Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|077280
Gene name
Locationscaffold_4:2824224..2827981
Strand-
Gene length (bp)3757
Transcript length (bp)2448
Coding sequence length (bp)2448
Protein length (aa) 816

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07971 Glyco_hydro_92 Glycosyl hydrolase family 92 2.1E-135 305 791
PF17678 Glyco_hydro_92N Glycosyl hydrolase family 92 N-terminal domain 3.8E-56 46 299

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ATR3|A7629_ARTBC Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07629 PE=1 SV=1 40 812 1.0E-157
sp|O86365|Y584_MYCTU Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0584 PE=3 SV=1 39 812 1.0E-48

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|077280
MGRTFLVLCLIYALKANAQTVPSSSSSVEPPTSTAVAPIADPASLVLPLIGTTNGGHVFPGATLPHGMVKAGMDT
DSPGKHAGYDGDPQFNATGFSQLHDSGTGGAIPLSNFKLWPFAECSSFGKCPTSLNSRKRLRHILPDGSPDDFAS
PGYFSTNLSNSIQVELTATRRTALHRYTFPAGTDHPRILVDITNDGQRSSTDPVMTLDPDTAKVMGGSSFAASFG
PGRYSAFTCVTFKGDGFDLGKPTEYGAWLADFPILGTTNALQLYSGFVDEMGALFTFSPAPSGKTTILARVGVSF
ISSEQACANAEEEIPDFDFEKVHSDARAQWNDLLGRVQVDATGVSKDTVQLFYSSLYRTHISPADYSGENPKWNS
TEPYFDSFYCNWDTYRTLYPLMSLHDPGNFAQIVRGLIDIQKHEGWLPECRGATAMHFIQGGSNADPILGEFFVK
FHEHAAALKVSQEDLYNALLADAEIESPNWNLQGRQAGVWKELGYIPHDTFSPGGANTKQVSRTLEHAFNDFSIA
QVAKALGKTEDQNKYLGRAGNFMNIWNPDVSVPGNPEVKGMMQPRFANGTFNFTDPRHCSIHDPEEATCFLNAAN
RDGFYEGSPIIYSQYVPQDTAKLIELQGGNESFIRRLDFIFEQDYFEATNEPSQQIPYMYHYANKPGFSTQKSRE
IITEFFNTSVNGLPGNDDSGAMGSYVAFYLAGLYPLPATEQILLSSPFFREISYFNPVFNTTTVIRSKNFKGNTE
NGKGGRVFIERVTVNGEPYKSNCYLEWDVFKTGAIVELTLSDDINVSCGDGIDALPPSISTGGYI*
Coding >AgabiH97|077280
ATGGGTCGGACGTTCCTTGTGTTGTGTCTCATATACGCTTTAAAGGCCAATGCTCAAACTGTTCCAAGCTCTAGT
TCAAGTGTTGAACCTCCGACAAGCACTGCGGTCGCTCCCATTGCTGACCCCGCCAGTCTTGTCCTCCCCTTAATC
GGAACAACCAATGGTGGACATGTTTTCCCAGGTGCCACGTTACCTCACGGAATGGTGAAGGCAGGAATGGACACA
GACTCCCCTGGCAAACATGCTGGATATGATGGAGATCCGCAGTTCAACGCAACTGGCTTCTCTCAGTTGCATGAC
AGCGGAACAGGAGGCGCCATTCCTTTGTCGAATTTCAAGCTTTGGCCCTTTGCAGAATGTTCCTCATTTGGGAAA
TGTCCCACCTCGCTAAATAGCCGAAAGCGTTTGCGCCACATCCTTCCGGATGGCTCCCCTGATGATTTCGCGTCG
CCCGGTTACTTTTCTACCAATTTATCGAACTCTATACAGGTCGAACTAACGGCTACGAGGCGGACAGCTTTACAT
CGTTATACATTCCCTGCTGGGACAGATCATCCCAGAATCCTCGTTGACATCACCAATGATGGACAGAGAAGTAGC
ACCGATCCCGTCATGACTCTCGATCCGGACACCGCTAAAGTCATGGGAGGTTCTTCCTTTGCTGCTTCTTTTGGT
CCAGGACGGTACAGTGCATTTACTTGTGTCACATTCAAGGGCGATGGCTTCGACCTCGGTAAACCAACTGAATAT
GGGGCATGGCTAGCCGATTTTCCCATTCTAGGAACGACAAATGCACTCCAACTGTATTCTGGTTTCGTTGATGAA
ATGGGTGCTCTATTCACTTTCTCGCCCGCACCCAGTGGGAAAACAACCATTCTAGCACGCGTCGGCGTTTCATTT
ATATCGAGTGAACAAGCGTGTGCTAATGCTGAAGAAGAAATACCTGACTTCGATTTCGAGAAGGTTCACAGTGAC
GCTCGCGCTCAGTGGAATGATCTTCTGGGTCGCGTACAGGTGGATGCAACGGGAGTCTCGAAGGACACTGTCCAA
CTATTTTATTCTTCTTTGTATCGAACGCATATATCTCCAGCAGATTATAGCGGAGAAAATCCAAAATGGAACTCA
ACTGAGCCTTACTTTGACTCTTTCTACTGCAATTGGGATACTTATCGTACACTCTACCCTCTTATGTCCCTTCAC
GACCCGGGAAATTTTGCTCAGATTGTCCGAGGACTGATTGATATCCAGAAACATGAAGGATGGCTTCCTGAATGT
CGAGGAGCGACAGCGATGCACTTTATTCAGGGTGGCAGCAACGCTGATCCTATTCTGGGCGAATTTTTCGTGAAG
TTTCATGAACATGCAGCGGCGCTCAAAGTGTCCCAGGAGGACTTATACAATGCTTTACTAGCGGACGCGGAAATT
GAATCGCCCAACTGGAATCTGCAAGGTCGGCAGGCTGGAGTCTGGAAGGAACTAGGCTATATCCCACACGACACA
TTTAGCCCAGGAGGTGCGAACACCAAACAAGTATCTCGAACTCTTGAGCACGCCTTCAATGATTTCTCTATTGCA
CAAGTTGCGAAGGCTTTGGGCAAGACTGAGGATCAGAATAAGTATCTCGGTAGAGCCGGTAACTTCATGAACATT
TGGAACCCAGATGTTAGCGTTCCAGGGAATCCAGAGGTGAAGGGCATGATGCAGCCGAGGTTTGCCAATGGCACA
TTCAACTTCACCGATCCTCGTCACTGCAGTATCCATGATCCAGAGGAAGCGACGTGCTTCCTGAATGCCGCTAAT
AGAGATGGGTTTTATGAAGGATCTCCGATCATCTATTCCCAATACGTTCCTCAAGATACAGCAAAATTGATTGAA
CTTCAAGGCGGAAACGAGAGCTTCATTCGTCGATTAGACTTCATTTTCGAGCAAGACTATTTCGAGGCCACCAAT
GAACCATCACAACAGATACCATACATGTATCATTATGCTAATAAGCCTGGCTTTAGTACTCAGAAGTCGAGAGAA
ATCATAACAGAGTTTTTCAACACATCTGTCAACGGCCTTCCTGGGAATGACGATTCTGGTGCGATGGGGAGCTAT
GTTGCTTTCTATCTTGCTGGTCTTTATCCTTTACCAGCAACTGAGCAGATTTTACTCTCTTCTCCATTCTTCCGC
GAGATCTCGTACTTCAATCCTGTCTTCAACACGACAACCGTAATCAGATCCAAAAACTTCAAAGGAAATACAGAG
AACGGGAAAGGTGGTCGCGTTTTTATTGAGCGTGTTACGGTCAATGGCGAACCATACAAATCCAATTGTTATTTG
GAGTGGGACGTTTTCAAAACAGGTGCTATCGTTGAGCTTACTCTTAGTGATGATATCAACGTTTCTTGTGGAGAC
GGGATAGATGCTCTCCCACCTTCGATCTCGACGGGAGGTTACATCTAG
Transcript >AgabiH97|077280
ATGGGTCGGACGTTCCTTGTGTTGTGTCTCATATACGCTTTAAAGGCCAATGCTCAAACTGTTCCAAGCTCTAGT
TCAAGTGTTGAACCTCCGACAAGCACTGCGGTCGCTCCCATTGCTGACCCCGCCAGTCTTGTCCTCCCCTTAATC
GGAACAACCAATGGTGGACATGTTTTCCCAGGTGCCACGTTACCTCACGGAATGGTGAAGGCAGGAATGGACACA
GACTCCCCTGGCAAACATGCTGGATATGATGGAGATCCGCAGTTCAACGCAACTGGCTTCTCTCAGTTGCATGAC
AGCGGAACAGGAGGCGCCATTCCTTTGTCGAATTTCAAGCTTTGGCCCTTTGCAGAATGTTCCTCATTTGGGAAA
TGTCCCACCTCGCTAAATAGCCGAAAGCGTTTGCGCCACATCCTTCCGGATGGCTCCCCTGATGATTTCGCGTCG
CCCGGTTACTTTTCTACCAATTTATCGAACTCTATACAGGTCGAACTAACGGCTACGAGGCGGACAGCTTTACAT
CGTTATACATTCCCTGCTGGGACAGATCATCCCAGAATCCTCGTTGACATCACCAATGATGGACAGAGAAGTAGC
ACCGATCCCGTCATGACTCTCGATCCGGACACCGCTAAAGTCATGGGAGGTTCTTCCTTTGCTGCTTCTTTTGGT
CCAGGACGGTACAGTGCATTTACTTGTGTCACATTCAAGGGCGATGGCTTCGACCTCGGTAAACCAACTGAATAT
GGGGCATGGCTAGCCGATTTTCCCATTCTAGGAACGACAAATGCACTCCAACTGTATTCTGGTTTCGTTGATGAA
ATGGGTGCTCTATTCACTTTCTCGCCCGCACCCAGTGGGAAAACAACCATTCTAGCACGCGTCGGCGTTTCATTT
ATATCGAGTGAACAAGCGTGTGCTAATGCTGAAGAAGAAATACCTGACTTCGATTTCGAGAAGGTTCACAGTGAC
GCTCGCGCTCAGTGGAATGATCTTCTGGGTCGCGTACAGGTGGATGCAACGGGAGTCTCGAAGGACACTGTCCAA
CTATTTTATTCTTCTTTGTATCGAACGCATATATCTCCAGCAGATTATAGCGGAGAAAATCCAAAATGGAACTCA
ACTGAGCCTTACTTTGACTCTTTCTACTGCAATTGGGATACTTATCGTACACTCTACCCTCTTATGTCCCTTCAC
GACCCGGGAAATTTTGCTCAGATTGTCCGAGGACTGATTGATATCCAGAAACATGAAGGATGGCTTCCTGAATGT
CGAGGAGCGACAGCGATGCACTTTATTCAGGGTGGCAGCAACGCTGATCCTATTCTGGGCGAATTTTTCGTGAAG
TTTCATGAACATGCAGCGGCGCTCAAAGTGTCCCAGGAGGACTTATACAATGCTTTACTAGCGGACGCGGAAATT
GAATCGCCCAACTGGAATCTGCAAGGTCGGCAGGCTGGAGTCTGGAAGGAACTAGGCTATATCCCACACGACACA
TTTAGCCCAGGAGGTGCGAACACCAAACAAGTATCTCGAACTCTTGAGCACGCCTTCAATGATTTCTCTATTGCA
CAAGTTGCGAAGGCTTTGGGCAAGACTGAGGATCAGAATAAGTATCTCGGTAGAGCCGGTAACTTCATGAACATT
TGGAACCCAGATGTTAGCGTTCCAGGGAATCCAGAGGTGAAGGGCATGATGCAGCCGAGGTTTGCCAATGGCACA
TTCAACTTCACCGATCCTCGTCACTGCAGTATCCATGATCCAGAGGAAGCGACGTGCTTCCTGAATGCCGCTAAT
AGAGATGGGTTTTATGAAGGATCTCCGATCATCTATTCCCAATACGTTCCTCAAGATACAGCAAAATTGATTGAA
CTTCAAGGCGGAAACGAGAGCTTCATTCGTCGATTAGACTTCATTTTCGAGCAAGACTATTTCGAGGCCACCAAT
GAACCATCACAACAGATACCATACATGTATCATTATGCTAATAAGCCTGGCTTTAGTACTCAGAAGTCGAGAGAA
ATCATAACAGAGTTTTTCAACACATCTGTCAACGGCCTTCCTGGGAATGACGATTCTGGTGCGATGGGGAGCTAT
GTTGCTTTCTATCTTGCTGGTCTTTATCCTTTACCAGCAACTGAGCAGATTTTACTCTCTTCTCCATTCTTCCGC
GAGATCTCGTACTTCAATCCTGTCTTCAACACGACAACCGTAATCAGATCCAAAAACTTCAAAGGAAATACAGAG
AACGGGAAAGGTGGTCGCGTTTTTATTGAGCGTGTTACGGTCAATGGCGAACCATACAAATCCAATTGTTATTTG
GAGTGGGACGTTTTCAAAACAGGTGCTATCGTTGAGCTTACTCTTAGTGATGATATCAACGTTTCTTGTGGAGAC
GGGATAGATGCTCTCCCACCTTCGATCTCGACGGGAGGTTACATCTAG
Gene >AgabiH97|077280
ATGGGTCGGACGTTCCTTGTGTTGTGTCTCATATACGCTTTAAAGGCCAATGCTCAAACTGTTCCAAGCTCTAGT
TCAAGGTTTGAAATCATCATGCTTTCCGTTACCGTCATCCCTTAGTGTTGTTAGTGTTGAACCTCCGACAAGCAC
TGCGGTCGCTCCCATTGCTGACCCCGCCAGTCTTGTCCTCCCCTTAATCGGAACAACCAATGGTGGACATGTTTT
CCCAGGTATTTTCCTTCTTTCAATCGGTGATGTGTCCAGGTTAAATTCTCGTAGGTGCCACGTTACCTCACGGAA
TGGTGAAGGCAGGAATGGACACAGACTCCCCTGGCAAAGTAGTATCTTCCATATCTTGCACATGTTTACCTCTAA
CATTGTTTTATACCTAGCATGCTGGATATGATGGAGATCCGCAGTTCAACGCAACTGGCTTCTCTCAGTTGCATG
ACAGCGGAACAGGAGGCGTGCGTCAACTCTGCTACTGGAGTTATGGAAGCGTGATTTGACGCATTTCTAGGCCAT
TCCTTTGTCGAATTTCAAGCTTTGGCCCTTTGCAGAATGTTCCTCATTTGGGAAATGTCCCACCTCGCTAAATAG
CCGAAAGCGTTTGCGCCACATCCTTCCGGATGGTAGATTTTTATTTTGCAGACGCTTTAAAGAATATTTAACGAG
TCAATAGGCTCCCCTGATGATTTCGCGTCGCCCGGTTACTTTTCTACCAATTTAGTGCGTGCCAGTAGGAAGATC
ATTCACTTATTTTCTGTTGTAAGCTTGTGCTAAACCAAATGCAGTCGAACTCTATACAGGTCGAACTAACGGCTA
CGAGGCGGACAGCTTTACATCGTTATACATTCCCTGCTGGGACAGATCATCCCAGAATCCTCGTTGACATCACCA
ATGATGGACAGAGAAGTAGCACCGATCCCGTCATGACTCTCGATCCGGACACCGCTAAAGTCATGGGAGGTTCTT
CCTTTGCTGCTTCTTTTGGTCCAGGTGAGCATTGAATGCAGACACAAATTTTAAGTAGCTGAGACAGTGACAGGA
CGGTACAGTGCATTTACTTGTGTCACATTCAAGGGCGATGGCTTCGACCTCGGTAAACCAACTGAATATGGGGCA
TGGCTAGCCGATTTTCCCATTCTAGGAACGACAAATGCACTCCAACTGTATTCTGGTATGAGGGGATTTAATAAT
GCCATCGAATCAATGAATAGTGCTGCGACAGGTTTCGTTGATGAAATGGGTGCTCTATTCACTTTCTCGCCCGCA
CCCAGTGGGAAAACAACCATTCTAGCACGCGTCGGCGTTTCATTTATATCGAGTGAACAAGCGTGTGCTAATGCT
GAAGAAGAAATACCTGACTTCGATTTCGAGAAGGTTCACAGTGACGCTCGCGCTCAGTGGAATGATCTTCTGGGT
CGCGTACAGGTGGATGCAACGGGAGTCTCGAAGGACACTGTCCAACTATTTTATTCTTCTGTACGTTCTGAAAAT
CATTTGAAAGCGGTCAAGATTCACACCAGCTTGATAGTTGTATCGAACGCATATATCTCCAGCAGATTGTAAGGC
ACCATTTCCTGCAAATGCGCGGTAGAACTAAACATCCTACAGATAGCGGAGAAAATCCAAAATGGAACTCAACTG
AGCCTTACTTTGACTCTTTCTACTGCAATGTATGTTGTTCCCATCCAATAATCTAGGTATAGGCCTTAATTCTTT
TGCAGTGGGATACTTATCGTACACTCTACCCTCTTATGTCCCTTCACGACCCGGGAAATTTTGCTCAGATTGTCC
GAGGACTGATTGATATCCAGAAACATGAAGGTATGTGATGTTCTATGATTCTTTTGAAGAAGATTCCCACATGAG
ATTCCAAATAGGATGGCTTCCTGAATGTCGAGGAGCGACAGCGATGCACTTTATTCAGGGTGGCAGCAGTATGTC
GTTTGTATCATTTTATGAAACAAACCTTAATAAATATAATCGCAGACGCTGATCCTATTCTGGGCGAATTTTTCG
TGAAGTAGGTCGAGGTAATATCATTTTGGATGGTTACTAACGTGTTATAGGTTTCATGAACATGCAGCGGCGCTC
AAAGTGTCCCAGGAGGACTTATACAATGCTTTACTAGCGGACGCGGAAATTGAATCGCCCAACTGGAATCTGCAA
GGTCGGCAGGCTGGAGTCTGGAAGGAACTAGGTGGGTGGTTGCCTCTTAAGCCACCATCAACAATGATGCGACTG
ATTTCATCTAGGCTATATCCCACACGACACATTTAGCCCAGGAGGTGCGAACACCAAACAAGTATCTCGAACTCT
TGAGGTAAGCATTGACTTGTTACTAAGGGACGATCATTAAGGTATTCTGGTTATAGCACGCCTTCAATGATTTCT
CTATTGCACAAGTTGCGAAGGCTTTGGGCAAGACTGAGGATCAGAATAAGGTCTATATTTGAACGTCTTAACTTG
ATTAGCGTGATACTGATGTCTATATCTAGTATCTCGGTAGAGCCGGTAACTTCATGAACATTTGGAACCCAGATG
TTAGCGTTCCAGGGAATCCAGAGGTGAAGGGCATGATGCAGGTTAGCCACTTTCTAGTCTCATCTGTGTCATAAC
TTGAGATGGTTAGCCGAGGTTTGCCAATGGCACATTCAACTTCACCGATCCTCGTCACTGCAGTATCCATGATCC
AGAGGAAGCGACGTGCTTCCTGAATGCCGCTAATAGAGATGGGTTTTATGAAGGTAAGTCAAATATTCCACGGGA
CTTCAAGATACACTAATGCAGTATTAAGGATCTCCGATCATCGTAAGTGAACATTGATCTTTCGTTGTGATTTGA
CATGCGTGATAAATGATTAGTATTCCCAAGTAAGATTTCTGTGGTGTCCATCTTACACTACTAACACATTCGCTT
TAAGTACGTTCCTCAAGATACAGCAAAATTGATTGAACTTCAAGGCGGAAACGAGAGCTTCATTCGTCGATTAGA
CTTCATTTTCGAGCAAGTGAGTTACTTACGAAATTACAACCGAATCCTTCTCGCTGACCCTAAATTAGGACTATT
TCGAGGCCACCAATGAACCATCACAACAGATACCATACATGTATCATTATGCTAATAAGCCTGGCTTTAGTACTC
AGAAGTCGAGAGAAATCATAACAGAGTTTTTCAACACATCTGTCAACGGCCTTCCTGGGAATGACGGTCAGTTTT
AACTGCTGTCCTCCCTCGTTCTGTTTACCCTAACATATTCACAGATTCTGGTGCTCAAACTTATCTTCTTCCTCG
TCGTAAAGCACTAATTTTGACTCGATCCTAGGTGCGATGGGGAGCTATGTTGCTTTCTATCTTGCTGGTCTTTAT
CCTTTACCAGCAACTGAGCAGATTTTACTCTCTTCTCCATTCTTCCGCGAGATCTCGTACTTCAATCCTGTCTTC
AACACGACAACCGTAATCAGATCCAAAAACTTCAAAGGAAATACAGAGAACGGGAAAGGTGGTCGCGTTTTTATT
GAGGTAATGCAACTATTTTCATTCTCGTTTCTTCACAACGATTCCTTATGCTGGATGTTATTAGCGTGTTACGGT
CAATGGCGAACCATACAAATCCAATTGTTATTTGGAGTGGGACGTTTTCAAAACAGGTGCTATCGTTGAGCTTAC
TCTTAGTGATGATATCAACGTTTCTTGTGGAGACGGGATAGATGCTCTCCCACCTTCGATCTCGACGGGAGGTTA
CATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail