OS=Shewanella sediminis (strain HAW-EB3) GN=dnaJ PE=3 SV=1 446 534 3.0E-10
sp|Q82BY4|DNAJ2_STRAW Chaperone protein DnaJ 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaJ2 PE=3 SV=1 448 511 3.0E-10
sp|Q74IT7|DNAJ_LACJO Chaperone protein DnaJ OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaJ PE=3 SV=1 446 506 3.0E-10
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 448 506 3.0E-10
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 446 512 3.0E-10
sp|Q7V9C8|DNAJ_PROMM Chaperone protein DnaJ OS=Prochlorococcus marinus (strain MIT 9313) GN=dnaJ PE=3 SV=1 448 506 3.0E-10
sp|Q24SS4|DNAJ_DESHY Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain Y51) GN=dnaJ PE=3 SV=1 446 512 3.0E-10
sp|B8FUN3|DNAJ_DESHD Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaJ PE=3 SV=1 446 512 3.0E-10
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 446 549 3.0E-10
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 446 506 3.0E-10
sp|Q9RDD7|DNAJ2_STRCO Chaperone protein DnaJ 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ2 PE=3 SV=1 448 511 3.0E-10
sp|O52164|DNAJ2_STRAL Chaperone protein DnaJ 2 OS=Streptomyces albus G GN=dnaJ2 PE=3 SV=1 448 511 3.0E-10
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 447 506 4.0E-10
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 447 508 4.0E-10
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 447 508 4.0E-10
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 446 506 4.0E-10
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 446 506 4.0E-10
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 446 506 4.0E-10
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 446 506 4.0E-10
sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 446 506 4.0E-10
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 446 506 4.0E-10
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 446 523 4.0E-10
sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 446 506 4.0E-10
sp|Q0AIY0|DNAJ_NITEC Chaperone protein DnaJ OS=Nitrosomonas eutropha (strain C91) GN=dnaJ PE=3 SV=1 446 506 4.0E-10
sp|A7I2G3|DNAJ_CAMHC Chaperone protein DnaJ OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaJ PE=3 SV=1 448 536 4.0E-10
sp|A5W9N6|CBPA_PSEP1 Curved DNA-binding protein OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cbpA PE=3 SV=1 447 523 5.0E-10
sp|Q03FR6|DNAJ_PEDPA Chaperone protein DnaJ OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaJ PE=3 SV=1 447 512 5.0E-10
sp|Q88DH7|CBPA_PSEPK Curved DNA-binding protein OS=Pseudomonas putida (strain KT2440) GN=cbpA PE=3 SV=1 447 523 5.0E-10
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 446 506 5.0E-10
sp|A1RGN2|DNAJ_SHESW Chaperone protein DnaJ OS=Shewanella sp. (strain W3-18-1) GN=dnaJ PE=3 SV=1 446 512 5.0E-10
sp|A4Y9Q2|DNAJ_SHEPC Chaperone protein DnaJ OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaJ PE=3 SV=1 446 512 5.0E-10
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 448 506 5.0E-10
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 446 506 5.0E-10
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 448 506 5.0E-10
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 448 506 6.0E-10
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 447 554 6.0E-10
sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 446 506 6.0E-10
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 446 534 6.0E-10
sp|Q38W94|DNAJ_LACSS Chaperone protein DnaJ OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaJ PE=3 SV=1 444 506 6.0E-10
sp|O87778|DNAJ_LACSK Chaperone protein DnaJ OS=Lactobacillus sakei GN=dnaJ PE=2 SV=1 444 506 6.0E-10
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 443 539 7.0E-10
sp|B1J5W7|CBPA_PSEPW Curved DNA-binding protein OS=Pseudomonas putida (strain W619) GN=cbpA PE=3 SV=1 447 523 7.0E-10
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 446 506 7.0E-10
sp|Q89AU7|DNAJ_BUCBP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaJ PE=3 SV=1 446 506 7.0E-10
sp|Q044A8|DNAJ_LACGA Chaperone protein DnaJ OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=dnaJ PE=3 SV=1 446 506 7.0E-10
sp|C4L8Y4|DNAJ_TOLAT Chaperone protein DnaJ OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaJ PE=3 SV=1 446 512 7.0E-10
sp|A8H759|DNAJ_SHEPA Chaperone protein DnaJ OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaJ PE=3 SV=1 446 512 7.0E-10
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 446 506 7.0E-10
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 446 506 7.0E-10
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 446 506 8.0E-10
sp|P78004|DNAJ_MYCPN Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaJ PE=3 SV=1 446 551 8.0E-10
sp|Q316U7|DNAJ_DESAG Chaperone protein DnaJ OS=Desulfovibrio alaskensis (strain G20) GN=dnaJ PE=3 SV=1 446 506 8.0E-10
sp|C4K3I5|DNAJ_HAMD5 Chaperone protein DnaJ OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaJ PE=3 SV=1 446 520 8.0E-10
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 446 506 9.0E-10
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 446 506 9.0E-10
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 446 506 9.0E-10
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 446 506 9.0E-10
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|B0TQC1|DNAJ_SHEHH Chaperone protein DnaJ OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaJ PE=3 SV=1 446 512 9.0E-10
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 446 506 9.0E-10
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|Q7VEJ6|DNAJ_PROMA Chaperone protein DnaJ OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaJ PE=3 SV=1 448 506 1.0E-09
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 443 539 1.0E-09
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 448 506 1.0E-09
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 447 506 1.0E-09
sp|P22305|DNAJ_CAUCR Chaperone protein DnaJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaJ PE=3 SV=2 447 506 1.0E-09
sp|Q835R5|DNAJ_ENTFA Chaperone protein DnaJ OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dnaJ PE=3 SV=1 444 512 1.0E-09
sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 417 543 1.0E-09
sp|Q49762|DNAJ2_MYCLE Chaperone protein DnaJ 2 OS=Mycobacterium leprae (strain TN) GN=dnaJ2 PE=3 SV=1 447 511 1.0E-09
sp|Q71ZJ8|DNAJ_LISMF Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaJ PE=3 SV=1 446 512 1.0E-09
sp|C1KVB9|DNAJ_LISMC Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaJ PE=3 SV=1 446 512 1.0E-09
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 446 512 1.0E-09
sp|Q1I490|CBPA_PSEE4 Curved DNA-binding protein OS=Pseudomonas entomophila (strain L48) GN=cbpA PE=3 SV=1 447 523 1.0E-09
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 446 512 1.0E-09
sp|B1WVR2|DNAJ_CYAA5 Chaperone protein DnaJ OS=Cyanothece sp. (strain ATCC 51142) GN=dnaJ PE=3 SV=1 448 539 1.0E-09
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 446 506 1.0E-09
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 446 506 1.0E-09
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B0KK26|CBPA_PSEPG Curved DNA-binding protein OS=Pseudomonas putida (strain GB-1) GN=cbpA PE=3 SV=1 447 523 1.0E-09
sp|B0UWR3|DNAJ_HISS2 Chaperone protein DnaJ OS=Histophilus somni (strain 2336) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|Q0I3V1|DNAJ_HAES1 Chaperone protein DnaJ OS=Haemophilus somnus (strain 129Pt) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|P47442|DNAJM_MYCGE DnaJ-like protein MG200 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG200 PE=1 SV=1 445 534 1.0E-09
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|Q1GKS4|DNAJ_RUEST Chaperone protein DnaJ OS=Ruegeria sp. (strain TM1040) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|B2VGS0|DNAJ_ERWT9 Chaperone protein DnaJ OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaJ PE=3 SV=1 446 506 1.0E-09
sp|Q5P9E0|DNAJ_ANAMM Chaperone protein DnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1 448 526 1.0E-09
sp|B9KH92|DNAJ_ANAMF Chaperone protein DnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1 448 526 1.0E-09
sp|Q9SR96|DNJ63_ARATH DnaJ protein ERDJ3A OS=Arabidopsis thaliana GN=ERDJ3A PE=1 SV=1 443 514 1.0E-09
sp|Q87VN8|CBPA_PSESM Curved DNA-binding protein OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cbpA PE=3 SV=1 447 544 1.0E-09
sp|B8DE39|DNAJ_LISMH Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaJ PE=3 SV=1 446 512 2.0E-09
sp|Q92BN9|DNAJ_LISIN Chaperone protein DnaJ OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaJ PE=3 SV=1 446 512 2.0E-09
sp|P0DJM1|DNAJ_LISMO Chaperone protein DnaJ OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaJ PE=3 SV=1 446 512 2.0E-09
sp|G2K045|DNAJ_LISM4 Chaperone protein DnaJ OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaJ PE=3 SV=1 446 512 2.0E-09
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 446 512 2.0E-09
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 443 539 2.0E-09
sp|O67623|DNAJ1_AQUAE Chaperone protein DnaJ 1 OS=Aquifex aeolicus (strain VF5) GN=dnaJ1 PE=3 SV=1 447 513 2.0E-09
sp|Q9QYI6|DNJB9_MOUSE DnaJ homolog subfamily B member 9 OS=Mus musculus GN=Dnajb9 PE=1 SV=2 447 535 2.0E-09
sp|B1KRT1|DNAJ_SHEWM Chaperone protein DnaJ OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaJ PE=3 SV=1 446 534 2.0E-09
sp|Q75VW3|DNAJ_HYDTT Chaperone protein DnaJ OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=dnaJ PE=3 SV=1 447 506 2.0E-09
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 446 522 2.0E-09
sp|P97554|DNJB9_RAT DnaJ homolog subfamily B member 9 OS=Rattus norvegicus GN=Dnajb9 PE=2 SV=2 447 535 2.0E-09
sp|Q5YZX0|DNAJ1_NOCFA Chaperone protein DnaJ 1 OS=Nocardia farcinica (strain IFM 10152) GN=dnaJ1 PE=3 SV=1 447 511 2.0E-09
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 424 552 2.0E-09
sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 445 546 2.0E-09
sp|Q73XZ6|DNAJ1_MYCPA Chaperone protein DnaJ 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaJ1 PE=3 SV=1 447 511 2.0E-09
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 448 506 2.0E-09
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 448 506 2.0E-09
sp|Q9CMS2|DNAJ_PASMU Chaperone protein DnaJ OS=Pasteurella multocida (strain Pm70) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|P63972|DNAJ_STAAW Chaperone protein DnaJ OS=Staphylococcus aureus (strain MW2) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|A8Z4B8|DNAJ_STAAT Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|Q6G8Y8|DNAJ_STAAS Chaperone protein DnaJ OS=Staphylococcus aureus (strain MSSA476) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|P63971|DNAJ_STAAN Chaperone protein DnaJ OS=Staphylococcus aureus (strain N315) GN=dnaJ PE=1 SV=1 446 506 2.0E-09
sp|P63970|DNAJ_STAAM Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|A6QHC2|DNAJ_STAAE Chaperone protein DnaJ OS=Staphylococcus aureus (strain Newman) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|Q5HFI1|DNAJ_STAAC Chaperone protein DnaJ OS=Staphylococcus aureus (strain COL) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|Q2YT48|DNAJ_STAAB Chaperone protein DnaJ OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|A5ITA7|DNAJ_STAA9 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH9) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|Q2FXZ3|DNAJ_STAA8 Chaperone protein DnaJ OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|Q2FGE4|DNAJ_STAA3 Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|A6U251|DNAJ_STAA2 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH1) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|A7X2Y0|DNAJ_STAA1 Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|A7MWW1|DNAJ_VIBCB Chaperone protein DnaJ OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|Q6GGC1|DNAJ_STAAR Chaperone protein DnaJ OS=Staphylococcus aureus (strain MRSA252) GN=dnaJ PE=3 SV=1 446 506 2.0E-09
sp|Q83CJ2|CBPA_COXBU Curved DNA-binding protein OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=cbpA PE=3 SV=1 447 507 3.0E-09
sp|A9NDK6|CBPA_COXBR Curved DNA-binding protein OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=cbpA PE=3 SV=1 447 507 3.0E-09
sp|A9KE65|CBPA_COXBN Curved DNA-binding protein OS=Coxiella burnetii (strain Dugway 5J108-111) GN=cbpA PE=3 SV=1 447 507 3.0E-09
sp|Q57AD6|DNAJ_BRUAB Chaperone protein DnaJ OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|Q2YQV1|DNAJ_BRUA2 Chaperone protein DnaJ OS=Brucella abortus (strain 2308) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|B2S9C2|DNAJ_BRUA1 Chaperone protein DnaJ OS=Brucella abortus (strain S19) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|Q0K758|DNAJ_CUPNH Chaperone protein DnaJ OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaJ PE=3 SV=1 446 512 3.0E-09
sp|Q8FXX1|DNAJ_BRUSU Chaperone protein DnaJ OS=Brucella suis biovar 1 (strain 1330) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|B0CJX5|DNAJ_BRUSI Chaperone protein DnaJ OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|Q8YE77|DNAJ_BRUME Chaperone protein DnaJ OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|C0RG11|DNAJ_BRUMB Chaperone protein DnaJ OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|A9M9V9|DNAJ_BRUC2 Chaperone protein DnaJ OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|B5ZWQ1|DNAJ_RHILW Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|Q0AKB3|DNAJ_MARMM Chaperone protein DnaJ OS=Maricaulis maris (strain MCS10) GN=dnaJ PE=3 SV=1 446 506 3.0E-09
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|Q88VM1|DNAJ_LACPL Chaperone protein DnaJ OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dnaJ PE=3 SV=1 446 506 3.0E-09
sp|Q05980|DNAJ_BRUO2 Chaperone protein DnaJ OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaJ PE=2 SV=2 448 506 3.0E-09
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 444 506 3.0E-09
sp|A8EUC7|DNAJ_ARCB4 Chaperone protein DnaJ OS=Arcobacter butzleri (strain RM4018) GN=dnaJ PE=3 SV=1 448 506 3.0E-09
sp|B1YKT0|DNAJ_EXIS2 Chaperone protein DnaJ OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dnaJ PE=3 SV=1 445 506 3.0E-09
sp|Q56237|DNAJ2_THET8 Chaperone protein DnaJ 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ2 PE=3 SV=2 444 506 3.0E-09
sp|A1BHL1|DNAJ_CHLPD Chaperone protein DnaJ OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaJ PE=3 SV=1 446 550 3.0E-09
sp|Q8KCD8|DNAJ_CHLTE Chaperone protein DnaJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaJ PE=3 SV=1 446 506 3.0E-09
sp|O52065|DNAJ_MANHA Chaperone protein DnaJ OS=Mannheimia haemolytica GN=dnaJ PE=3 SV=1 446 506 3.0E-09
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 445 543 3.0E-09
sp|A1STE5|DNAJ_PSYIN Chaperone protein DnaJ OS=Psychromonas ingrahamii (strain 37) GN=dnaJ PE=3 SV=1 446 534 3.0E-09
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 446 506 3.0E-09
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 446 506 3.0E-09
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 447 506 4.0E-09
sp|O27352|DNAJ_METTH Chaperone protein DnaJ OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dnaJ PE=3 SV=1 446 506 4.0E-09
sp|B0KIS4|DNAJ_PSEPG Chaperone protein DnaJ OS=Pseudomonas putida (strain GB-1) GN=dnaJ PE=3 SV=1 446 512 4.0E-09
sp|B1J255|DNAJ_PSEPW Chaperone protein DnaJ OS=Pseudomonas putida (strain W619) GN=dnaJ PE=3 SV=1 446 512 4.0E-09
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 446 506 4.0E-09
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 446 506 4.0E-09
sp|P17631|DNAJ_BACSU Chaperone protein DnaJ OS=Bacillus subtilis (strain 168) GN=dnaJ PE=2 SV=3 446 512 4.0E-09
sp|A0AIS3|DNAJ_LISW6 Chaperone protein DnaJ OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaJ PE=3 SV=1 446 512 4.0E-09
sp|O94625|SPJ1_SCHPO DnaJ-related protein spj1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spj1 PE=2 SV=2 451 507 4.0E-09
sp|A5W9A2|DNAJ_PSEP1 Chaperone protein DnaJ OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaJ PE=3 SV=1 446 512 4.0E-09
sp|B3R6G6|DNAJ_CUPTR Chaperone protein DnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1 446 512 4.0E-09
sp|Q99M87|DNJA3_MOUSE DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus GN=Dnaja3 PE=1 SV=1 448 519 4.0E-09
sp|Q88DU3|DNAJ_PSEPK Chaperone protein DnaJ OS=Pseudomonas putida (strain KT2440) GN=dnaJ PE=3 SV=1 446 512 4.0E-09
sp|A4IR30|DNAJ_GEOTN Chaperone protein DnaJ OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaJ PE=3 SV=1 446 513 4.0E-09
sp|Q9PQ82|DNAJ_UREPA Chaperone protein DnaJ OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=dnaJ PE=3 SV=1 446 506 4.0E-09
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 447 506 4.0E-09
sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 445 507 5.0E-09
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 448 506 5.0E-09
sp|Q45552|DNAJ_GEOSE Chaperone protein DnaJ OS=Geobacillus stearothermophilus GN=dnaJ PE=3 SV=1 446 523 5.0E-09
sp|Q3IC07|DNAJ_PSEHT Chaperone protein DnaJ OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaJ PE=3 SV=1 446 506 5.0E-09
sp|Q5P1H7|DNAJ2_AROAE Chaperone protein DnaJ 2 OS=Aromatoleum aromaticum (strain EbN1) GN=dnaJ2 PE=3 SV=1 446 535 5.0E-09
sp|A1V9Q3|DNAJ_DESVV Chaperone protein DnaJ OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaJ PE=3 SV=1 446 506 5.0E-09
sp|Q725M6|DNAJ_DESVH Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaJ PE=3 SV=1 446 506 5.0E-09
sp|B3QPW8|DNAJ_CHLP8 Chaperone protein DnaJ OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaJ PE=3 SV=1 446 506 5.0E-09
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 446 506 5.0E-09
sp|Q3B2T5|DNAJ_CHLL7 Chaperone protein DnaJ OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaJ PE=3 SV=1 446 506 5.0E-09
sp|P45555|DNAJ_STAAU Chaperone protein DnaJ OS=Staphylococcus aureus GN=dnaJ PE=3 SV=1 446 506 5.0E-09
sp|P48208|DNAJ_HAEDU Chaperone protein DnaJ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaJ PE=3 SV=1 446 506 6.0E-09
sp|Q46XI8|DNAJ_CUPPJ Chaperone protein DnaJ OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaJ PE=3 SV=1 446 512 6.0E-09
sp|A8FFD1|DNAJ_BACP2 Chaperone protein DnaJ OS=Bacillus pumilus (strain SAFR-032) GN=dnaJ PE=3 SV=1 446 512 6.0E-09
sp|Q70WY6|DNAJ_FUSNP Chaperone protein DnaJ OS=Fusobacterium nucleatum subsp. polymorphum GN=dnaJ PE=3 SV=1 446 506 6.0E-09
sp|Q9ZFC5|DNAJ_METSS Chaperone protein DnaJ OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaJ PE=3 SV=1 446 536 6.0E-09
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 447 506 7.0E-09
sp|Q5KWZ8|DNAJ_GEOKA Chaperone protein DnaJ OS=Geobacillus kaustophilus (strain HTA426) GN=dnaJ PE=3 SV=1 446 513 7.0E-09
sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 440 560 7.0E-09
sp|C3LTA6|DNAJ_VIBCM Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaJ PE=3 SV=1 446 506 7.0E-09
sp|O34242|DNAJ_VIBCH Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaJ PE=3 SV=2 446 506 7.0E-09
sp|A5F362|DNAJ_VIBC3 Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaJ PE=3 SV=1 446 506 7.0E-09
sp|P9WNV7|DNAJ2_MYCTU Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaJ2 PE=1 SV=1 447 511 7.0E-09
sp|P9WNV6|DNAJ2_MYCTO Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaJ2 PE=3 SV=1 447 511 7.0E-09
sp|P63967|DNAJ2_MYCBO Chaperone protein DnaJ 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaJ2 PE=3 SV=1 447 511 7.0E-09
sp|Q65U54|DNAJ_MANSM Chaperone protein DnaJ OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaJ PE=3 SV=2 446 506 7.0E-09
sp|Q49Y21|DNAJ_STAS1 Chaperone protein DnaJ OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaJ PE=3 SV=1 446 506 7.0E-09
sp|A4XYF5|DNAJ_PSEMY Chaperone protein DnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1 446 512 7.0E-09
sp|B1HUD0|DNAJ_LYSSC Chaperone protein DnaJ OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaJ PE=3 SV=1 445 512 8.0E-09
sp|Q9KWS6|DNAJ_GEOTM Chaperone protein DnaJ OS=Geobacillus thermoglucosidasius GN=dnaJ PE=3 SV=1 446 518 8.0E-09
sp|Q0A7E4|DNAJ_ALKEH Chaperone protein DnaJ OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dnaJ PE=3 SV=1 446 512 8.0E-09
sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=1 SV=1 440 560 8.0E-09
sp|Q98DD2|DNAJ_RHILO Chaperone protein DnaJ OS=Rhizobium loti (strain MAFF303099) GN=dnaJ PE=3 SV=1 448 518 8.0E-09
sp|C5BQ32|DNAJ_TERTT Chaperone protein DnaJ OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaJ PE=3 SV=1 446 506 9.0E-09
sp|A9KKT9|DNAJ_CLOPH Chaperone protein DnaJ OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaJ PE=3 SV=1 446 506 9.0E-09
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 446 506 9.0E-09
sp|A7Z6W0|DNAJ_BACMF Chaperone protein DnaJ OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaJ PE=3 SV=1 446 512 1.0E-08
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 446 512 1.0E-08
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 446 506 1.0E-08
sp|C4Z1J3|DNAJ_EUBE2 Chaperone protein DnaJ OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=dnaJ PE=3 SV=1 446 506 1.0E-08
sp|C5D4U0|DNAJ_GEOSW Chaperone protein DnaJ OS=Geobacillus sp. (strain WCH70) GN=dnaJ PE=3 SV=1 446 518 1.0E-08
sp|P26508|NOLC_RHIFR Protein NolC OS=Rhizobium fredii GN=nolC PE=3 SV=1 446 506 1.0E-08
sp|Q6VAY5|DNAJ_PSEST Chaperone protein DnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1 446 512 1.0E-08
sp|B0BTI6|DNAJ_ACTPJ Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaJ PE=3 SV=1 446 506 1.0E-08
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 446 512 1.0E-08
sp|A6VCL7|DNAJ_PSEA7 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain PA7) GN=dnaJ PE=3 SV=1 446 512 1.0E-08
sp|B0S1F7|DNAJ_FINM2 Chaperone protein DnaJ OS=Finegoldia magna (strain ATCC 29328) GN=dnaJ PE=3 SV=1 447 539 1.0E-08
sp|B3EE31|DNAJ_CHLL2 Chaperone protein DnaJ OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaJ PE=3 SV=1 446 506 1.0E-08
sp|Q0WTI8|DNJ72_ARATH Chaperone protein dnaJ 72 OS=Arabidopsis thaliana GN=ATJ72 PE=2 SV=1 448 527 1.0E-08
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 447 506 1.0E-08
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 446 512 1.0E-08
sp|O59731|YHXB_SCHPO Uncharacterized J domain-containing protein C3E7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.11c PE=3 SV=1 440 538 1.0E-08
sp|C3MC05|DNAJ_RHISN Chaperone protein DnaJ OS=Rhizobium sp. (strain NGR234) GN=dnaJ PE=3 SV=1 446 506 1.0E-08
sp|Q9HV44|DNAJ_PSEAE Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaJ PE=3 SV=1 446 512 1.0E-08
sp|Q02FR2|DNAJ_PSEAB Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaJ PE=3 SV=1 446 512 1.0E-08
sp|B7V1H2|DNAJ_PSEA8 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaJ PE=3 SV=1 446 512 1.0E-08
sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 447 558 1.0E-08
sp|A4SFR5|DNAJ_CHLPM Chaperone protein DnaJ OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaJ PE=3 SV=1 446 506 1.0E-08
sp|A8LQ63|DNAJ_DINSH Chaperone protein DnaJ OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=dnaJ PE=3 SV=1 446 506 1.0E-08
sp|Q5ZKZ4|DJC16_CHICK DnaJ homolog subfamily C member 16 OS=Gallus gallus GN=DNAJC16 PE=2 SV=1 446 552 1.0E-08
sp|Q92T07|DNAJ_RHIME Chaperone protein DnaJ OS=Rhizobium meliloti (strain 1021) GN=dnaJ PE=3 SV=1 446 506 1.0E-08
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 446 512 1.0E-08
sp|A6UEY1|DNAJ_SINMW Chaperone protein DnaJ OS=Sinorhizobium medicae (strain WSM419) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|Q0C454|DNAJ_HYPNA Chaperone protein DnaJ OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 447 506 2.0E-08
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 447 506 2.0E-08
sp|A7GT07|DNAJ_BACCN Chaperone protein DnaJ OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 446 511 2.0E-08
sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 447 506 2.0E-08
sp|A6WX07|DNAJ_OCHA4 Chaperone protein DnaJ OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dnaJ PE=3 SV=1 448 506 2.0E-08
sp|B2GBQ6|DNAJ_LACF3 Chaperone protein DnaJ OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 447 506 2.0E-08
sp|C0ZB49|DNAJ_BREBN Chaperone protein DnaJ OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaJ PE=3 SV=1 446 512 2.0E-08
sp|Q8CP18|DNAJ_STAES Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 446 512 2.0E-08
sp|Q1H3B9|DNAJ_METFK Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1 446 512 2.0E-08
sp|B9KPP3|DNAJ_RHOSK Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|Q3IYM8|DNAJ_RHOS4 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 446 512 2.0E-08
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 444 506 2.0E-08
sp|A3PNM0|DNAJ_RHOS1 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 446 512 2.0E-08
sp|A4WW88|DNAJ_RHOS5 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|Q3YT99|DNAJ_EHRCJ Chaperone protein DnaJ OS=Ehrlichia canis (strain Jake) GN=dnaJ PE=3 SV=1 446 535 2.0E-08
sp|Q80TN4|DJC16_MOUSE DnaJ homolog subfamily C member 16 OS=Mus musculus GN=Dnajc16 PE=1 SV=2 448 552 2.0E-08
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|Q8FNF5|DNAJ1_COREF Chaperone protein DnaJ 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=dnaJ1 PE=3 SV=1 447 511 2.0E-08
sp|P94319|DNAJ_BRADU Chaperone protein DnaJ OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dnaJ PE=3 SV=1 441 506 2.0E-08
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|C3K274|DNAJ_PSEFS Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain SBW25) GN=dnaJ PE=3 SV=1 446 512 2.0E-08
sp|C1DD87|DNAJ_LARHH Chaperone protein DnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1 446 511 2.0E-08
sp|Q6F150|DNAJ_MESFL Chaperone protein DnaJ OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|B6IZJ1|DNAJ_COXB2 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaJ PE=3 SV=1 446 506 2.0E-08
sp|A9KG87|DNAJ_COXBN Chaperone protein DnaJ OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|B6J7U6|DNAJ_COXB1 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|Q8NNB4|DNAJ1_CORGL Chaperone protein DnaJ 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=dnaJ1 PE=3 SV=1 447 511 3.0E-08
sp|Q96EY1|DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=2 446 527 3.0E-08
sp|Q6NG14|DNAJ1_CORDI Chaperone protein DnaJ 1 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=dnaJ1 PE=3 SV=1 447 511 3.0E-08
sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|Q27237|TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster GN=l(2)tid PE=1 SV=2 412 507 3.0E-08
sp|Q6LUA6|DNAJ_PHOPR Chaperone protein DnaJ OS=Photobacterium profundum GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=1 SV=3 447 506 3.0E-08
sp|A5UF67|DNAJ_HAEIG Chaperone protein DnaJ OS=Haemophilus influenzae (strain PittGG) GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|B6EKA0|DNAJ_ALISL Chaperone protein DnaJ OS=Aliivibrio salmonicida (strain LFI1238) GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|A8IPT0|DNAJ_AZOC5 Chaperone protein DnaJ OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 436 543 3.0E-08
sp|Q21H37|DNAJ_SACD2 Chaperone protein DnaJ OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 444 506 3.0E-08
sp|P40170|DNAJ1_STRCO Chaperone protein DnaJ 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ1 PE=3 SV=2 446 506 3.0E-08
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|Q2KWA4|DNAJ_BORA1 Chaperone protein DnaJ OS=Bordetella avium (strain 197N) GN=dnaJ PE=3 SV=1 446 512 3.0E-08
sp|Q9UBS3|DNJB9_HUMAN DnaJ homolog subfamily B member 9 OS=Homo sapiens GN=DNAJB9 PE=1 SV=1 447 507 3.0E-08
sp|Q2SMM7|DNAJ_HAHCH Chaperone protein DnaJ OS=Hahella chejuensis (strain KCTC 2396) GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein DnaJ OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1 446 512 3.0E-08
sp|Q1IF58|DNAJ_PSEE4 Chaperone protein DnaJ OS=Pseudomonas entomophila (strain L48) GN=dnaJ PE=3 SV=1 446 512 3.0E-08
sp|A1B4F0|DNAJ_PARDP Chaperone protein DnaJ OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaJ PE=3 SV=1 446 506 3.0E-08
sp|P50026|DNAJ_SYNE7 Chaperone protein DnaJ OS=Synechococcus elongatus (strain PCC 7942) GN=dnaJ PE=3 SV=2 447 505 4.0E-08
sp|Q626I7|DNJ20_CAEBR DnaJ homolog dnj-20 OS=Caenorhabditis briggsae GN=dnj-20 PE=3 SV=1 447 506 4.0E-08
sp|Q3AQP5|DNAJ_CHLCH Chaperone protein DnaJ OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaJ PE=3 SV=1 446 506 4.0E-08
sp|P77866|DNAJ_AGGAC Chaperone protein DnaJ OS=Aggregatibacter actinomycetemcomitans GN=dnaJ PE=3 SV=2 446 506 4.0E-08
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 446 506 4.0E-08
sp|Q3A8C3|DNAJ_PELCD Chaperone protein DnaJ OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaJ PE=3 SV=1 446 506 4.0E-08
sp|Q5R9A4|DNJB9_PONAB DnaJ homolog subfamily B member 9 OS=Pongo abelii GN=DNAJB9 PE=2 SV=1 447 507 4.0E-08
sp|Q16D44|DNAJ_ROSDO Chaperone protein DnaJ OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaJ PE=3 SV=1 446 506 4.0E-08
sp|Q8RH03|DNAJ_FUSNN Chaperone protein DnaJ OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=dnaJ PE=3 SV=1 446 506 4.0E-08
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 446 512 4.0E-08
sp|Q87WP1|DNAJ_PSESM Chaperone protein DnaJ OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaJ PE=3 SV=1 446 512 5.0E-08
sp|A1AW21|DNAJ_RUTMC Chaperone protein DnaJ OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dnaJ PE=3 SV=1 446 506 5.0E-08
sp|Q8WWF6|DNJB3_HUMAN DnaJ homolog subfamily B member 3 OS=Homo sapiens GN=DNAJB3 PE=1 SV=1 448 553 5.0E-08
sp|P25303|SCJ1_YEAST DnaJ-related protein SCJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCJ1 PE=1 SV=2 447 506 5.0E-08
sp|Q5HNW7|DNAJ_STAEQ Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaJ PE=3 SV=1 446 506 5.0E-08
sp|Q65H55|DNAJ_BACLD Chaperone protein DnaJ OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaJ PE=3 SV=1 446 512 5.0E-08
sp|A7IC67|DNAJ_XANP2 Chaperone protein DnaJ OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaJ PE=3 SV=1 446 506 5.0E-08
sp|Q2J319|DNAJ_RHOP2 Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaJ PE=3 SV=1 444 506 5.0E-08
sp|B7LFA9|CBPA_ECO55 Curved DNA-binding protein OS=Escherichia coli (strain 55989 / EAEC) GN=cbpA PE=3 SV=1 447 539 5.0E-08
sp|A5WBF8|DNAJ_PSYWF Chaperone protein DnaJ OS=Psychrobacter sp. (strain PRwf-1) GN=dnaJ PE=3 SV=1 446 506 6.0E-08
sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 444 506 6.0E-08
sp|Q39JC7|DNAJ_BURL3 Chaperone protein DnaJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaJ PE=3 SV=1 446 512 6.0E-08
sp|B4S9D0|DNAJ_PROA2 Chaperone protein DnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaJ PE=3 SV=1 446 506 6.0E-08
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 448 506 6.0E-08
sp|Q2GLU9|DNAJ_ANAPZ Chaperone protein DnaJ OS=Anaplasma phagocytophilum (strain HZ) GN=dnaJ PE=3 SV=1 448 521 6.0E-08
sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 448 542 6.0E-08
sp|B7JN38|DNAJ_BACC0 Chaperone protein DnaJ OS=Bacillus cereus (strain AH820) GN=dnaJ PE=3 SV=1 446 506 6.0E-08
sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 446 506 6.0E-08
sp|Q6MNG0|DNAJ_BDEBA Chaperone protein DnaJ OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaJ PE=3 SV=1 446 506 6.0E-08
sp|Q5LWJ5|DNAJ_RUEPO Chaperone protein DnaJ OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|Q6D0B8|DNAJ_PECAS Chaperone protein DnaJ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|Q6HDK8|DNAJ_BACHK Chaperone protein DnaJ OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|Q81LS3|DNAJ_BACAN Chaperone protein DnaJ OS=Bacillus anthracis GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|C3L5R6|DNAJ_BACAC Chaperone protein DnaJ OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|C3P8L9|DNAJ_BACAA Chaperone protein DnaJ OS=Bacillus anthracis (strain A0248) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|Q4ZNP8|DNAJ_PSEU2 Chaperone protein DnaJ OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaJ PE=3 SV=1 446 512 7.0E-08
sp|Q8MPX3|DNJ20_CAEEL DnaJ homolog dnj-20 OS=Caenorhabditis elegans GN=dnj-20 PE=3 SV=2 447 506 7.0E-08
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 446 512 7.0E-08
sp|Q47XI7|DNAJ_COLP3 Chaperone protein DnaJ OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 446 512 7.0E-08
sp|B2UBP2|DNAJ_RALPJ Chaperone protein DnaJ OS=Ralstonia pickettii (strain 12J) GN=dnaJ PE=3 SV=1 446 512 7.0E-08
sp|B9IY80|DNAJ_BACCQ Chaperone protein DnaJ OS=Bacillus cereus (strain Q1) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|B7HPL2|DNAJ_BACC7 Chaperone protein DnaJ OS=Bacillus cereus (strain AH187) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|Q730M2|DNAJ_BACC1 Chaperone protein DnaJ OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|Q5FVM7|DJC16_RAT DnaJ homolog subfamily C member 16 OS=Rattus norvegicus GN=Dnajc16 PE=2 SV=1 448 552 7.0E-08
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 446 512 7.0E-08
sp|A8GMF8|DNAJ_RICAH Chaperone protein DnaJ OS=Rickettsia akari (strain Hartford) GN=dnaJ PE=3 SV=1 447 542 7.0E-08
sp|Q634M8|DNAJ_BACCZ Chaperone protein DnaJ OS=Bacillus cereus (strain ZK / E33L) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|C1ESK7|DNAJ_BACC3 Chaperone protein DnaJ OS=Bacillus cereus (strain 03BB102) GN=dnaJ PE=3 SV=1 446 506 7.0E-08
sp|Q48E63|DNAJ_PSE14 Chaperone protein DnaJ OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dnaJ PE=3 SV=1 446 512 7.0E-08
sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 448 542 7.0E-08
sp|Q5RCM7|DJC16_PONAB DnaJ homolog subfamily C member 16 OS=Pongo abelii GN=DNAJC16 PE=2 SV=1 448 510 7.0E-08
sp|A7H2C0|DNAJ_CAMJD Chaperone protein DnaJ OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dnaJ PE=3 SV=1 449 506 7.0E-08
sp|A1K4C4|DNAJ_AZOSB Chaperone protein DnaJ OS=Azoarcus sp. (strain BH72) GN=dnaJ PE=3 SV=1 446 512 8.0E-08
sp|P0C0B5|DNAJ_STRPY Chaperone protein DnaJ OS=Streptococcus pyogenes GN=dnaJ PE=3 SV=1 448 506 8.0E-08
sp|B8D757|DNAJ_BUCAT Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaJ PE=3 SV=1 446 506 8.0E-08
sp|P0DA71|DNAJ_STRPQ Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dnaJ PE=3 SV=1 448 506 8.0E-08
sp|P0DA70|DNAJ_STRP3 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dnaJ PE=3 SV=1 448 506 8.0E-08
sp|P0C0B6|DNAJ_STRP1 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M1 GN=dnaJ PE=3 SV=1 448 506 8.0E-08
sp|O32465|DNAJ_BUCAI Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaJ PE=3 SV=2 446 506 8.0E-08
sp|B8D8V3|DNAJ_BUCA5 Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaJ PE=3 SV=1 446 506 8.0E-08
sp|Q8NZM7|DNAJ_STRP8 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dnaJ PE=3 SV=1 448 506 8.0E-08
sp|Q5XAD7|DNAJ_STRP6 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dnaJ PE=3 SV=2 448 506 8.0E-08
sp|B2TTP8|CBPA_SHIB3 Curved DNA-binding protein OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cbpA PE=3 SV=1 447 539 8.0E-08
sp|B1LJ04|CBPA_ECOSM Curved DNA-binding protein OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cbpA PE=3 SV=1 447 539 8.0E-08
sp|Q3Z3C3|CBPA_SHISS Curved DNA-binding protein OS=Shigella sonnei (strain Ss046) GN=cbpA PE=3 SV=1 447 539 8.0E-08
sp|O85213|DNAJ_CAMJE Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dnaJ PE=3 SV=2 449 506 8.0E-08
sp|Q1RDL6|CBPA_ECOUT Curved DNA-binding protein OS=Escherichia coli (strain UTI89 / UPEC) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|Q8FJ50|CBPA_ECOL6 Curved DNA-binding protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|Q0TJ66|CBPA_ECOL5 Curved DNA-binding protein OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|A1A9Q7|CBPA_ECOK1 Curved DNA-binding protein OS=Escherichia coli O1:K1 / APEC GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|B7MPT2|CBPA_ECO81 Curved DNA-binding protein OS=Escherichia coli O81 (strain ED1a) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|B7MIE6|CBPA_ECO45 Curved DNA-binding protein OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|B7UNY3|CBPA_ECO27 Curved DNA-binding protein OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|Q5HTK3|DNAJ_CAMJR Chaperone protein DnaJ OS=Campylobacter jejuni (strain RM1221) GN=dnaJ PE=3 SV=1 449 506 9.0E-08
sp|Q7C254|CBPA_SHIFL Curved DNA-binding protein OS=Shigella flexneri GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|Q0T634|CBPA_SHIF8 Curved DNA-binding protein OS=Shigella flexneri serotype 5b (strain 8401) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|Q31YR1|CBPA_SHIBS Curved DNA-binding protein OS=Shigella boydii serotype 4 (strain Sb227) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|B6I976|CBPA_ECOSE Curved DNA-binding protein OS=Escherichia coli (strain SE11) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|P36659|CBPA_ECOLI Curved DNA-binding protein OS=Escherichia coli (strain K12) GN=cbpA PE=1 SV=2 447 539 9.0E-08
sp|B1IV97|CBPA_ECOLC Curved DNA-binding protein OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|A7ZYV2|CBPA_ECOHS Curved DNA-binding protein OS=Escherichia coli O9:H4 (strain HS) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|B1X8V5|CBPA_ECODH Curved DNA-binding protein OS=Escherichia coli (strain K12 / DH10B) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|C4ZQC8|CBPA_ECOBW Curved DNA-binding protein OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|B7M8Y3|CBPA_ECO8A Curved DNA-binding protein OS=Escherichia coli O8 (strain IAI1) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|B7NLC5|CBPA_ECO7I Curved DNA-binding protein OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|A7ZKA5|CBPA_ECO24 Curved DNA-binding protein OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|Q5WV16|DNAJ_LEGPL Chaperone protein DnaJ OS=Legionella pneumophila (strain Lens) GN=dnaJ PE=3 SV=1 445 512 9.0E-08
sp|C1DFM2|DNAJ_AZOVD Chaperone protein DnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1 446 506 9.0E-08
sp|P50025|DNAJ_LEGPN Chaperone protein DnaJ OS=Legionella pneumophila GN=dnaJ PE=3 SV=1 445 512 9.0E-08
sp|Q5ZTY4|DNAJ_LEGPH Chaperone protein DnaJ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaJ PE=3 SV=1 445 512 9.0E-08
sp|A5IDK7|DNAJ_LEGPC Chaperone protein DnaJ OS=Legionella pneumophila (strain Corby) GN=dnaJ PE=3 SV=1 445 512 9.0E-08
sp|Q5X3M8|DNAJ_LEGPA Chaperone protein DnaJ OS=Legionella pneumophila (strain Paris) GN=dnaJ PE=3 SV=1 445 512 9.0E-08
sp|B5YU43|CBPA_ECO5E Curved DNA-binding protein OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cbpA PE=3 SV=1 447 539 9.0E-08
sp|Q54M21|DNJC3_DICDI DnaJ homolog subfamily C member 3 homolog OS=Dictyostelium discoideum GN=dnajc3 PE=3 SV=1 38 278 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|078020
MRLPRLVLGLLCLGGAYADQGGLYPPGLLPLINRANALLSTGQFSEAAKIYTEAIDQSPADYLLYYKRATAQLSL
QRHAAALEDFNKVLSLTSNTFDNAHLMKARIYIKEGQYDLARPSLKLYMKAKSKDQDAEELEKEIEEGEQLYLKL
DKERKSQLWTACVDTASSLLRKASHAVEVRSWRAECAFASGDLESAAGDLSRLSHLLQPSTTLLSHIFRLSYFLL
PPSPGAMNALKQCLLYDPDSKICLPQHRLVKNLDKGFAQVDELLGKEDWRGVVKLLLTSGGGKTSDLWRKFEDAM
EENVKEDAILPLIPPELLESAIPDANKKTKKLVLKSLPMPNASKISVQRQTLVRALCKSFTHLADQSKGDEYKRQ
MGKWCSELLTLEGCADDMDGLVGKGEDHLGNEEYDEAVRVFEKAFEASGRSDRNIHSRLQKAQKLLKQSKQKDYY
KVLGVSRDADEKTIRKAFRQAAKSAHPDKGGSEAKMSTINEAYEVLTDPELRARFDAGDDPNDPSGGMGGNPFAQ
GGHPFGQFFNSGGFPGGSGGFQFHFNGHAGGRKGH*
Coding >AgabiH97|078020
ATGCGTCTACCTCGGCTGGTTCTGGGTCTGCTCTGTCTAGGCGGTGCCTACGCTGACCAGGGCGGGCTGTATCCT
CCAGGACTCCTACCACTCATTAACAGAGCTAATGCTCTTCTTTCTACCGGCCAGTTCAGTGAAGCGGCCAAGATA
TACACCGAAGCCATCGACCAATCACCTGCAGATTATTTATTATATTATAAACGCGCTACTGCCCAACTCTCTCTC
CAACGACATGCCGCAGCTCTCGAGGACTTTAACAAAGTCCTGTCGCTGACCTCAAACACTTTTGACAACGCCCAC
CTCATGAAGGCTCGTATCTATATCAAAGAAGGCCAGTATGACCTAGCAAGACCTTCCCTCAAACTCTACATGAAG
GCCAAGAGTAAAGACCAGGATGCGGAAGAGTTGGAGAAAGAAATTGAAGAGGGGGAACAGCTCTATTTGAAACTT
GACAAGGAGAGAAAATCGCAGCTATGGACAGCTTGCGTGGACACCGCCAGCTCACTCTTGAGGAAAGCCAGCCAC
GCTGTTGAGGTGCGGAGTTGGCGCGCCGAATGTGCTTTTGCTTCGGGAGACCTCGAGAGTGCCGCTGGTGACCTT
TCTCGTTTGTCACATCTCTTGCAGCCATCTACCACGCTTCTCAGCCACATATTTCGACTCTCATATTTCCTACTA
CCACCGTCACCTGGTGCGATGAACGCACTCAAGCAATGCCTTCTCTACGACCCGGATTCCAAGATCTGTCTTCCG
CAACACCGTCTCGTAAAGAACTTGGATAAAGGTTTTGCGCAAGTAGATGAACTGCTGGGAAAAGAAGATTGGCGT
GGTGTCGTGAAGCTATTACTCACCTCAGGTGGTGGTAAGACAAGCGATCTCTGGCGTAAATTTGAAGATGCTATG
GAAGAAAACGTGAAGGAGGATGCTATTCTACCTCTCATTCCTCCAGAACTCCTCGAGAGCGCTATTCCCGACGCC
AACAAGAAAACAAAGAAGCTCGTTCTAAAGTCCTTACCCATGCCCAACGCGTCGAAAATATCCGTTCAACGACAG
ACTCTTGTCCGTGCTCTATGTAAATCATTCACACATCTCGCCGACCAATCTAAAGGAGATGAGTATAAGAGACAA
ATGGGTAAATGGTGTTCTGAGCTGTTGACGTTGGAAGGATGTGCGGATGATATGGACGGTCTGGTTGGAAAGGGT
GAAGATCATCTGGGGAATGAGGAGTACGATGAGGCTGTGAGGGTTTTTGAAAAAGCTTTCGAGGCCAGTGGACGT
AGCGACCGTAACATCCATTCTCGCCTTCAGAAAGCTCAGAAACTCCTCAAACAGTCGAAACAAAAAGACTATTAC
AAAGTCCTCGGAGTTTCTCGCGATGCAGACGAAAAGACTATTAGAAAGGCATTCCGTCAAGCCGCCAAATCTGCT
CATCCTGATAAGGGTGGATCTGAAGCCAAAATGTCAACAATCAATGAGGCTTATGAGGTTCTTACCGATCCGGAA
TTGCGAGCTCGGTTTGATGCTGGTGACGATCCGAATGACCCGAGTGGTGGTATGGGAGGGAATCCTTTCGCTCAG
GGTGGTCATCCGTTTGGTCAATTCTTTAACAGTGGTGGGTTCCCTGGTGGTTCTGGAGGTTTCCAATTCCACTTC
AATGGTCATGCTGGAGGGCGGAAGGGTCATTAG
Transcript >AgabiH97|078020
ATGCGTCTACCTCGGCTGGTTCTGGGTCTGCTCTGTCTAGGCGGTGCCTACGCTGACCAGGGCGGGCTGTATCCT
CCAGGACTCCTACCACTCATTAACAGAGCTAATGCTCTTCTTTCTACCGGCCAGTTCAGTGAAGCGGCCAAGATA
TACACCGAAGCCATCGACCAATCACCTGCAGATTATTTATTATATTATAAACGCGCTACTGCCCAACTCTCTCTC
CAACGACATGCCGCAGCTCTCGAGGACTTTAACAAAGTCCTGTCGCTGACCTCAAACACTTTTGACAACGCCCAC
CTCATGAAGGCTCGTATCTATATCAAAGAAGGCCAGTATGACCTAGCAAGACCTTCCCTCAAACTCTACATGAAG
GCCAAGAGTAAAGACCAGGATGCGGAAGAGTTGGAGAAAGAAATTGAAGAGGGGGAACAGCTCTATTTGAAACTT
GACAAGGAGAGAAAATCGCAGCTATGGACAGCTTGCGTGGACACCGCCAGCTCACTCTTGAGGAAAGCCAGCCAC
GCTGTTGAGGTGCGGAGTTGGCGCGCCGAATGTGCTTTTGCTTCGGGAGACCTCGAGAGTGCCGCTGGTGACCTT
TCTCGTTTGTCACATCTCTTGCAGCCATCTACCACGCTTCTCAGCCACATATTTCGACTCTCATATTTCCTACTA
CCACCGTCACCTGGTGCGATGAACGCACTCAAGCAATGCCTTCTCTACGACCCGGATTCCAAGATCTGTCTTCCG
CAACACCGTCTCGTAAAGAACTTGGATAAAGGTTTTGCGCAAGTAGATGAACTGCTGGGAAAAGAAGATTGGCGT
GGTGTCGTGAAGCTATTACTCACCTCAGGTGGTGGTAAGACAAGCGATCTCTGGCGTAAATTTGAAGATGCTATG
GAAGAAAACGTGAAGGAGGATGCTATTCTACCTCTCATTCCTCCAGAACTCCTCGAGAGCGCTATTCCCGACGCC
AACAAGAAAACAAAGAAGCTCGTTCTAAAGTCCTTACCCATGCCCAACGCGTCGAAAATATCCGTTCAACGACAG
ACTCTTGTCCGTGCTCTATGTAAATCATTCACACATCTCGCCGACCAATCTAAAGGAGATGAGTATAAGAGACAA
ATGGGTAAATGGTGTTCTGAGCTGTTGACGTTGGAAGGATGTGCGGATGATATGGACGGTCTGGTTGGAAAGGGT
GAAGATCATCTGGGGAATGAGGAGTACGATGAGGCTGTGAGGGTTTTTGAAAAAGCTTTCGAGGCCAGTGGACGT
AGCGACCGTAACATCCATTCTCGCCTTCAGAAAGCTCAGAAACTCCTCAAACAGTCGAAACAAAAAGACTATTAC
AAAGTCCTCGGAGTTTCTCGCGATGCAGACGAAAAGACTATTAGAAAGGCATTCCGTCAAGCCGCCAAATCTGCT
CATCCTGATAAGGGTGGATCTGAAGCCAAAATGTCAACAATCAATGAGGCTTATGAGGTTCTTACCGATCCGGAA
TTGCGAGCTCGGTTTGATGCTGGTGACGATCCGAATGACCCGAGTGGTGGTATGGGAGGGAATCCTTTCGCTCAG
GGTGGTCATCCGTTTGGTCAATTCTTTAACAGTGGTGGGTTCCCTGGTGGTTCTGGAGGTTTCCAATTCCACTTC
AATGGTCATGCTGGAGGGCGGAAGGGTCATTAG
Gene >AgabiH97|078020
ATGCGTCTACCTCGGCTGGTTCTGGGTCTGCTCTGTCTAGGCGGTGCCTACGCTGACCAGGGCGGGCTGTATCCT
CCAGGACTCCTACCACTCATTAACAGAGCTAATGCTCTTCTTTCTACCGGCCAGTTCAGTGAAGCGGCCAAGATA
TACACCGAAGCCATCGGTATGGTTCAGTTCTACTTGTACAGGAAATTGTATAGCTGACGGTTAGTCCACAGACCA
ATCACCTGCAGATTATTTATTATATTATAAACGCGCTACTGCCCAACTCTCTCTCCAACGACATGCCGCAGCTCT
CGAGGACTTTAACAAAGTCCTGTCGCTGACCTCAAACACTTTTGACAACGCCCACCTCATGAAGGCTCGTATCTA
TATCAAAGAAGGCCAGTATGACCTAGCAAGACCTTCCCTCAAACTCTACATGAAGGCCAAGAGTAAAGACCAGGA
TGCGGAAGAGTTGGAGAAAGAAATTGAAGAGGGGGAACAGCTCTATTTGAAACTTGACAAGGAGAGAAAATCGCA
GCTATGGACAGCTTGCGTGGACACCGCCAGCTCACTCTTGAGGAAAGCCAGCCACGCTGTTGAGGTGCGGAGTTG
GCGCGCCGAATGTGCTTTTGCTTCGGGAGACCTCGAGAGTGCCGCTGGTGACCTTTCGTAAGCGATCGTTCTCTC
ATTGTGGCGAAATTATCCAACTTATCGCTTGATAGTCGTTTGTCACATCTCTTGCAGCCATCTACCACGCTTCTC
AGCCACATATTTCGACTCTCATATTTCCTACTACCACCGTCACCTGGTGCGATGAACGCACTCAAGCAATGCCTT
CTCTACGACCCGGATTCCAAGATCTGTCTTCCGCAACACCGTCTCGTAAAGAACTTGGATAAAGGTTTTGCGCAA
GTAGATGAACTGCTGGGAAAAGAAGATTGGCGTGGTGTCGTGAAGCTATTACTCACCTCAGGTGGTGGTAAGACA
AGCGATCTCTGGCGTAAATTTGAAGATGCTATGGAAGAAAACGTGAAGGAGGATGCTATTCTACCTCTCATTCCT
CCAGAACTCCTCGAGAGCGCTATTCCCGACGCCAACAAGAAAACAAAGAAGCTCGTTCTAAAGTCCTTACCCATG
CCCAACGCGTCGAAAATATCCGTTCAACGACAGACTCTTGTCCGTGCTCTATGTAAATCATTCACACATCTCGCC
GACCAATCTAAAGGAGATGAGTATAAGAGACAAATGGGTAAATGGTGTTCTGAGCTGTTGACGTTGGAAGGATGT
GCGGATGATATGGACGGTCTGGTTGGAAAGGGTGAAGATCATCTGGGGAATGAGGAGTACGATGAGGCTGTGAGG
GTTTTTGAAAAAGCTTTCGAGGCCAGTGGACGTAGCGACCGTAACGTAAGCTTTCATTTTTTCCTCAAATACCTC
CTATGTATCTTATAACCCCTCATCTAGATCCATTCTCGCCTTCAGAAAGCTCAGAAACTCCTCAAACAGTCGAAA
CAAAAAGACTATTACAAAGTCCTCGGAGTTTCTCGCGATGCAGACGAAAAGACTATTAGAAAGGCATTCCGTCAA
GCCGCCAAATCTGCTCATCCTGATAAGGGTGGATCTGAAGCCAAAATGTCAACAATCAATGAGGCTTATGAGGTT
CTTACCGATCCGGAATTGCGAGCTCGGTTTGATGCTGGTGACGATCCGAATGACCCGAGTGGTGGTATGGGAGGG
AATCCTTTCGCTCAGGGTGGTCATCCGTTTGGTCAATTCTTTAACAGTGGTGGGTTCCCTGGTGGTTCTGGAGGT
TTCCAATTCCACTTCAATGGTCATGCTGGAGGGCGGAAGGGTCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail