Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|077050
Gene name
Locationscaffold_4:2775007..2775809
Strand+
Gene length (bp)802
Transcript length (bp)681
Coding sequence length (bp)681
Protein length (aa) 227

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04622 ERG2_Sigma1R ERG2 and Sigma1 receptor like protein 2.2E-97 19 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33281|ERG2_MAGO7 C-8 sterol isomerase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG2 PE=3 SV=1 8 226 1.0E-84
sp|Q92254|ERG2_NEUCR C-8 sterol isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-1 PE=3 SV=2 14 226 2.0E-80
sp|P32360|ERG2_USTMA C-8 sterol isomerase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG2 PE=3 SV=1 10 226 2.0E-78
sp|P32352|ERG2_YEAST C-8 sterol isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG2 PE=1 SV=1 25 225 1.0E-60
sp|P87113|ERG2_SCHPO C-8 sterol isomerase erg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg2 PE=3 SV=1 38 226 6.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33281|ERG2_MAGO7 C-8 sterol isomerase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG2 PE=3 SV=1 8 226 1.0E-84
sp|Q92254|ERG2_NEUCR C-8 sterol isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-1 PE=3 SV=2 14 226 2.0E-80
sp|P32360|ERG2_USTMA C-8 sterol isomerase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG2 PE=3 SV=1 10 226 2.0E-78
sp|P32352|ERG2_YEAST C-8 sterol isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG2 PE=1 SV=1 25 225 1.0E-60
sp|P87113|ERG2_SCHPO C-8 sterol isomerase erg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg2 PE=3 SV=1 38 226 6.0E-54
sp|Q55BU8|ERG2_DICDI Protein erg2 homolog OS=Dictyostelium discoideum GN=erg2 PE=3 SV=1 77 225 8.0E-29
sp|Q66IM1|SGMR1_XENTR Sigma non-opioid intracellular receptor 1 OS=Xenopus tropicalis GN=sigmar1 PE=2 SV=1 20 221 2.0E-28
sp|Q6DCU6|SGMR1_XENLA Sigma non-opioid intracellular receptor 1 OS=Xenopus laevis GN=sigmar1 PE=2 SV=1 20 218 3.0E-28
sp|Q7ZWG9|SGMR1_DANRE Sigma non-opioid intracellular receptor 1 OS=Danio rerio GN=sigmar1 PE=2 SV=1 34 218 2.0E-27
sp|Q645J3|SGMR1_TARGR Sigma non-opioid intracellular receptor 1 OS=Taricha granulosa GN=SIGMAR1 PE=2 SV=1 20 221 2.0E-26
sp|Q5ZL84|SGMR1_CHICK Sigma non-opioid intracellular receptor 1 OS=Gallus gallus GN=SIGMAR1 PE=2 SV=1 29 218 3.0E-25
sp|O55242|SGMR1_MOUSE Sigma non-opioid intracellular receptor 1 OS=Mus musculus GN=Sigmar1 PE=1 SV=1 39 215 1.0E-24
sp|Q5PXE3|SGMR1_MUSER Sigma non-opioid intracellular receptor 1 OS=Mustela erminea GN=SIGMAR1 PE=2 SV=1 30 215 1.0E-24
sp|Q99720|SGMR1_HUMAN Sigma non-opioid intracellular receptor 1 OS=Homo sapiens GN=SIGMAR1 PE=1 SV=1 30 215 1.0E-24
sp|Q5PXE2|SGMR1_TRIVU Sigma non-opioid intracellular receptor 1 OS=Trichosurus vulpecula GN=SIGMAR1 PE=2 SV=1 16 215 1.0E-24
sp|Q9R0C9|SGMR1_RAT Sigma non-opioid intracellular receptor 1 OS=Rattus norvegicus GN=Sigmar1 PE=1 SV=1 16 215 2.0E-24
sp|Q60492|SGMR1_CAVPO Sigma non-opioid intracellular receptor 1 OS=Cavia porcellus GN=SIGMAR1 PE=1 SV=1 16 217 2.0E-24
sp|Q58DH7|SGMR1_BOVIN Sigma non-opioid intracellular receptor 1 OS=Bos taurus GN=SIGMAR1 PE=2 SV=1 30 215 4.0E-24
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|077050
MYGTKQENPPLIKWTRRMALVLVFVLFCGWLDTIKDRWYVFNPDSLHQLAQEAIAVAGHNNTQGMIDHIVSTLST
THAPWINTNKAEWVFNNAGGAMGAMYIIHASITEYLIIFGTPLGTEGHTGLHSADDYFNILVGEQWAFKPGSLEM
EKYPAGSVHHLPRGTAKQYKMHEGCFALEYARGWIPLMLPFGFADTLSSTLDIPTLYHTVRVTAREMIGNTLIGK
I*
Coding >AgabiH97|077050
ATGTATGGGACTAAGCAAGAGAATCCTCCTCTGATCAAGTGGACGAGGAGAATGGCTTTGGTCCTCGTCTTCGTA
CTATTCTGTGGATGGCTAGATACCATCAAAGATCGGTGGTATGTTTTTAACCCCGATTCCCTTCACCAACTCGCC
CAAGAGGCAATCGCCGTCGCCGGCCATAACAATACTCAAGGAATGATCGACCACATCGTTTCCACCCTCTCAACT
ACCCATGCACCATGGATCAACACCAACAAAGCCGAATGGGTATTCAACAATGCCGGCGGTGCCATGGGTGCCATG
TATATCATCCACGCCAGCATCACAGAGTATTTAATCATTTTCGGAACACCACTGGGTACTGAAGGACATACTGGA
CTCCATTCCGCTGATGACTATTTCAACATTCTCGTTGGTGAACAATGGGCTTTCAAGCCTGGAAGCTTGGAGATG
GAAAAATATCCTGCTGGAAGCGTGCATCACTTGCCCAGAGGGACGGCAAAACAGTATAAAATGCATGAAGGATGC
TTTGCTTTGGAATATGCTAGAGGCTGGATTCCATTGATGCTGCCTTTCGGTTTTGCGGATACTTTGTCTTCGACG
TTGGACATTCCAACATTATATCACACCGTCCGTGTAACGGCCAGGGAGATGATTGGAAACACGCTCATCGGGAAG
ATTTAA
Transcript >AgabiH97|077050
ATGTATGGGACTAAGCAAGAGAATCCTCCTCTGATCAAGTGGACGAGGAGAATGGCTTTGGTCCTCGTCTTCGTA
CTATTCTGTGGATGGCTAGATACCATCAAAGATCGGTGGTATGTTTTTAACCCCGATTCCCTTCACCAACTCGCC
CAAGAGGCAATCGCCGTCGCCGGCCATAACAATACTCAAGGAATGATCGACCACATCGTTTCCACCCTCTCAACT
ACCCATGCACCATGGATCAACACCAACAAAGCCGAATGGGTATTCAACAATGCCGGCGGTGCCATGGGTGCCATG
TATATCATCCACGCCAGCATCACAGAGTATTTAATCATTTTCGGAACACCACTGGGTACTGAAGGACATACTGGA
CTCCATTCCGCTGATGACTATTTCAACATTCTCGTTGGTGAACAATGGGCTTTCAAGCCTGGAAGCTTGGAGATG
GAAAAATATCCTGCTGGAAGCGTGCATCACTTGCCCAGAGGGACGGCAAAACAGTATAAAATGCATGAAGGATGC
TTTGCTTTGGAATATGCTAGAGGCTGGATTCCATTGATGCTGCCTTTCGGTTTTGCGGATACTTTGTCTTCGACG
TTGGACATTCCAACATTATATCACACCGTCCGTGTAACGGCCAGGGAGATGATTGGAAACACGCTCATCGGGAAG
ATTTAA
Gene >AgabiH97|077050
ATGTATGGGACTAAGCAAGAGAATCCTCCTCTGATCAAGTGGACGAGGAGAATGGCTTTGGTCCTCGTCTTCGTA
CTATTCTGTGGATGGCTAGATACCATCAAAGTGGGTTTTACTTTTCATAGCTCTAACTAAAATAAGTTACTGACT
ACTTATATAGGATCGGTGGTATGTTTTTAACCCCGATTCCCTTCACCAACTCGCCCAAGAGGCAATCGCCGTCGC
CGGCCATAACAATACTCAAGGAATGATCGACCACATCGTTTCCACCCTCTCAACTACCCATGCACCATGGATCAA
CACCAACAAAGCCGAATGGGTATTCAACAATGCCGGCGGTGCCATGGGTGCCATGTATATCATCCACGCCAGCAT
CACAGAGTATTTAATCATTTTCGGAACACCACTGGGTACTGAAGGACATACTGGACTCCATTCCGCTGATGACTA
TTTCAACATTCTCGTTGGTGAACAATGGGCTTTCAAGCCTGGAAGCTTGGAGATGGAAAAATATCCTGCTGGAAG
CGTGCATCACTTGCCCAGAGGGACGGCAAAACAGTATAAAATGCATGAAGGATGCTTTGCTTTGGAATATGCTAG
AGGTATGTAACCTAACAAACTTACGAAGCAAGATTGACTCAGTTTCTTTTTTTCCTCTTTTTTGATAGGCTGGAT
TCCATTGATGCTGCCTTTCGGTTTTGCGGATACTTTGTCTTCGACGTTGGACATTCCAACATTATATCACACCGT
CCGTGTAACGGCCAGGGAGATGATTGGAAACACGCTCATCGGGAAGATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail