Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|077740
Gene name
Locationscaffold_4:2983031..2984313
Strand+
Gene length (bp)1282
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10503 Esterase_PHB Esterase PHB depolymerase 1.8E-26 42 231
PF00734 CBM_1 Fungal cellulose binding domain 3.5E-12 321 349
PF00326 Peptidase_S9 Prolyl oligopeptidase family 5.6E-06 77 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 21 353 2.0E-102
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 1 353 1.0E-101
sp|B8NBI2|AXE1_ASPFN Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=axeA PE=3 SV=1 21 291 1.0E-98
sp|Q75P26|AXE1_ASPOR Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=axeA PE=1 SV=1 21 291 4.0E-98
sp|A9JPE6|AXE1_ASPFL Probable acetylxylan esterase A OS=Aspergillus flavus GN=axeA PE=3 SV=1 21 291 4.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 21 353 2.0E-102
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 1 353 1.0E-101
sp|B8NBI2|AXE1_ASPFN Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=axeA PE=3 SV=1 21 291 1.0E-98
sp|Q75P26|AXE1_ASPOR Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=axeA PE=1 SV=1 21 291 4.0E-98
sp|A9JPE6|AXE1_ASPFL Probable acetylxylan esterase A OS=Aspergillus flavus GN=axeA PE=3 SV=1 21 291 4.0E-98
sp|Q9HE18|FAEB_TALFU Feruloyl esterase B OS=Talaromyces funiculosus GN=FAEB PE=1 SV=1 27 353 2.0E-96
sp|Q5B037|AXE1_EMENI Acetylxylan esterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=axeA PE=1 SV=2 27 291 2.0E-96
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 21 353 3.0E-93
sp|B8M9H9|FAEB_TALSN Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=faeB PE=1 SV=1 27 353 8.0E-91
sp|Q96W96|AXE1_ASPFI Acetylxylan esterase A OS=Aspergillus ficuum GN=axeA PE=1 SV=1 11 290 9.0E-89
sp|A1CSZ8|AXE1_ASPCL Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=axeA PE=3 SV=1 21 290 2.0E-88
sp|A2QZI3|AXE1_ASPNC Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=axeA PE=3 SV=1 11 290 3.0E-88
sp|Q92194|AXE1_ASPAW Acetylxylan esterase A OS=Aspergillus awamori GN=axeA PE=1 SV=2 18 290 9.0E-88
sp|Q0C8Z1|AXE1_ASPTN Probable acetylxylan esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=axeA PE=3 SV=1 21 290 4.0E-84
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 27 290 1.0E-70
sp|G2QND5|FAEB_MYCTT Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Fae1a PE=1 SV=1 14 290 3.0E-70
sp|Q9HGR3|FAEB_NEUCR Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fae-1 PE=2 SV=2 26 290 8.0E-68
sp|P52090|PHA1_PAULE Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei GN=phaZ1 PE=3 SV=1 4 255 4.0E-39
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 304 353 2.0E-11
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 307 353 2.0E-10
sp|P12625|PHB_RALPI Poly(3-hydroxybutyrate) depolymerase OS=Ralstonia pickettii PE=3 SV=1 4 169 7.0E-10
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 307 353 3.0E-09
sp|P62695|GUX1_TRIKO Exoglucanase 1 OS=Trichoderma koningii GN=cbh1 PE=3 SV=1 316 353 5.0E-09
sp|P62694|GUX1_HYPJE Exoglucanase 1 OS=Hypocrea jecorina GN=cbh1 PE=1 SV=1 316 353 5.0E-09
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 294 353 5.0E-09
sp|B8YG19|XS20E_NEOPA Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum GN=xynS20E PE=1 SV=1 40 214 7.0E-09
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 304 353 2.0E-08
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 314 353 2.0E-08
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 314 353 2.0E-08
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 303 353 2.0E-08
sp|Q7SA23|GUX1A_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 295 353 3.0E-08
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 313 353 5.0E-08
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 313 352 2.0E-07
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 320 353 3.0E-07
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 320 353 4.0E-07
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 321 353 4.0E-07
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 317 353 5.0E-07
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 322 353 8.0E-07
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 322 353 8.0E-07
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 319 353 8.0E-07
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 321 353 1.0E-06
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 319 353 1.0E-06
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 322 353 1.0E-06
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 319 353 2.0E-06
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 319 353 2.0E-06
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 320 353 2.0E-06
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 319 353 2.0E-06
sp|P07981|GUN1_HYPJE Endoglucanase EG-1 OS=Hypocrea jecorina GN=egl1 PE=1 SV=1 321 353 3.0E-06
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 316 353 4.0E-06
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 321 353 4.0E-06
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 321 353 4.0E-06
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 322 353 4.0E-06
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 322 353 5.0E-06
sp|Q12714|GUN1_TRILO Endoglucanase EG-1 OS=Trichoderma longibrachiatum GN=egl1 PE=3 SV=1 321 353 5.0E-06
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 320 353 5.0E-06
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 314 353 6.0E-06
sp|P46238|GUXC_FUSOX Putative exoglucanase type C OS=Fusarium oxysporum PE=2 SV=1 293 352 6.0E-06
sp|A1DNL0|CBHB_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhB PE=3 SV=1 321 353 7.0E-06
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 322 353 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0005576 extracellular region Yes
GO:0019538 protein metabolic process No
GO:0110165 cellular anatomical entity No
GO:0030247 polysaccharide binding No
GO:0005488 binding No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0017171 serine hydrolase activity No
GO:0008150 biological_process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0008152 metabolic process No
GO:0030246 carbohydrate binding No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|077740
MFSFSKCLALIAGVVAGVNAAGPLQQQTGSWGANPTNVGFYYYKPASVSSNPALIVAIHYCSGTAQAFYSGTSYA
NLADQHGFIVIYPDAPDAGGCWDVHTTATLTHDGGGDSLAIANMVRFAISNWGVDASRVYMTGLSSGAMMTNVLA
GAYPDLFAAGSAWAGVPYGCFGGPDMWNSACSTGQITKSGQQWGSDVRSGYPGYTGPRPKLEIWQGTLDTTLNYH
NFGEGIKQWTNIFGYSETPTKVDTNWPLPNWTRSVYGPNFRAISAAGVDHNIQIQADQVLDWFGITGDGSTPPTS
PPPTTTPPSTTTSPNGPAQSQWGQCGGIGWQGPFTCVAGTTCQMINQWYSQCL*
Coding >AgabiH97|077740
ATGTTCTCCTTTTCTAAATGTCTAGCCTTAATAGCGGGGGTCGTCGCTGGAGTCAATGCGGCGGGCCCTCTGCAG
CAACAAACAGGCAGCTGGGGAGCCAATCCCACGAATGTTGGTTTTTACTACTATAAACCAGCCTCCGTATCGTCA
AATCCTGCGCTCATTGTGGCTATTCACTATTGCTCGGGTACTGCGCAAGCTTTTTACTCGGGCACTAGCTATGCC
AACTTAGCTGATCAACACGGATTCATCGTGATATACCCCGATGCGCCCGATGCTGGAGGTTGTTGGGATGTCCAC
ACTACTGCTACACTTACCCATGACGGTGGGGGTGATTCGCTTGCCATCGCAAACATGGTCCGCTTCGCTATCTCG
AACTGGGGAGTTGATGCGAGCCGCGTTTATATGACGGGACTCTCATCTGGAGCTATGATGACTAACGTACTTGCT
GGTGCGTACCCCGACCTGTTTGCGGCGGGATCAGCATGGGCTGGCGTTCCATACGGATGTTTCGGTGGTCCGGAC
ATGTGGAATAGCGCCTGTTCCACGGGACAAATCACAAAGTCTGGACAACAATGGGGTAGCGACGTGCGCTCTGGC
TACCCTGGCTATACTGGCCCTCGACCAAAGTTGGAAATATGGCAAGGAACCCTCGATACTACTCTCAATTATCAC
AACTTCGGTGAGGGCATCAAGCAATGGACCAATATATTTGGCTATTCCGAAACTCCGACCAAGGTTGACACGAAT
TGGCCCCTGCCCAACTGGACTCGGAGTGTTTACGGGCCTAACTTTCGGGCCATTAGTGCAGCTGGTGTAGACCAC
AATATTCAAATCCAGGCCGACCAAGTTCTTGACTGGTTCGGAATCACTGGTGACGGATCAACTCCTCCTACTTCG
CCACCTCCGACTACGACCCCTCCTTCTACTACCACTTCACCAAATGGACCAGCTCAAAGCCAATGGGGGCAATGT
GGCGGAATCGGATGGCAAGGGCCTTTCACTTGCGTAGCGGGGACGACTTGTCAGATGATAAACCAATGGTATTCA
CAGTGCCTTTGA
Transcript >AgabiH97|077740
ATGTTCTCCTTTTCTAAATGTCTAGCCTTAATAGCGGGGGTCGTCGCTGGAGTCAATGCGGCGGGCCCTCTGCAG
CAACAAACAGGCAGCTGGGGAGCCAATCCCACGAATGTTGGTTTTTACTACTATAAACCAGCCTCCGTATCGTCA
AATCCTGCGCTCATTGTGGCTATTCACTATTGCTCGGGTACTGCGCAAGCTTTTTACTCGGGCACTAGCTATGCC
AACTTAGCTGATCAACACGGATTCATCGTGATATACCCCGATGCGCCCGATGCTGGAGGTTGTTGGGATGTCCAC
ACTACTGCTACACTTACCCATGACGGTGGGGGTGATTCGCTTGCCATCGCAAACATGGTCCGCTTCGCTATCTCG
AACTGGGGAGTTGATGCGAGCCGCGTTTATATGACGGGACTCTCATCTGGAGCTATGATGACTAACGTACTTGCT
GGTGCGTACCCCGACCTGTTTGCGGCGGGATCAGCATGGGCTGGCGTTCCATACGGATGTTTCGGTGGTCCGGAC
ATGTGGAATAGCGCCTGTTCCACGGGACAAATCACAAAGTCTGGACAACAATGGGGTAGCGACGTGCGCTCTGGC
TACCCTGGCTATACTGGCCCTCGACCAAAGTTGGAAATATGGCAAGGAACCCTCGATACTACTCTCAATTATCAC
AACTTCGGTGAGGGCATCAAGCAATGGACCAATATATTTGGCTATTCCGAAACTCCGACCAAGGTTGACACGAAT
TGGCCCCTGCCCAACTGGACTCGGAGTGTTTACGGGCCTAACTTTCGGGCCATTAGTGCAGCTGGTGTAGACCAC
AATATTCAAATCCAGGCCGACCAAGTTCTTGACTGGTTCGGAATCACTGGTGACGGATCAACTCCTCCTACTTCG
CCACCTCCGACTACGACCCCTCCTTCTACTACCACTTCACCAAATGGACCAGCTCAAAGCCAATGGGGGCAATGT
GGCGGAATCGGATGGCAAGGGCCTTTCACTTGCGTAGCGGGGACGACTTGTCAGATGATAAACCAATGGTATTCA
CAGTGCCTTTGA
Gene >AgabiH97|077740
ATGTTCTCCTTTTCTAAATGTCTAGCCTTAATAGCGGGGGTCGTCGCTGGAGTCAATGCGGCGGGCCCTCTGCAG
CAACAAACAGGCAGCTGGGGAGCCAATCCCACGAATGTTGGTTTTTACTACTATAAACCAGCCTCCGTATCGTCA
AATCCTGCGCTCATTGTGGCTATTCACTATTGCTCGGGTACTGCGCAAGCTTTTTACTCGGGCACTAGCTATGCC
AACTTAGCTGATCAACACGGATTCATCGTGATATACCCCGATGCGCCCGATGCTGGAGGTTGTTGGGATGTCCAC
ACTACTGCTACACTTACCCATGACGGTGGGGGTGATTCGCTTGCCATCGCAAACATGGTCCGCTTCGCTATCTCG
AACTGGGGAGTTGATGCGAGCCGCGTTTATATGACGGGACTCTCATCTGGAGCTATGATGACTAACGTACTTGCT
GGTGCGTACCCCGACCTGTTTGCGGCGGGATCAGCATGGGCTGGCGTTCCATACGGATGTTTCGGTGGTCCGGAC
ATGTGGAATAGCGCCTGTTCCACGGGACAAATCACAAAGTCTGGACAACAATGGGTGGGCACGATTTTGCGTAAT
TAAGTCCGTGTTTTTGACAGCCTTTATATCAATCAGGGTAGCGACGTGCGCTCTGGCTACCCTGGCTATACTGGC
CCTCGACCAAAGTTGGAAATATGGCAAGGAACCCTGTGAGTTGATTTGCAACCCAGTCAATAAATGATTGTCTTA
CATGAACCATTCAGCGATACTACTCTCAATTATCACAACTTCGGTGAGGGCATCAAGCAATGGACCAATATATTT
GGCTATTCCGAAACTCCGACCAAGGTTGACACGAATTGGCCCCTGCCCAACTGGACTCGGAGTGTTTACGGGCCT
AACTTTCGGGCCATTAGTGCAGCTGGTGTAGACCACAATATTCAAATCCAGGCCGACCAAGTTCTTGACTGGTTC
GGAATCACTGGTGACGGATCAACTCCTCCTACTTCGCCACCTCCGACTACGACCCCTCCTTCTACTACCACTTCA
CCAAATGGACCAGCTCAAAGCCAATGGGGGCAATGTGGCGGGTATGCTGCTTTTTCGGAAATTGGCTCTTGACAT
CATTAGCTGATAATGTCTAGAATCGGATGGCAAGGGCCTTTCACTTGCGTAGCGGGGACGACTTGTCAGATGATA
AACCAATGGTATTCACAGGTACTTGCAACGCCTTCATTCATACCTTCGCCGGTAGATCTAATTTCGACTGTAGTG
CCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail