Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|077730
Gene name
Locationscaffold_4:2979274..2981589
Strand+
Gene length (bp)2315
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.7E-19 23 436
PF06813 Nodulin-like Nodulin-like 2.1E-12 16 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03795|YM30_YEAST Uncharacterized membrane protein YMR155W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR155W PE=1 SV=1 14 505 4.0E-29
sp|Q4IM48|MCH1_GIBZE Probable transporter MCH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCH1 PE=3 SV=1 12 516 3.0E-16
sp|Q9P3K8|MCH1_NEUCR Probable transporter mch1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mch1 PE=3 SV=1 7 509 1.0E-15
sp|Q96TW9|MCH1_WICAO Probable transporter MCH1 OS=Wickerhamomyces anomalus GN=MCH1 PE=3 SV=1 281 471 1.0E-10
sp|Q07376|MCH1_YEAST Probable transporter MCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH1 PE=1 SV=1 19 471 4.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03795|YM30_YEAST Uncharacterized membrane protein YMR155W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR155W PE=1 SV=1 14 505 4.0E-29
sp|Q4IM48|MCH1_GIBZE Probable transporter MCH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCH1 PE=3 SV=1 12 516 3.0E-16
sp|Q9P3K8|MCH1_NEUCR Probable transporter mch1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mch1 PE=3 SV=1 7 509 1.0E-15
sp|Q96TW9|MCH1_WICAO Probable transporter MCH1 OS=Wickerhamomyces anomalus GN=MCH1 PE=3 SV=1 281 471 1.0E-10
sp|Q07376|MCH1_YEAST Probable transporter MCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH1 PE=1 SV=1 19 471 4.0E-06
sp|F4I9E1|NFD4_ARATH Protein NUCLEAR FUSION DEFECTIVE 4 OS=Arabidopsis thaliana GN=NFD4 PE=3 SV=1 14 439 5.0E-06
sp|Q5AXV1|MCH1_EMENI Probable transporter mch1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mch1 PE=3 SV=2 316 467 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 83 105 22
3 115 137 22
4 158 180 22
5 184 206 22
6 307 329 22
7 351 373 22
8 386 408 22
9 418 440 22
10 447 466 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|077730
MASAKPPGIVSAPRITTLIASLLVSTSSGTNYAFSAWAPQLGSRLRINHTRLNVIGLAGNVGVYSSGPIWGRIVD
KRGPRIPLIGAFVLLFLGYSGVKSFFDAGLPGDAQTAGLSTFSFILLVFCNYMTGSGGNGGLTSSVNSTAKTFPD
RARATATGFVLGGFGLSAFVFSTLAHVIFAGNTSAFLQILALGTSLPMIIGCFLVRPIPLPLDVSAGPERGIGAL
PGAVTSTSALIDDDSRGPLLARESDWELNGPEEPSYNHVRALSRSSSDAISADELPNRRSHGRTDDDLPNITGMQ
LWKSGDFYLLFTILSILAGTGLMYINNVGTMSQTLYAQNNSQYDEVEAGKWQAMQVSVISIMNFSGRILIGIISD
AAKNRFKIPRSYCLVLVSIGVFLSQVAAARITMTSDLWLASAMLGISYGAVFSIMPQICIEWFGLQHFSENWGYL
SMSPMVAGNLFMLFFGRNLDAHEPRTSLQSPYTARRENLLTPDDIPRCLEGKDCYVAALLEGTPTVDGFG*
Coding >AgabiH97|077730
ATGGCGTCTGCTAAGCCTCCTGGGATTGTGAGTGCTCCCAGAATCACCACACTCATCGCTTCGCTGCTGGTATCT
ACCAGCTCTGGAACTAACTATGCCTTTTCTGCTTGGGCACCTCAGCTTGGGTCTCGATTGCGCATTAATCATACA
AGGCTGAATGTTATCGGATTAGCTGGAAACGTTGGCGTGTACAGTTCTGGACCAATATGGGGGCGCATTGTGGAT
AAGAGGGGACCTCGTATTCCACTGATTGGAGCATTTGTATTGCTCTTTCTTGGATATTCTGGCGTGAAGAGTTTC
TTCGATGCGGGGCTTCCTGGTGACGCTCAGACGGCGGGGCTATCGACTTTCAGTTTCATTCTGTTGGTTTTTTGC
AATTACATGACCGGTTCAGGCGGGAATGGAGGCTTGACGAGTTCCGTAAATTCGACGGCGAAGACGTTCCCAGAC
AGGGCACGCGCTACGGCAACGGGCTTCGTTCTCGGTGGATTCGGATTGTCTGCATTCGTTTTTTCGACCCTGGCC
CATGTCATATTCGCTGGGAATACATCAGCTTTCCTGCAAATTCTGGCGCTGGGAACGTCATTACCTATGATCATC
GGGTGTTTCCTTGTCAGACCCATCCCACTGCCATTGGATGTATCGGCTGGTCCTGAGCGAGGGATTGGTGCTTTG
CCCGGAGCCGTGACCAGCACTTCAGCGTTGATTGATGATGACTCTCGTGGACCATTATTAGCTCGCGAGTCGGAC
TGGGAGTTGAATGGGCCGGAAGAGCCATCTTACAATCATGTTCGCGCGTTGTCTAGATCATCCTCCGACGCAATC
TCGGCAGACGAGCTTCCTAATCGTCGCTCCCACGGACGAACCGACGACGATTTACCCAATATTACTGGAATGCAA
TTATGGAAGAGTGGAGATTTTTATCTGCTTTTCACGATACTCTCTATACTCGCTGGAACGGGCTTGATGTACATC
AATAATGTTGGAACCATGTCTCAAACACTTTATGCGCAAAACAATTCCCAGTACGATGAGGTTGAAGCTGGGAAG
TGGCAAGCTATGCAGGTATCGGTCATCAGTATTATGAACTTTTCGGGTCGCATTCTCATTGGTATTATTTCCGAC
GCCGCAAAAAATAGATTCAAGATTCCACGCTCCTACTGCCTCGTGTTGGTCTCTATTGGTGTATTCCTTTCTCAA
GTCGCCGCAGCACGAATTACTATGACAAGCGATCTATGGTTAGCAAGTGCAATGCTTGGCATCTCCTATGGCGCT
GTATTCTCCATTATGCCTCAAATATGTATTGAGTGGTTCGGTCTACAGCATTTCTCAGAAAACTGGGGATACCTA
TCCATGTCGCCAATGGTCGCCGGCAATTTATTCATGTTGTTTTTCGGCCGCAATTTAGATGCACACGAGCCGAGA
ACTTCACTGCAATCACCTTATACCGCCAGACGGGAAAATTTGTTGACCCCTGACGATATACCGCGGTGTCTGGAA
GGAAAAGACTGTTACGTTGCGGCCCTGCTGGAGGGAACACCAACGGTCGATGGATTTGGTTAG
Transcript >AgabiH97|077730
ATGGCGTCTGCTAAGCCTCCTGGGATTGTGAGTGCTCCCAGAATCACCACACTCATCGCTTCGCTGCTGGTATCT
ACCAGCTCTGGAACTAACTATGCCTTTTCTGCTTGGGCACCTCAGCTTGGGTCTCGATTGCGCATTAATCATACA
AGGCTGAATGTTATCGGATTAGCTGGAAACGTTGGCGTGTACAGTTCTGGACCAATATGGGGGCGCATTGTGGAT
AAGAGGGGACCTCGTATTCCACTGATTGGAGCATTTGTATTGCTCTTTCTTGGATATTCTGGCGTGAAGAGTTTC
TTCGATGCGGGGCTTCCTGGTGACGCTCAGACGGCGGGGCTATCGACTTTCAGTTTCATTCTGTTGGTTTTTTGC
AATTACATGACCGGTTCAGGCGGGAATGGAGGCTTGACGAGTTCCGTAAATTCGACGGCGAAGACGTTCCCAGAC
AGGGCACGCGCTACGGCAACGGGCTTCGTTCTCGGTGGATTCGGATTGTCTGCATTCGTTTTTTCGACCCTGGCC
CATGTCATATTCGCTGGGAATACATCAGCTTTCCTGCAAATTCTGGCGCTGGGAACGTCATTACCTATGATCATC
GGGTGTTTCCTTGTCAGACCCATCCCACTGCCATTGGATGTATCGGCTGGTCCTGAGCGAGGGATTGGTGCTTTG
CCCGGAGCCGTGACCAGCACTTCAGCGTTGATTGATGATGACTCTCGTGGACCATTATTAGCTCGCGAGTCGGAC
TGGGAGTTGAATGGGCCGGAAGAGCCATCTTACAATCATGTTCGCGCGTTGTCTAGATCATCCTCCGACGCAATC
TCGGCAGACGAGCTTCCTAATCGTCGCTCCCACGGACGAACCGACGACGATTTACCCAATATTACTGGAATGCAA
TTATGGAAGAGTGGAGATTTTTATCTGCTTTTCACGATACTCTCTATACTCGCTGGAACGGGCTTGATGTACATC
AATAATGTTGGAACCATGTCTCAAACACTTTATGCGCAAAACAATTCCCAGTACGATGAGGTTGAAGCTGGGAAG
TGGCAAGCTATGCAGGTATCGGTCATCAGTATTATGAACTTTTCGGGTCGCATTCTCATTGGTATTATTTCCGAC
GCCGCAAAAAATAGATTCAAGATTCCACGCTCCTACTGCCTCGTGTTGGTCTCTATTGGTGTATTCCTTTCTCAA
GTCGCCGCAGCACGAATTACTATGACAAGCGATCTATGGTTAGCAAGTGCAATGCTTGGCATCTCCTATGGCGCT
GTATTCTCCATTATGCCTCAAATATGTATTGAGTGGTTCGGTCTACAGCATTTCTCAGAAAACTGGGGATACCTA
TCCATGTCGCCAATGGTCGCCGGCAATTTATTCATGTTGTTTTTCGGCCGCAATTTAGATGCACACGAGCCGAGA
ACTTCACTGCAATCACCTTATACCGCCAGACGGGAAAATTTGTTGACCCCTGACGATATACCGCGGTGTCTGGAA
GGAAAAGACTGTTACGTTGCGGCCCTGCTGGAGGGAACACCAACGGTCGATGGATTTGGTTAG
Gene >AgabiH97|077730
ATGGCGTCTGCTAAGCCTCCTGGGATTGTGAGTGCTCCCAGAATCACCACACTCATCGCTTCGCTGCTGGTATCT
ACCAGCTCTGGAACTAACTATGTGAGTAAGAGCCGCATAGTTCTTCTTGAGGTAACTTACGCGGAAGAAACTTTC
TTTCGTTCTAGGCCTTTTCTGGTGGGTGTCTTACAACCTTGGTTGATTCCTAAAAGCATATTGGGGGGGTGCGGG
ATTCCCCGCGTATCGGAATGCAACGAAAGAATAATGCTGACTGTGTTGGAAACGAAACACAGCTTGGGCACCTCA
GCTTGGGTCTCGATTGCGCATTAATCATACAAGGCTGAATGTTATCGGATTAGCTGGAAACGGTGTGTGTCATTT
CGCTAGGGTCGTGTCAATGTTGGAAATTTATAATTGTGTCTGTTCACTTTTTTTAGTTGGCGTGTACAGTTCTGG
ACCAATATGGGGGCGCATTGTGGATAAGAGGGGACCTCGTATTCCACTGATTGGAGCATTTGTATTGCTCTTTCT
TGGATATTCTGGCGTGAAGAGTTTCTTCGATGCGGGGCTTCCTGGTGACGCTCAGACGGCGGGGCTATCGACTTT
CAGTTTCATTCTGTTGGTTTTTTGCAATTACATGACCGGTTCAGGCGGGAATGGAGGCTTGACGAGTTCCGTAAA
TTCGACGGCGAAGACGTTCCCAGACAGGGCAGTGCGTGATTTTCCCCTTTTTTCGTGGAGAATACTGATTATGAC
TTTCAATAACCTTTGCGGTTGCAGCGCGCTACGGCAACGGGCTTCGTTCTCGGTGGATTCGGATTGTCTGCATTC
GTTTTTTCGACCCTGGCCCATGTCATATTCGCTGGGAATACATCAGCTTTCCTGCAAATTCTGGCGCTGGGAACG
TCATTACCTATGATCATCGGGTGTTTCCTTGTCAGACCCATCCCACTGCCATTGGATGTATCGGCTGGTCCTGAG
CGAGGGATTGGTGCTTTGCCCGGAGCCGTGACCAGCACTTCAGCGTTGATTGATGATGACTCTCGTGGACCATTA
TTAGCTCGCGAGTCGGACTGGGAGTTGAATGGGCCGGAAGAGCCATCTTACAATCATGTTCGCGCGTTGTCTAGA
TCATCCTCCGACGCAATCTCGGCAGACGAGCTTCCTAATCGTCGCTCCCACGGACGAACCGACGACGATTTACCC
AATATTACTGGAATGCAATTATGGAAGAGTGGAGATTTTTATCTGCTTTTCACGATACTCTCTATACGTATGTGC
TTCTGCGCCTTCTTAATCTTGTTTCGTAATATGCTTACTGTCCCCTGTTTCGTGTACGCCCCATTCAAATCAGTC
GCTGGAACGGGCTTGATGTGTGAGTCTCGCTTGACACTCTTTTTTGGAAATGTTTGCCAATATACATCTTTCCTT
TCAAACGTACAGACATCAATAATGTTGGAACCATGTCTCAAACACTTTATGCGCAAAACAATTCCCAGTACGATG
AGGTTGAAGCTGGGAAGTGGCAAGCTATGCAGGTATCGGTCATCAGTATTATGAACTTTTCGGGTCGCATTCTCA
TTGGTGAGTCGCCTGAAATTATTTTCTTGTGCTACAATCTCTTATCTAGCTCTCCTGTGTGGGTTTTGGTTTCCG
CCGCTCTCCGTCGCCATTGATCCAGGTATTATTTCCGACGCCGCAAAAAATAGATTCAAGATTCCACGCTCCTAC
TGCCTCGTGTTGGTCTCTATTGGTGTATTCCTTTCTCAAGTCGCCGCAGCACGAATTACTATGACAAGCGATCTA
TGGTTAGCAAGTGCAATGCTTGGCATCTCCTATGGCGCTGTATTCTCCATTATGCCTCAAATATGTATTGAGTGG
TTCGGTCTACGTGAGTGTTTTGGCATCATATAAGGGGCCTTGTGCATTCTTCGTACTCCATGGTTCACGAGTCCC
ATCATCCATTTTCATGACGTTTTTTTCGATTATTAATAAATCGCTTCCCGTACTAATTTCATATCCACAGAGCAT
TTCTCAGAAAACTGGGGATACCTATCCATGTCGCCAATGGTCGCCGGCAATTTATTCATGTTGTTTTTCGGCCGC
AATTTAGATGCACACGAGCCGAGAACTTCACTGCAATCACCTTATACCGCCAGACGGGAAAATTTGTTGACCCCT
GACGATATACCGCGGTGTCTGGAAGGAAAAGACTGTTACGTTGCGGCCCTGTATCTGACGATGTTCATGACGTTC
ACTTGTATCTTGCTGAGCGTATGGGCAGGCTGGAGGGAACACCAACGGTCGATGGATTTGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail