Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|077040
Gene name
Locationscaffold_4:2772392..2774543
Strand+
Gene length (bp)2151
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12999 PRKCSH-like Glucosidase II beta subunit-like 1.1E-45 8 174
PF13015 PRKCSH_1 Glucosidase II beta subunit-like protein 1.6E-22 392 533
PF07915 PRKCSH Glucosidase II beta subunit-like protein 1.1E-07 426 489

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT24|GLU2B_USTMA Glucosidase 2 subunit beta OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_12045 PE=3 SV=1 30 532 2.0E-100
sp|Q9USH8|GLU2B_SCHPO Glucosidase 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtb1 PE=1 SV=1 8 532 1.0E-41
sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 40 187 2.0E-25
sp|Q9FM96|PSL4_ARATH Glucosidase 2 subunit beta OS=Arabidopsis thaliana GN=PSL4 PE=2 SV=1 20 187 5.0E-25
sp|A2WNF5|GLU2B_ORYSI Glucosidase 2 subunit beta OS=Oryza sativa subsp. indica GN=OsI_01383 PE=3 SV=1 22 154 5.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT24|GLU2B_USTMA Glucosidase 2 subunit beta OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_12045 PE=3 SV=1 30 532 2.0E-100
sp|Q9USH8|GLU2B_SCHPO Glucosidase 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtb1 PE=1 SV=1 8 532 1.0E-41
sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 40 187 2.0E-25
sp|Q9FM96|PSL4_ARATH Glucosidase 2 subunit beta OS=Arabidopsis thaliana GN=PSL4 PE=2 SV=1 20 187 5.0E-25
sp|A2WNF5|GLU2B_ORYSI Glucosidase 2 subunit beta OS=Oryza sativa subsp. indica GN=OsI_01383 PE=3 SV=1 22 154 5.0E-24
sp|Q5NBP9|GLU2B_ORYSJ Glucosidase 2 subunit beta OS=Oryza sativa subsp. japonica GN=Os01g0276800 PE=2 SV=1 22 154 5.0E-24
sp|O08795|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus GN=Prkcsh PE=1 SV=1 40 237 3.0E-23
sp|Q28034|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1 40 181 2.0E-22
sp|Q28034|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1 377 520 3.0E-16
sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 377 520 6.0E-16
sp|A2WNF5|GLU2B_ORYSI Glucosidase 2 subunit beta OS=Oryza sativa subsp. indica GN=OsI_01383 PE=3 SV=1 375 530 6.0E-15
sp|Q5NBP9|GLU2B_ORYSJ Glucosidase 2 subunit beta OS=Oryza sativa subsp. japonica GN=Os01g0276800 PE=2 SV=1 375 530 6.0E-15
sp|Q04924|GLU2B_YEAST Glucosidase 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTB1 PE=1 SV=1 1 259 6.0E-15
sp|Q9FM96|PSL4_ARATH Glucosidase 2 subunit beta OS=Arabidopsis thaliana GN=PSL4 PE=2 SV=1 356 531 7.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|077040
MLAYFLLLLPLSTQVAGALDKTFGVAPDLVSKYVPTNGKWKCLDGSKEIPWELVNDDSCDCADGSDEPGTGACPD
TFFYCHNKGHIGASIPSSRVRDGICEPQCCDGSDERPGVCKNVCEEVGEAHQKKNAAEMKLRKTGSKIRSTYIAF
AHKEKKRLEERTAALEKEIQAKEIEVQQLKNTAERTESFDAAVLEHKKQSPLYLNVIDHHNALEYLQSEVERYRK
AEKKLGEILDTLRRGYNPNYQDMAVLEAVRGWEKHADLPHINDVGKEGEAAEEEKKEKPPAATTIDGEVWTEEML
QKELKALIKTDFDSLLVEDDEYHRSNEVQEENQFDVTSYLPDFAVGYYDQLKDGLVSLFGSAPEASTKGSTKGSA
KATKAREAFNKADEELRQLQTDKQQSEREAAKIFDVKHFGAEGAWKKLDNTCIEYDDGDYIYETCFFKESKQKPK
GSGITQSLGNFESWNPSPDVEPGTPEYYSKQVYKHGSRCWNGPERNVIFILTCGTENTITSVQELEKCEYQFTGT
TPALCLPVTESNTNNKSRQEL*
Coding >AgabiH97|077040
ATGTTGGCGTATTTTCTCTTGCTTCTTCCTCTTTCCACACAAGTTGCCGGCGCTTTGGACAAAACCTTTGGTGTC
GCACCGGACCTGGTATCTAAATATGTACCAACGAATGGGAAATGGAAGTGTCTGGATGGGTCAAAGGAAATTCCT
TGGGAACTCGTGAACGACGATTCCTGTGACTGCGCAGATGGGAGTGATGAGCCTGGAACTGGCGCATGTCCTGAT
ACGTTTTTCTATTGTCACAACAAGGGACACATAGGAGCCTCCATTCCCAGCTCCAGAGTACGCGATGGAATTTGT
GAGCCACAATGCTGTGATGGTTCAGATGAGCGTCCCGGAGTTTGTAAGAATGTGTGCGAGGAGGTTGGTGAAGCG
CACCAGAAGAAGAATGCGGCTGAGATGAAACTTCGGAAGACGGGGTCTAAAATTCGTTCAACTTATATTGCCTTC
GCACACAAAGAGAAGAAGCGCTTAGAGGAGCGAACCGCAGCCCTCGAGAAGGAAATACAGGCCAAGGAAATAGAG
GTTCAACAATTGAAAAATACTGCTGAACGTACGGAATCTTTTGACGCTGCTGTTCTCGAACACAAGAAACAATCT
CCGCTTTACTTAAACGTCATCGATCATCACAACGCGCTTGAGTATCTCCAGAGCGAGGTTGAAAGGTATCGTAAA
GCTGAAAAGAAACTTGGAGAAATTCTCGACACTCTCAGACGTGGTTACAACCCGAACTATCAAGACATGGCCGTC
CTAGAGGCAGTTCGTGGTTGGGAGAAACATGCTGATCTTCCCCACATTAACGACGTTGGCAAAGAGGGTGAAGCA
GCTGAGGAAGAGAAGAAAGAAAAACCGCCTGCTGCAACGACGATCGATGGAGAAGTGTGGACTGAGGAGATGCTG
CAAAAGGAGTTGAAGGCGTTAATAAAAACTGATTTTGACTCGTTGCTAGTGGAAGACGACGAGTACCATCGCTCG
AATGAAGTACAAGAAGAGAATCAGTTCGATGTTACATCATACCTTCCCGATTTTGCGGTTGGCTACTATGATCAG
CTCAAAGACGGTCTTGTCTCGTTGTTCGGCAGTGCACCGGAAGCCTCCACAAAGGGTTCCACAAAGGGCTCAGCC
AAGGCAACCAAGGCCCGTGAAGCGTTCAACAAGGCTGACGAGGAGCTACGTCAACTCCAAACAGACAAGCAACAG
AGCGAACGGGAGGCTGCTAAAATCTTCGACGTAAAGCACTTCGGTGCCGAGGGCGCATGGAAGAAACTTGATAAT
ACCTGTATTGAATACGATGACGGAGACTACATCTACGAAACCTGTTTCTTCAAGGAATCCAAGCAAAAACCAAAG
GGCTCAGGAATCACTCAAAGTCTTGGTAACTTTGAATCGTGGAATCCATCACCGGATGTTGAACCCGGAACGCCC
GAATATTACTCGAAACAGGTATACAAGCATGGTTCGAGATGTTGGAACGGTCCAGAACGCAATGTTATCTTCATT
CTGACTTGTGGGACTGAGAATACTATTACATCGGTGCAGGAACTCGAAAAGTGTGAATATCAGTTCACTGGGACA
ACACCAGCACTTTGTTTACCAGTGACGGAGTCTAATACCAATAATAAGTCGAGGCAAGAGCTTTAG
Transcript >AgabiH97|077040
ATGTTGGCGTATTTTCTCTTGCTTCTTCCTCTTTCCACACAAGTTGCCGGCGCTTTGGACAAAACCTTTGGTGTC
GCACCGGACCTGGTATCTAAATATGTACCAACGAATGGGAAATGGAAGTGTCTGGATGGGTCAAAGGAAATTCCT
TGGGAACTCGTGAACGACGATTCCTGTGACTGCGCAGATGGGAGTGATGAGCCTGGAACTGGCGCATGTCCTGAT
ACGTTTTTCTATTGTCACAACAAGGGACACATAGGAGCCTCCATTCCCAGCTCCAGAGTACGCGATGGAATTTGT
GAGCCACAATGCTGTGATGGTTCAGATGAGCGTCCCGGAGTTTGTAAGAATGTGTGCGAGGAGGTTGGTGAAGCG
CACCAGAAGAAGAATGCGGCTGAGATGAAACTTCGGAAGACGGGGTCTAAAATTCGTTCAACTTATATTGCCTTC
GCACACAAAGAGAAGAAGCGCTTAGAGGAGCGAACCGCAGCCCTCGAGAAGGAAATACAGGCCAAGGAAATAGAG
GTTCAACAATTGAAAAATACTGCTGAACGTACGGAATCTTTTGACGCTGCTGTTCTCGAACACAAGAAACAATCT
CCGCTTTACTTAAACGTCATCGATCATCACAACGCGCTTGAGTATCTCCAGAGCGAGGTTGAAAGGTATCGTAAA
GCTGAAAAGAAACTTGGAGAAATTCTCGACACTCTCAGACGTGGTTACAACCCGAACTATCAAGACATGGCCGTC
CTAGAGGCAGTTCGTGGTTGGGAGAAACATGCTGATCTTCCCCACATTAACGACGTTGGCAAAGAGGGTGAAGCA
GCTGAGGAAGAGAAGAAAGAAAAACCGCCTGCTGCAACGACGATCGATGGAGAAGTGTGGACTGAGGAGATGCTG
CAAAAGGAGTTGAAGGCGTTAATAAAAACTGATTTTGACTCGTTGCTAGTGGAAGACGACGAGTACCATCGCTCG
AATGAAGTACAAGAAGAGAATCAGTTCGATGTTACATCATACCTTCCCGATTTTGCGGTTGGCTACTATGATCAG
CTCAAAGACGGTCTTGTCTCGTTGTTCGGCAGTGCACCGGAAGCCTCCACAAAGGGTTCCACAAAGGGCTCAGCC
AAGGCAACCAAGGCCCGTGAAGCGTTCAACAAGGCTGACGAGGAGCTACGTCAACTCCAAACAGACAAGCAACAG
AGCGAACGGGAGGCTGCTAAAATCTTCGACGTAAAGCACTTCGGTGCCGAGGGCGCATGGAAGAAACTTGATAAT
ACCTGTATTGAATACGATGACGGAGACTACATCTACGAAACCTGTTTCTTCAAGGAATCCAAGCAAAAACCAAAG
GGCTCAGGAATCACTCAAAGTCTTGGTAACTTTGAATCGTGGAATCCATCACCGGATGTTGAACCCGGAACGCCC
GAATATTACTCGAAACAGGTATACAAGCATGGTTCGAGATGTTGGAACGGTCCAGAACGCAATGTTATCTTCATT
CTGACTTGTGGGACTGAGAATACTATTACATCGGTGCAGGAACTCGAAAAGTGTGAATATCAGTTCACTGGGACA
ACACCAGCACTTTGTTTACCAGTGACGGAGTCTAATACCAATAATAAGTCGAGGCAAGAGCTTTAG
Gene >AgabiH97|077040
ATGTTGGCGTATTTTCTCTTGCTTCTTCCTCTTTCCACACAAGTTGCCGGCGCTTTGGACAAAACCTTTGGTGTC
GCACCGGACCTGGTATCTAAATATGTACCAACGAATGGGAAATGGAAGTGTCTGGATGGGTCAAAGGAAATTCCT
TGGGAACTCGTGAACGACGATTCCTGTGACTGCGCAGATGGGAGTGATGAGCCTGGTATGTCTACAACAGTTCAT
GCATTCATCTTGTTGAATGATATATCCTTCAGGAACTGGCGCATGTCCTGATACGTTTTTCTATTGTCACAACAA
GGGACACATAGGAGCCTCCATTCCCAGCTCCAGAGTACGCGATGGAATTTGTGGTATGCCCGTTTCATTCATCAC
TATGCTTCGAATCTGTAACTCACACGACCCCTTAAGAGCCACAATGCTGTGATGGTTCAGATGAGCGTCCCGGAG
TTTGTAAGAATGTGTGCGAGGAGGTTGGTGAAGCGCACCAGAAGAAGAATGCGGCTGAGATGAAACTTCGGAAGA
CGGTAAGCTCTTAATCATTTTTGCTGTATCGTCAGCTTAGCTGCTCCAGGGGTCTAAAATTCGTTCAACTTATAT
TGCCTTCGCACACAAAGAGAAGAAGCGCTTAGAGGAGCGAACCGCAGCCCTCGAGAAGGAAATACAGGCCAAGGA
AATAGAGGTTCAACAATTGAAAAGTACGCAAAATATCAACATGCCGAAACGGAACACTGCCTGACTTTTTGCAGA
TACTGCTGAACGTACGGAATCTTTTGACGCTGCTGTTCTCGAACACAAGAAACAATCTCGTGAGTATCTTGATTC
GGACACGCTCTGCTTAGGATATTGAAGATGATTTATTTAGCGCTTTACTTAAACGTCATCGATCATCACAACGCG
CTTGAGTATCTCCAGAGCGAGGTTGAAAGGTATCGTAAAGCTGAAAAGAAACTTGGAGAAATTCTCGACACTCTC
AGACGTGGTTACAACCCGAACTATCAAGACATGGCCGTCCTAGAGGCAGTTCGTGGTTGGGAGAAACATGCTGAT
CTTCCCCACATTAACGACGTTGGCAAAGAGGGTGAAGCAGCTGAGGAAGAGAAGAAAGAAAAACCGCCTGCTGCA
ACGACGATCGATGGAGAAGTGTGGACTGAGGAGATGCTGCAAAAGGAGTTGAAGGCGTTAATAAAAACTGATTTT
GACTCGTTGCTAGTGGAAGACGACGAGTACCATCGCTCGAATGAAGTACAAGAAGAGAATCGTAAGTCTTTAGTC
TTAGTTATATGTGACAGGACCTGTGTTAATTCGCAAATTCATAGAGTTCGATGTTACATCATACCTTCCCGATTT
TGCGGTTGGCTACTATGATCAGCTCAAAGACGGTCTTGTCTCGTTGTTCGGCAGTGCACCGGAAGCCTCCACAAA
GGGTTCCACAAAGGGCTCAGGTATTCCTTCTTTTCCTAAACCTCTATGACTTTCCTGTAAACATATTTCTTCTCA
GCCAAGGCAACCAAGGCCCGTGAAGCGTTCAACAAGGCTGACGAGGAGCTACGTCAACTCCAAACAGACAAGCAA
CAGAGCGAACGGGAGGCTGCTAAAATCTTCGACGTAAAGCACTTCGGTGCCGAGGGCGCATGGAAGAAACTTGAT
AATACCTGTATTGAATACGATGACGGAGACTACATCTACGAAACCTGTTTCTTCAAGGAATCCAAGCAAAAACCA
AAGGGCTCAGGAATCACTCAAAGTCTTGGGTACGTGAATTTTTAAAAAGGACTCACCTTCGATGGCTGAAGAAGC
TTTTTGTATGGCAGTAACTTTGAATCGTGGAATCCATCACCGGATGTTGAACCCGGAACGCCCGAATATTACTCG
AAACAGGTATACAAGCATGGTTCGAGATGTTGGAACGGTCCAGAACGCAATGTTATCGTAAGTTCACACCTCCAA
AAAGTCTATTTTTGTCAAAACGGAAATCACTTACGATCGTCCCTTTTTCTATAGTTCATTCTGACTTGTGGGACT
GAGAATACTATTACATCGGTGCAGGAACTCGAAAAGTGTGAATATCAGTTCACTGGGACAACACCAGCACTTTGT
TTACCAGTGACGGAGTCTAATACCAATAATAAGTCGAGGCAAGAGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail