Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|077870
Gene name
Locationscaffold_4:3009212..3010456
Strand-
Gene length (bp)1244
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10282 Lactonase Lactonase, 7-bladed beta-propeller 5.6E-37 6 327

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34499|6PGL_BACSU 6-phosphogluconolactonase OS=Bacillus subtilis (strain 168) GN=pgl PE=1 SV=1 14 351 4.0E-09
sp|D4B0N9|6PGL_ARTBC Probable 6-phosphogluconolactonase ARB_02015 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02015 PE=1 SV=1 6 312 3.0E-08
sp|Q8CRT1|Y1604_STAES Uncharacterized protein SE_1604 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1604 PE=3 SV=1 34 348 4.0E-06
sp|Q5HN15|Y1457_STAEQ Uncharacterized protein SERP1457 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1457 PE=3 SV=1 34 348 4.0E-06
sp|O59681|YBS1_SCHPO Uncharacterized protein C18E5.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18E5.01 PE=3 SV=1 18 229 7.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|077870
MAFRILAGGYDNFVATYLFDPQSSSLSVASRSTTGINPSWLTGHPTNASIFYATNENADGGLQSFTINSDGSLVT
QDTVSSGGDSPAFAVALSTGQVAVMNYNTGNGRVVPTNEGLVFEQNAAVEKFPLENSTSVSHPHMALEHGGEIYV
PDLGQDKIWRLVQNGSNPSSFVIHGSLPHPLGSGPRHIAIHEDRLFTIHELSSTLTVQAVPASLDETTQITSSVS
IIPPDQPQGSQFAAAEILIPSPTSKFPTPYIYVSNRNIGRALDPRGDSIAIFELVNKGTQDESLQLVNQIFTGLT
QIRGMEFGPSSQGGEDFLIAAGVVGDAGTVVLQRTDGGRNMTVVSRNADIPTRTSFLWI*
Coding >AgabiH97|077870
ATGGCGTTCAGAATCCTTGCCGGAGGATATGACAACTTCGTTGCCACCTATCTATTCGACCCACAATCATCTTCC
CTCTCGGTCGCAAGCCGCTCTACAACCGGTATAAATCCATCATGGCTCACGGGCCACCCCACCAATGCGAGCATC
TTCTATGCTACCAATGAGAATGCAGATGGCGGTTTACAGTCATTCACCATCAACTCGGATGGATCCCTAGTAACC
CAAGATACGGTTTCATCTGGCGGAGACTCGCCGGCATTCGCGGTAGCTCTTTCAACGGGACAAGTTGCGGTGATG
AACTATAATACTGGTAACGGGCGTGTGGTTCCTACCAACGAGGGTTTGGTTTTCGAACAAAATGCTGCCGTGGAA
AAGTTTCCACTTGAAAATAGTACTTCTGTTTCTCACCCACACATGGCTTTGGAGCACGGAGGTGAGATATATGTC
CCAGATTTGGGACAAGACAAGATCTGGCGACTAGTCCAGAACGGGAGCAACCCTAGTTCCTTCGTGATCCATGGA
TCCCTTCCTCACCCGCTTGGAAGCGGCCCGCGTCATATTGCCATTCATGAGGATCGATTGTTTACGATACACGAG
CTCTCCTCCACATTGACCGTTCAGGCAGTACCGGCTTCACTCGATGAGACTACGCAGATAACTTCCTCGGTGTCA
ATCATCCCTCCTGATCAACCTCAAGGTTCACAATTCGCTGCTGCAGAAATCCTTATCCCAAGTCCTACTTCGAAA
TTCCCCACTCCCTATATCTACGTCTCAAACAGGAATATTGGGAGAGCACTTGATCCTCGAGGAGATTCCATCGCG
ATTTTTGAATTGGTTAACAAGGGAACGCAGGACGAGTCTTTGCAACTCGTTAATCAGATTTTCACAGGCCTCACA
CAAATTAGAGGAATGGAATTTGGACCATCGAGTCAAGGCGGAGAAGACTTTTTGATTGCTGCTGGTGTGGTTGGA
GATGCGGGAACCGTGGTCTTGCAACGAACTGATGGTGGTAGGAATATGACAGTCGTTTCTAGAAATGCGGACATC
CCTACTCGTACCAGTTTCCTTTGGATCTAA
Transcript >AgabiH97|077870
ATGGCGTTCAGAATCCTTGCCGGAGGATATGACAACTTCGTTGCCACCTATCTATTCGACCCACAATCATCTTCC
CTCTCGGTCGCAAGCCGCTCTACAACCGGTATAAATCCATCATGGCTCACGGGCCACCCCACCAATGCGAGCATC
TTCTATGCTACCAATGAGAATGCAGATGGCGGTTTACAGTCATTCACCATCAACTCGGATGGATCCCTAGTAACC
CAAGATACGGTTTCATCTGGCGGAGACTCGCCGGCATTCGCGGTAGCTCTTTCAACGGGACAAGTTGCGGTGATG
AACTATAATACTGGTAACGGGCGTGTGGTTCCTACCAACGAGGGTTTGGTTTTCGAACAAAATGCTGCCGTGGAA
AAGTTTCCACTTGAAAATAGTACTTCTGTTTCTCACCCACACATGGCTTTGGAGCACGGAGGTGAGATATATGTC
CCAGATTTGGGACAAGACAAGATCTGGCGACTAGTCCAGAACGGGAGCAACCCTAGTTCCTTCGTGATCCATGGA
TCCCTTCCTCACCCGCTTGGAAGCGGCCCGCGTCATATTGCCATTCATGAGGATCGATTGTTTACGATACACGAG
CTCTCCTCCACATTGACCGTTCAGGCAGTACCGGCTTCACTCGATGAGACTACGCAGATAACTTCCTCGGTGTCA
ATCATCCCTCCTGATCAACCTCAAGGTTCACAATTCGCTGCTGCAGAAATCCTTATCCCAAGTCCTACTTCGAAA
TTCCCCACTCCCTATATCTACGTCTCAAACAGGAATATTGGGAGAGCACTTGATCCTCGAGGAGATTCCATCGCG
ATTTTTGAATTGGTTAACAAGGGAACGCAGGACGAGTCTTTGCAACTCGTTAATCAGATTTTCACAGGCCTCACA
CAAATTAGAGGAATGGAATTTGGACCATCGAGTCAAGGCGGAGAAGACTTTTTGATTGCTGCTGGTGTGGTTGGA
GATGCGGGAACCGTGGTCTTGCAACGAACTGATGGTGGTAGGAATATGACAGTCGTTTCTAGAAATGCGGACATC
CCTACTCGTACCAGTTTCCTTTGGATCTAA
Gene >AgabiH97|077870
ATGGCGTTCAGAATCCTTGCCGGAGGATATGACAACTTCGTTGCCACCTATCTATTCGACCCACAATCATCTTCC
CTCTCGGTCGCAAGCCGCTCTACAACCGGTATAAATCCATCATGGCTCACGGGCCACCCCACCAATGCGAGCATC
TTCTAGTGAGTATCTGGTAAATCCCTCGTTCCATGATCATCTTCGATAACCACGTGGTTAGTGCTACCAATGAGA
ATGCAGATGGCGGTTTACAGTCATTCACCATCAACTCGGATGGATCCCTAGTAACCCAAGATACGGTTTCATCTG
GCGGAGACTCGCCGGCATTCGCGGTAGCTCTTTCAACGGGACAAGTTGCGGTGATGAACTATAATACTGGTAACG
GGCGTGTGGTTCCTACCAACGAGGGTTTGGTTTTCGAACAAAATGCTGCCGTGGAAAAGTTTCCACTTGAAAATA
GTACTTCTGTTTCTCACCCACACATGGCTTTGGAGCACGGAGGTGAGATATATGTCCCAGATTTGGTCAGTAGTT
ATTACATCTTCGTTCTGTCCTTGACTGGTGTTCATGTATATTCAAGGGACAAGACAAGATCTGGCGACTAGTCCA
GAACGGGAGCAACCCTAGTTCCTTCGTGATCCATGGATCCCTTCCTCACCCGCTTGGAAGCGGCCCGCGTCATAT
TGCCATTCATGGTACGTCTTCCCCATTTATATTATCGTTAAGCAAAAGTTGACAACTATGCAGAGGATCGATTGT
TTACGATACACGAGCTCTCCTCCACATTGACCGTTCAGGCAGTACCGGCTTCACTCGATGAGACTACGCAGATAA
CTTCCTCGGTGTCAATCATCCCTCCTGATCAACCTCAAGGTTCACAATTCGCTGCTGCAGAAATCCTTATCCCAA
GTCCTACTTCGAAATTCCCCACTCCCTATATCTACGTCTCAAACAGGAATATTGGGAGAGCACTTGATCCTCGAG
GAGATTCCATCGCGATTTTTGAATTGGTTAACAAGGGAACGCAGGACGAGTCTTTGCAACTCGTTAATCAGATTT
TCACAGGCCTCACACAAATTAGAGGAATGGAATTTGGACCATCGAGTCAAGGCGGAGAAGACTTTTTGATTGCTG
CTGGTGTGGTTGGAGATGCGGGAACCGTGGTCTTGCAACGAACTGATGGTGGTAGGAATATGACAGTCGTTTCTA
GAAATGCGGACATCCCTACTCGTACCAGTTTCCTTTGGATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail