Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|077830
Gene name
Locationscaffold_4:3000563..3001117
Strand-
Gene length (bp)554
Transcript length (bp)381
Coding sequence length (bp)381
Protein length (aa) 127

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 671.54 398.70 944.38
Initials Initials knots 4.22 0.58 7.86
Pileal_Stipeal_center Stage I stipe center 4.11 0.66 7.55
Pileal_Stipeal_shell Stage I stipe shell 4.09 0.55 7.63
DIF_stipe_center Stage II stipe center 2.93 0.22 5.64
DIF_stipe_shell Stage II stipe shell 2.50 0.10 4.90
DIF_stipe_skin Stage II stipe skin 1.89 0.00 3.85
DIF_cap_skin Stage II cap skin 0.87 0.00 2.03
DIF_cap_tissue Stage II cap tissue 0.95 0.00 2.19
DIF_gill_tissue Stage II gill tissue 2.76 0.15 5.36
YFB_stipe_center Young fruiting body stipe center 4.33 0.59 8.07
YFB_stipe_shell Young fruiting body stipe shell 2.99 0.25 5.74
YFB_stipe_skin Young fruiting body stipe skin 2.94 0.26 5.61
YFB_cap_skin Young fruiting body cap skin 1.41 0.00 3.06
YFB_cap_tissue Young fruiting body cap tissue 1.22 0.00 2.70
YFB_gill_tissue Young fruiting body gill tissue 1.28 0.00 2.83
YFB_veil Young fruiting body veil 1.63 0.00 3.44

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.001140 yes
Casing YFB_cap_tissue 0.004928 yes
Casing YFB_gill_tissue 0.002084 yes
Casing YFB_veil 0.001625 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.010093 yes
Casing DIF_cap_tissue 0.008121 yes
DIF_gill_tissue YFB_stipe_center 0.586018 no
DIF_gill_tissue YFB_stipe_shell 0.947431 no
DIF_gill_tissue YFB_stipe_skin 0.959277 no
DIF_gill_tissue YFB_cap_skin 0.454422 no
DIF_gill_tissue YFB_cap_tissue 0.367909 no
DIF_gill_tissue YFB_gill_tissue 0.401404 no
DIF_gill_tissue YFB_veil 0.588853 no
YFB_stipe_center YFB_stipe_shell 0.681619 no
YFB_stipe_center YFB_stipe_skin 0.667662 no
YFB_stipe_center YFB_cap_skin 0.145389 no
YFB_stipe_center YFB_cap_tissue 0.130962 no
YFB_stipe_center YFB_gill_tissue 0.151916 no
YFB_stipe_center YFB_veil 0.228145 no
YFB_stipe_shell YFB_stipe_skin 0.987067 no
YFB_stipe_shell YFB_cap_skin 0.383535 no
YFB_stipe_shell YFB_cap_tissue 0.310391 no
YFB_stipe_shell YFB_gill_tissue 0.333988 no
YFB_stipe_shell YFB_veil 0.506143 no
YFB_stipe_skin YFB_cap_skin 0.405293 no
YFB_stipe_skin YFB_cap_tissue 0.326052 no
YFB_stipe_skin YFB_gill_tissue 0.354742 no
YFB_stipe_skin YFB_veil 0.532035 no
YFB_cap_skin YFB_cap_tissue 0.925128 no
YFB_cap_skin YFB_gill_tissue 0.949232 no
YFB_cap_skin YFB_veil 0.924285 no
YFB_cap_tissue YFB_gill_tissue 0.977266 no
YFB_cap_tissue YFB_veil 0.832596 no
YFB_gill_tissue YFB_veil 0.872830 no
Initials DIF_gill_tissue 0.617359 no
Initials YFB_stipe_center 0.982792 no
Initials YFB_stipe_shell 0.704974 no
Initials YFB_stipe_skin 0.686487 no
Initials YFB_cap_skin 0.168023 no
Initials YFB_cap_tissue 0.141808 no
Initials YFB_gill_tissue 0.158774 no
Initials YFB_veil 0.246090 no
Initials Pileal_Stipeal_center 0.982143 no
Initials Pileal_Stipeal_shell 0.977358 no
Initials DIF_stipe_center 0.681508 no
Initials DIF_stipe_shell 0.526224 no
Initials DIF_stipe_skin 0.299835 no
Initials DIF_cap_skin 0.102511 no
Initials DIF_cap_tissue 0.099929 no
Pileal_Stipeal_center DIF_gill_tissue 0.637388 no
Pileal_Stipeal_center YFB_stipe_center 0.962798 no
Pileal_Stipeal_center YFB_stipe_shell 0.726289 no
Pileal_Stipeal_center YFB_stipe_skin 0.709955 no
Pileal_Stipeal_center YFB_cap_skin 0.163563 no
Pileal_Stipeal_center YFB_cap_tissue 0.146995 no
Pileal_Stipeal_center YFB_gill_tissue 0.163972 no
Pileal_Stipeal_center YFB_veil 0.244911 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.989199 no
Pileal_Stipeal_center DIF_stipe_center 0.700196 no
Pileal_Stipeal_center DIF_stipe_shell 0.540853 no
Pileal_Stipeal_center DIF_stipe_skin 0.306061 no
Pileal_Stipeal_center DIF_cap_skin 0.102673 no
Pileal_Stipeal_center DIF_cap_tissue 0.106659 no
Pileal_Stipeal_shell DIF_gill_tissue 0.654234 no
Pileal_Stipeal_shell YFB_stipe_center 0.960010 no
Pileal_Stipeal_shell YFB_stipe_shell 0.741131 no
Pileal_Stipeal_shell YFB_stipe_skin 0.723330 no
Pileal_Stipeal_shell YFB_cap_skin 0.173847 no
Pileal_Stipeal_shell YFB_cap_tissue 0.152734 no
Pileal_Stipeal_shell YFB_gill_tissue 0.176439 no
Pileal_Stipeal_shell YFB_veil 0.257773 no
Pileal_Stipeal_shell DIF_stipe_center 0.718138 no
Pileal_Stipeal_shell DIF_stipe_shell 0.558288 no
Pileal_Stipeal_shell DIF_stipe_skin 0.321437 no
Pileal_Stipeal_shell DIF_cap_skin 0.103472 no
Pileal_Stipeal_shell DIF_cap_tissue 0.107767 no
DIF_stipe_center DIF_gill_tissue 0.960889 no
DIF_stipe_center YFB_stipe_center 0.650250 no
DIF_stipe_center YFB_stipe_shell 0.987527 no
DIF_stipe_center YFB_stipe_skin 0.987088 no
DIF_stipe_center YFB_cap_skin 0.395889 no
DIF_stipe_center YFB_cap_tissue 0.318065 no
DIF_stipe_center YFB_gill_tissue 0.347136 no
DIF_stipe_center YFB_veil 0.521681 no
DIF_stipe_center DIF_stipe_shell 0.893319 no
DIF_stipe_center DIF_stipe_skin 0.650100 no
DIF_stipe_center DIF_cap_skin 0.190974 no
DIF_stipe_center DIF_cap_tissue 0.204693 no
DIF_stipe_shell DIF_gill_tissue 0.938842 no
DIF_stipe_shell YFB_stipe_center 0.492314 no
DIF_stipe_shell YFB_stipe_shell 0.873714 no
DIF_stipe_shell YFB_stipe_skin 0.893499 no
DIF_stipe_shell YFB_cap_skin 0.548818 no
DIF_stipe_shell YFB_cap_tissue 0.452131 no
DIF_stipe_shell YFB_gill_tissue 0.490031 no
DIF_stipe_shell YFB_veil 0.689996 no
DIF_stipe_shell DIF_stipe_skin 0.803462 no
DIF_stipe_shell DIF_cap_skin 0.268668 no
DIF_stipe_shell DIF_cap_tissue 0.305339 no
DIF_stipe_skin DIF_gill_tissue 0.711011 no
DIF_stipe_skin YFB_stipe_center 0.272837 no
DIF_stipe_skin YFB_stipe_shell 0.623015 no
DIF_stipe_skin YFB_stipe_skin 0.646489 no
DIF_stipe_skin YFB_cap_skin 0.810202 no
DIF_stipe_skin YFB_cap_tissue 0.718803 no
DIF_stipe_skin YFB_gill_tissue 0.750261 no
DIF_stipe_skin YFB_veil 0.918352 no
DIF_stipe_skin DIF_cap_skin 0.476166 no
DIF_stipe_skin DIF_cap_tissue 0.544449 no
DIF_cap_skin DIF_gill_tissue 0.221032 no
DIF_cap_skin YFB_stipe_center 0.101862 no
DIF_cap_skin YFB_stipe_shell 0.190496 no
DIF_cap_skin YFB_stipe_skin 0.197355 no
DIF_cap_skin YFB_cap_skin 0.708942 no
DIF_cap_skin YFB_cap_tissue 0.835568 no
DIF_cap_skin YFB_gill_tissue 0.792772 no
DIF_cap_skin YFB_veil 0.606272 no
DIF_cap_skin DIF_cap_tissue 0.964937 no
DIF_cap_tissue DIF_gill_tissue 0.252836 no
DIF_cap_tissue YFB_stipe_center 0.101372 no
DIF_cap_tissue YFB_stipe_shell 0.212151 no
DIF_cap_tissue YFB_stipe_skin 0.218742 no
DIF_cap_tissue YFB_cap_skin 0.776711 no
DIF_cap_tissue YFB_cap_tissue 0.882281 no
DIF_cap_tissue YFB_gill_tissue 0.842397 no
DIF_cap_tissue YFB_veil 0.673393 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|077830
MKFTLAILPAFFALSAFGNPVELDARQMPMCDVAKCISTIGSQPGAIIAPCADAVGNLAKIQQAQAQGMQPSQAD
QFSLVSNTIKCISASIAAGFAIPAGCNGCIGAPPGGPATGFPAPGFPGFPA*
Coding >AgabiH97|077830
ATGAAATTCACTCTTGCAATTCTCCCTGCCTTCTTCGCATTGTCGGCTTTCGGTAACCCCGTTGAACTGGACGCT
CGTCAAATGCCGATGTGCGACGTTGCTAAATGCATTTCGACGATTGGCTCTCAGCCTGGCGCAATTATTGCTCCC
TGTGCAGATGCCGTTGGCAATCTTGCTAAAATTCAACAAGCTCAAGCTCAGGGCATGCAACCTAGTCAAGCTGAT
CAGTTCAGCCTTGTCTCCAACACAATCAAATGTATTTCCGCCAGCATTGCGGCCGGCTTCGCTATTCCGGCCGGT
TGTAATGGTTGCATTGGTGCCCCACCCGGTGGCCCAGCGACCGGTTTCCCAGCACCCGGTTTCCCCGGTTTCCCA
GCTTGA
Transcript >AgabiH97|077830
ATGAAATTCACTCTTGCAATTCTCCCTGCCTTCTTCGCATTGTCGGCTTTCGGTAACCCCGTTGAACTGGACGCT
CGTCAAATGCCGATGTGCGACGTTGCTAAATGCATTTCGACGATTGGCTCTCAGCCTGGCGCAATTATTGCTCCC
TGTGCAGATGCCGTTGGCAATCTTGCTAAAATTCAACAAGCTCAAGCTCAGGGCATGCAACCTAGTCAAGCTGAT
CAGTTCAGCCTTGTCTCCAACACAATCAAATGTATTTCCGCCAGCATTGCGGCCGGCTTCGCTATTCCGGCCGGT
TGTAATGGTTGCATTGGTGCCCCACCCGGTGGCCCAGCGACCGGTTTCCCAGCACCCGGTTTCCCCGGTTTCCCA
GCTTGA
Gene >AgabiH97|077830
ATGAAATTCACTCTTGCAATTCTCCCTGCCTTCTTCGCATTGTCGGCTTTCGGTAACCCCGTTGAACTGGACGCT
CGTCAAATGCCGATGTGCGACGTTGCTAGTACGTTCTCTTCAACACTCAATTTGATCATAGCCTCCTTTGCTTAC
CTTTCACTCAGAATGCATTTCGACGATTGGCTCTCAGCCTGGCGCAATTATTGCTCCCTGTGCAGATGCCGTTGG
CAATCTTGCTAAAATTCAACAAGCTCAAGCTCAGGGCATGCAACCTAGTGAGCACATTCACATAGAACATAGACA
CCGTGTTGAAACACCTCTTTTTCTAGGTCAAGCTGATCAGTTCAGCCTTGTCTCCAACACAATCAAATGTATTTC
CGCCAGCATTGCGGCCGGCTTCGCTATTGTAAGTCCCATTTCGAGTGACAACAATGTGCCAGCTCGTGAGCCCTA
AACGATTGCCACAGCCGGCCGGTTGTAATGGTTGCATTGGTGCCCCACCCGGTGGCCCAGCGACCGGTTTCCCAG
CACCCGGTTTCCCCGGTTTCCCAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail