Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|076950
Gene name
Locationscaffold_4:2754421..2755618
Strand-
Gene length (bp)1197
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 6.0E-13 51 316
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.7E-11 87 306
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.6E-10 85 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B7KWT4|RUTD_METC4 Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rutD PE=3 SV=1 36 316 2.0E-12
sp|D5VGV3|RUTD_CAUST Putative aminoacrylate hydrolase RutD OS=Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059) GN=rutD PE=3 SV=1 30 316 2.0E-11
sp|C7CM33|RUTD_METED Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain DSM 5838 / DM4) GN=rutD PE=3 SV=1 36 316 2.0E-11
sp|A8IAD8|RUTD_AZOC5 Putative aminoacrylate hydrolase RutD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutD PE=3 SV=1 31 158 5.0E-11
sp|P00632|ELH2_ACIAD 3-oxoadipate enol-lactonase 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catD PE=1 SV=3 36 161 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B7KWT4|RUTD_METC4 Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rutD PE=3 SV=1 36 316 2.0E-12
sp|D5VGV3|RUTD_CAUST Putative aminoacrylate hydrolase RutD OS=Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059) GN=rutD PE=3 SV=1 30 316 2.0E-11
sp|C7CM33|RUTD_METED Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain DSM 5838 / DM4) GN=rutD PE=3 SV=1 36 316 2.0E-11
sp|A8IAD8|RUTD_AZOC5 Putative aminoacrylate hydrolase RutD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutD PE=3 SV=1 31 158 5.0E-11
sp|P00632|ELH2_ACIAD 3-oxoadipate enol-lactonase 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catD PE=1 SV=3 36 161 6.0E-11
sp|B1ZB18|RUTD_METPB Putative aminoacrylate hydrolase RutD OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rutD PE=3 SV=1 41 316 2.0E-10
sp|A9W3H8|RUTD_METEP Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain PA1) GN=rutD PE=3 SV=1 36 316 1.0E-07
sp|P26495|PHAB_PSEOL Poly(3-hydroxyalkanoate) depolymerase OS=Pseudomonas oleovorans GN=phaB PE=3 SV=1 88 165 3.0E-07
sp|Q54528|RDMC_STREF Aclacinomycin methylesterase RdmC OS=Streptomyces purpurascens GN=rdmC PE=1 SV=1 35 158 4.0E-07
sp|P77044|MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) GN=mhpC PE=1 SV=4 25 318 6.0E-07
sp|B1XBJ6|MHPC_ECODH 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12 / DH10B) GN=mhpC PE=3 SV=2 25 318 6.0E-07
sp|A4VQH7|RUTD_PSEU5 Putative aminoacrylate hydrolase RutD OS=Pseudomonas stutzeri (strain A1501) GN=rutD PE=3 SV=1 36 318 6.0E-07
sp|Q9KWQ6|HSAD_RHOJR 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Rhodococcus jostii (strain RHA1) GN=hsaD PE=1 SV=1 35 327 7.0E-07
sp|B6HZX5|MHPC_ECOSE 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain SE11) GN=mhpC PE=3 SV=2 25 318 1.0E-06
sp|B7N8Q6|MHPC_ECOLU 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mhpC PE=3 SV=2 25 318 1.0E-06
sp|A7ZWZ6|MHPC_ECOHS 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O9:H4 (strain HS) GN=mhpC PE=3 SV=2 25 318 1.0E-06
sp|B7M2Z7|MHPC_ECO8A 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O8 (strain IAI1) GN=mhpC PE=3 SV=2 25 318 1.0E-06
sp|B7NK06|MHPC_ECO7I 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mhpC PE=3 SV=2 25 318 1.0E-06
sp|B7L505|MHPC_ECO55 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain 55989 / EAEC) GN=mhpC PE=3 SV=2 25 318 1.0E-06
sp|A7ZI96|MHPC_ECO24 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mhpC PE=3 SV=2 25 318 1.0E-06
sp|Q8X5K0|MHPC_ECO57 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O157:H7 GN=mhpC PE=3 SV=3 25 318 1.0E-06
sp|B7MPB6|MHPC_ECO81 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O81 (strain ED1a) GN=mhpC PE=3 SV=2 25 318 5.0E-06
sp|B9JLT6|RUTD_AGRRK Putative aminoacrylate hydrolase RutD OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rutD PE=3 SV=1 36 324 6.0E-06
sp|Q47HL4|MHPC1_DECAR 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 1 OS=Dechloromonas aromatica (strain RCB) GN=mhpC1 PE=3 SV=1 118 318 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|076950
MEFASLDLPTLFNPSTCVRKGLCPVTVPVSGTKHELYFEQHGRGEKYKIILIMGLNSSSFGWVKQVEWFGSEKAF
QDEEGEGGEKSTVLIFDNRGVGNSGYPSGPYSTSRMAEDVICLLDHVGWTEEKGVHVVGISLGGMIAQELAWRIP
ERIGSLVLAVTTPGGWFWNNIPPWKGAMSLTKLMMTPDPLMMAPIVADMLYTQDWLKERDIDEPNKTNRQVQQEA
FLRRVAITKKQRLKGHVSQMVAGLTHHVSAERLRQIGEGVGRVAIVVGDEDHLVWREGSRRLKEGMGKVVLEEWR
NTGHGIHVQRWREFNQLVERTIRTGARGV*
Coding >AgabiH97|076950
ATGGAATTCGCATCTCTAGACCTACCCACGCTCTTCAACCCCTCCACCTGTGTTCGTAAAGGACTTTGTCCAGTA
ACCGTACCTGTGAGTGGTACGAAACATGAGTTGTATTTCGAACAACATGGGAGAGGAGAGAAATACAAGATTATA
TTGATTATGGGGTTGAATTCGAGTTCATTTGGGTGGGTGAAACAGGTTGAGTGGTTTGGTAGTGAAAAGGCATTT
CAAGATGAAGAAGGGGAGGGGGGAGAGAAGAGTACAGTATTGATTTTTGATAATCGTGGTGTTGGAAATTCTGGG
TATCCAAGTGGACCTTATTCGACGTCGAGGATGGCGGAGGATGTGATTTGTTTGTTGGATCATGTGGGATGGACT
GAGGAAAAAGGGGTGCATGTGGTTGGAATCAGTTTGGGAGGGATGATTGCTCAGGAATTGGCATGGAGGATACCC
GAAAGAATTGGATCATTGGTATTGGCAGTGACTACACCTGGAGGATGGTTTTGGAACAACATACCCCCGTGGAAA
GGCGCAATGAGTTTAACAAAGTTAATGATGACGCCTGATCCGTTGATGATGGCACCGATAGTGGCAGATATGCTG
TACACACAGGATTGGCTAAAGGAAAGAGATATAGACGAGCCCAACAAGACTAATAGACAGGTACAGCAGGAGGCG
TTTTTACGCCGGGTGGCGATAACGAAGAAGCAGCGATTAAAAGGGCATGTATCGCAGATGGTGGCGGGGTTGACG
CACCATGTGTCGGCTGAGCGGCTGAGGCAGATTGGGGAAGGGGTGGGGCGGGTAGCGATTGTGGTGGGGGACGAG
GACCATCTGGTATGGCGGGAGGGGTCGCGTCGGCTGAAGGAGGGAATGGGGAAAGTGGTGTTGGAGGAGTGGAGG
AATACCGGGCACGGGATCCACGTGCAGCGGTGGCGGGAGTTCAATCAGCTGGTGGAGAGGACGATTCGCACGGGT
GCACGTGGTGTGTAG
Transcript >AgabiH97|076950
ATGGAATTCGCATCTCTAGACCTACCCACGCTCTTCAACCCCTCCACCTGTGTTCGTAAAGGACTTTGTCCAGTA
ACCGTACCTGTGAGTGGTACGAAACATGAGTTGTATTTCGAACAACATGGGAGAGGAGAGAAATACAAGATTATA
TTGATTATGGGGTTGAATTCGAGTTCATTTGGGTGGGTGAAACAGGTTGAGTGGTTTGGTAGTGAAAAGGCATTT
CAAGATGAAGAAGGGGAGGGGGGAGAGAAGAGTACAGTATTGATTTTTGATAATCGTGGTGTTGGAAATTCTGGG
TATCCAAGTGGACCTTATTCGACGTCGAGGATGGCGGAGGATGTGATTTGTTTGTTGGATCATGTGGGATGGACT
GAGGAAAAAGGGGTGCATGTGGTTGGAATCAGTTTGGGAGGGATGATTGCTCAGGAATTGGCATGGAGGATACCC
GAAAGAATTGGATCATTGGTATTGGCAGTGACTACACCTGGAGGATGGTTTTGGAACAACATACCCCCGTGGAAA
GGCGCAATGAGTTTAACAAAGTTAATGATGACGCCTGATCCGTTGATGATGGCACCGATAGTGGCAGATATGCTG
TACACACAGGATTGGCTAAAGGAAAGAGATATAGACGAGCCCAACAAGACTAATAGACAGGTACAGCAGGAGGCG
TTTTTACGCCGGGTGGCGATAACGAAGAAGCAGCGATTAAAAGGGCATGTATCGCAGATGGTGGCGGGGTTGACG
CACCATGTGTCGGCTGAGCGGCTGAGGCAGATTGGGGAAGGGGTGGGGCGGGTAGCGATTGTGGTGGGGGACGAG
GACCATCTGGTATGGCGGGAGGGGTCGCGTCGGCTGAAGGAGGGAATGGGGAAAGTGGTGTTGGAGGAGTGGAGG
AATACCGGGCACGGGATCCACGTGCAGCGGTGGCGGGAGTTCAATCAGCTGGTGGAGAGGACGATTCGCACGGGT
GCACGTGGTGTGTAG
Gene >AgabiH97|076950
ATGGAATTCGCATCTCTAGACCTACCCACGCTCTTCAACCCCTCCACCTGTGTTCGTAAAGGACTTTGTCCAGTA
ACCGTACCTGTGAGTGGTACGAAACATGAGTTGTATTTCGAACAACATGGGAGAGGAGAGAAATACAAGATTATA
TTGATTATGGGGTTGAATTCGAGTTCATTTGGGTGGGTGAAACAGGTTGAGTGGTTTGGTAGTGAAAAGGCATTT
CAAGATGAAGAAGGGGAGGGGGGAGAGAAGAGTACAGTATTGATTTTTGATAATCGTGGTGTTGGAAATTCTGGG
TATCCAAGTGGACCTTATTCGTGCGTTTTGCGCTTATTTTTTCTATTATTTTTTTGGTGTGTTGAATGAAAATGA
AGGACGTCGAGGATGGCGGAGGATGTGATTTGTTTGTTGGATCATGTGGGATGGACTGAGGAAAAAGGGGTGCAT
GTGGTTGGAATCAGTTTGGGAGGGATGATTGCTCAGGGTGAGTCATCATTTTTCTGCATTCTTGTGAATCTCATG
AGGTGGTAGAATTGGCATGGAGGATACCCGAAAGAATTGGATCATTGGTATTGGCAGTGACTACACCTGGAGGAT
GGTTTTGGAACAACATACCCCCGGTAATTGATTTATTTTACGTCTACTTGAACGTGATTAACATCGTAATAATAG
TGGAAAGGCGCAATGAGTTTAACAAAGTTAATGATGACGCCTGATCCGTTGATGATGGCACCGATAGTGGCAGAT
ATGCTGTACACACAGGATTGGCTAAAGGAAAGAGATATAGACGAGCCCAACAAGACTAATAGACAGGTACAGCAG
GAGGTGAGTTTACGTGTTTTGTGATGGTGAAAAGGGTATTGAAGTGTGGGGTAGGCGTTTTTACGCCGGGTGGCG
ATAACGAAGAAGCAGCGATTAAAAGGGCATGTATCGCAGATGGTGGCGGGGTTGACGCACCATGTGTCGGCTGAG
CGGCTGAGGCAGATTGGGGAAGGGGTGGGGCGGGTAGCGATTGTGGTGGGGGACGAGGACCATCTGGTATGGCGG
GAGGGGTCGCGTCGGCTGAAGGAGGGAATGGGGAAAGTGGTGTTGGAGGAGTGGAGGAATACCGGGCACGGGATC
CACGTGCAGCGGTGGCGGGAGTTCAATCAGCTGGTGGAGAGGACGATTCGCACGGGTGCACGTGGTGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail