© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|076610 |
| Gene name | |
| Location | scaffold_4:2656287..2660744 |
| Strand | + |
| Gene length (bp) | 4457 |
| Transcript length (bp) | 3630 |
| Coding sequence length (bp) | 3630 |
| Protein length (aa) | 1210 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 5.5E-35 | 614 | 824 |
| PF11987 | IF-2 | Translation-initiation factor 2 | 1.3E-20 | 939 | 1050 |
| PF03144 | GTP_EFTU_D2 | Elongation factor Tu domain 2 | 2.7E-08 | 851 | 927 |
| PF01926 | MMR_HSR1 | 50S ribosome-binding GTPase | 1.2E-05 | 615 | 738 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10251|IF2P_SCHPO | Eukaryotic translation initiation factor 5B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.03 PE=1 SV=1 | 609 | 1208 | 0.0E+00 |
| sp|P39730|IF2P_YEAST | Eukaryotic translation initiation factor 5B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN12 PE=1 SV=2 | 606 | 1208 | 0.0E+00 |
| sp|Q05D44|IF2P_MOUSE | Eukaryotic translation initiation factor 5B OS=Mus musculus GN=Eif5b PE=1 SV=2 | 606 | 1208 | 0.0E+00 |
| sp|B2GUV7|IF2P_RAT | Eukaryotic translation initiation factor 5B OS=Rattus norvegicus GN=Eif5b PE=1 SV=1 | 606 | 1208 | 0.0E+00 |
| sp|O60841|IF2P_HUMAN | Eukaryotic translation initiation factor 5B OS=Homo sapiens GN=EIF5B PE=1 SV=4 | 606 | 1208 | 0.0E+00 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10251|IF2P_SCHPO | Eukaryotic translation initiation factor 5B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.03 PE=1 SV=1 | 609 | 1208 | 0.0E+00 |
| sp|P39730|IF2P_YEAST | Eukaryotic translation initiation factor 5B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN12 PE=1 SV=2 | 606 | 1208 | 0.0E+00 |
| sp|Q05D44|IF2P_MOUSE | Eukaryotic translation initiation factor 5B OS=Mus musculus GN=Eif5b PE=1 SV=2 | 606 | 1208 | 0.0E+00 |
| sp|B2GUV7|IF2P_RAT | Eukaryotic translation initiation factor 5B OS=Rattus norvegicus GN=Eif5b PE=1 SV=1 | 606 | 1208 | 0.0E+00 |
| sp|O60841|IF2P_HUMAN | Eukaryotic translation initiation factor 5B OS=Homo sapiens GN=EIF5B PE=1 SV=4 | 606 | 1208 | 0.0E+00 |
| sp|Q5RDE1|IF2P_PONAB | Eukaryotic translation initiation factor 5B OS=Pongo abelii GN=EIF5B PE=2 SV=2 | 606 | 1208 | 0.0E+00 |
| sp|Q54XP6|IF2P_DICDI | Eukaryotic translation initiation factor 5B OS=Dictyostelium discoideum GN=eif5b PE=3 SV=1 | 611 | 1208 | 0.0E+00 |
| sp|A8A8D3|IF2P_IGNH4 | Probable translation initiation factor IF-2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=infB PE=3 SV=1 | 602 | 1202 | 4.0E-125 |
| sp|A2BJZ8|IF2P_HYPBU | Probable translation initiation factor IF-2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=infB PE=3 SV=1 | 610 | 1200 | 1.0E-123 |
| sp|Q9Y9B3|IF2P_AERPE | Probable translation initiation factor IF-2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=infB PE=3 SV=1 | 610 | 1197 | 2.0E-120 |
| sp|A1RXH6|IF2P_THEPD | Probable translation initiation factor IF-2 OS=Thermofilum pendens (strain Hrk 5) GN=infB PE=3 SV=1 | 610 | 1208 | 3.0E-118 |
| sp|A3DMS0|IF2P_STAMF | Probable translation initiation factor IF-2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=infB PE=3 SV=1 | 606 | 1202 | 7.0E-118 |
| sp|P95691|IF2P_SULAC | Probable translation initiation factor IF-2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=infB PE=3 SV=2 | 610 | 1197 | 1.0E-117 |
| sp|B6YWH3|IF2P_THEON | Probable translation initiation factor IF-2 OS=Thermococcus onnurineus (strain NA1) GN=infB PE=3 SV=1 | 610 | 1204 | 6.0E-115 |
| sp|Q9HNQ2|IF2P_HALSA | Probable translation initiation factor IF-2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=infB PE=3 SV=1 | 609 | 1190 | 8.0E-114 |
| sp|B0R6U5|IF2P_HALS3 | Probable translation initiation factor IF-2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=infB PE=3 SV=1 | 609 | 1190 | 8.0E-114 |
| sp|Q976A1|IF2P_SULTO | Probable translation initiation factor IF-2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=infB PE=3 SV=1 | 610 | 1196 | 1.0E-113 |
| sp|Q2FU48|IF2P_METHJ | Probable translation initiation factor IF-2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=infB PE=3 SV=1 | 610 | 1184 | 6.0E-111 |
| sp|C6A1V3|IF2P_THESM | Probable translation initiation factor IF-2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=infB PE=3 SV=1 | 610 | 1177 | 3.0E-109 |
| sp|A2STM8|IF2P_METLZ | Probable translation initiation factor IF-2 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=infB PE=3 SV=1 | 608 | 1183 | 8.0E-109 |
| sp|B9LQL7|IF2P_HALLT | Probable translation initiation factor IF-2 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=infB PE=3 SV=1 | 606 | 1195 | 2.0E-107 |
| sp|A4YCQ5|IF2P_METS5 | Probable translation initiation factor IF-2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=infB PE=3 SV=1 | 610 | 1197 | 4.0E-107 |
| sp|Q5UXU6|IF2P_HALMA | Probable translation initiation factor IF-2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=infB PE=3 SV=1 | 610 | 1192 | 7.0E-107 |
| sp|A0B8Q6|IF2P_METTP | Probable translation initiation factor IF-2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=infB PE=3 SV=1 | 610 | 1104 | 2.0E-106 |
| sp|Q466D5|IF2P_METBF | Probable translation initiation factor IF-2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=infB PE=3 SV=1 | 606 | 1183 | 5.0E-106 |
| sp|O26359|IF2P_METTH | Probable translation initiation factor IF-2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=infB PE=1 SV=1 | 610 | 1195 | 7.0E-106 |
| sp|A3CSP4|IF2P_METMJ | Probable translation initiation factor IF-2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=infB PE=3 SV=1 | 610 | 1184 | 1.0E-105 |
| sp|A7IAP7|IF2P_METB6 | Probable translation initiation factor IF-2 OS=Methanoregula boonei (strain 6A8) GN=infB PE=3 SV=1 | 610 | 1190 | 1.0E-105 |
| sp|A8MBV9|IF2P_CALMQ | Probable translation initiation factor IF-2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=infB PE=3 SV=1 | 608 | 1175 | 1.0E-105 |
| sp|Q18FT0|IF2P_HALWD | Probable translation initiation factor IF-2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=infB PE=3 SV=3 | 603 | 1171 | 1.0E-105 |
| sp|Q12Z93|IF2P_METBU | Probable translation initiation factor IF-2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=infB PE=3 SV=1 | 607 | 1197 | 2.0E-105 |
| sp|Q0W8X2|IF2P_METAR | Probable translation initiation factor IF-2 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=infB PE=3 SV=1 | 601 | 1104 | 4.0E-105 |
| sp|Q8TV06|IF2P_METKA | Probable translation initiation factor IF-2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=infB PE=3 SV=1 | 610 | 1204 | 3.0E-104 |
| sp|O29490|IF2P_ARCFU | Probable translation initiation factor IF-2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=infB PE=3 SV=1 | 610 | 1175 | 6.0E-104 |
| sp|A6UVG0|IF2P_META3 | Probable translation initiation factor IF-2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=infB PE=3 SV=1 | 610 | 1187 | 3.0E-102 |
| sp|Q3IMS5|IF2P_NATPD | Probable translation initiation factor IF-2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=infB PE=3 SV=1 | 610 | 1184 | 3.0E-102 |
| sp|A4FZQ3|IF2P_METM5 | Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=infB PE=3 SV=1 | 610 | 1190 | 5.0E-102 |
| sp|Q2NGM6|IF2P_METST | Probable translation initiation factor IF-2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=infB PE=3 SV=1 | 611 | 1204 | 2.0E-101 |
| sp|Q8PU78|IF2P_METMA | Probable translation initiation factor IF-2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=infB PE=3 SV=1 | 606 | 1078 | 3.0E-101 |
| sp|A9A813|IF2P_METM6 | Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=infB PE=3 SV=1 | 610 | 1188 | 2.0E-100 |
| sp|Q8TQL5|IF2P_METAC | Probable translation initiation factor IF-2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=infB PE=3 SV=1 | 601 | 1078 | 3.0E-100 |
| sp|A4WIK2|IF2P_PYRAR | Probable translation initiation factor IF-2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=infB PE=3 SV=1 | 610 | 1175 | 3.0E-100 |
| sp|A6VIS4|IF2P_METM7 | Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=infB PE=3 SV=1 | 610 | 1190 | 3.0E-100 |
| sp|Q8U1R8|IF2P_PYRFU | Probable translation initiation factor IF-2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=infB PE=3 SV=1 | 626 | 1203 | 4.0E-99 |
| sp|Q980Q8|IF2P_SULSO | Probable translation initiation factor IF-2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=infB PE=3 SV=1 | 610 | 1192 | 4.0E-99 |
| sp|Q5JGR9|IF2P_THEKO | Probable translation initiation factor IF-2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=infB PE=3 SV=1 | 617 | 1204 | 2.0E-98 |
| sp|B1YCQ7|IF2P_PYRNV | Probable translation initiation factor IF-2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=infB PE=3 SV=1 | 610 | 1190 | 2.0E-97 |
| sp|A3MTU7|IF2P_PYRCJ | Probable translation initiation factor IF-2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=infB PE=3 SV=1 | 610 | 1190 | 6.0E-97 |
| sp|Q9UZK7|IF2P_PYRAB | Probable translation initiation factor IF-2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=infB PE=3 SV=1 | 626 | 1204 | 8.0E-97 |
| sp|Q8ZX20|IF2P_PYRAE | Probable translation initiation factor IF-2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=infB PE=3 SV=1 | 610 | 1190 | 1.0E-96 |
| sp|A1RUX2|IF2P_PYRIL | Probable translation initiation factor IF-2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=infB PE=3 SV=1 | 610 | 1190 | 1.0E-96 |
| sp|O58822|IF2P_PYRHO | Probable translation initiation factor IF-2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=infB PE=3 SV=1 | 626 | 1204 | 2.0E-96 |
| sp|A5UJM9|IF2P_METS3 | Probable translation initiation factor IF-2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=infB PE=3 SV=1 | 610 | 1195 | 2.0E-96 |
| sp|Q6M0I6|IF2P_METMP | Probable translation initiation factor IF-2 OS=Methanococcus maripaludis (strain S2 / LL) GN=infB PE=3 SV=1 | 610 | 1190 | 4.0E-96 |
| sp|A6URS1|IF2P_METVS | Probable translation initiation factor IF-2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=infB PE=3 SV=1 | 610 | 1206 | 4.0E-95 |
| sp|Q57710|IF2P_METJA | Probable translation initiation factor IF-2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=infB PE=3 SV=1 | 626 | 1190 | 1.0E-86 |
| sp|Q9HJ60|IF2P_THEAC | Probable translation initiation factor IF-2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=infB PE=3 SV=1 | 610 | 1104 | 4.0E-73 |
| sp|Q97BK4|IF2P_THEVO | Probable translation initiation factor IF-2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=infB PE=3 SV=1 | 610 | 1104 | 5.0E-72 |
| sp|Q46J13|IF2_PROMT | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL2A) GN=infB PE=3 SV=1 | 611 | 1048 | 8.0E-35 |
| sp|A5WBS5|IF2_PSYWF | Translation initiation factor IF-2 OS=Psychrobacter sp. (strain PRwf-1) GN=infB PE=3 SV=1 | 598 | 1048 | 9.0E-35 |
| sp|Q0AYI8|IF2_SYNWW | Translation initiation factor IF-2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-34 |
| sp|Q31LL9|IF2_SYNE7 | Translation initiation factor IF-2 OS=Synechococcus elongatus (strain PCC 7942) GN=infB PE=3 SV=1 | 611 | 1059 | 4.0E-34 |
| sp|A5GVG4|IF2_SYNR3 | Translation initiation factor IF-2 OS=Synechococcus sp. (strain RCC307) GN=infB PE=3 SV=1 | 611 | 1059 | 5.0E-34 |
| sp|A2C4P1|IF2_PROM1 | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL1A) GN=infB PE=3 SV=1 | 611 | 1048 | 7.0E-34 |
| sp|A9BCI5|IF2_PROM4 | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9211) GN=infB PE=3 SV=1 | 606 | 1099 | 7.0E-34 |
| sp|P72689|IF2_SYNY3 | Translation initiation factor IF-2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=infB PE=3 SV=1 | 569 | 1088 | 1.0E-33 |
| sp|Q0I7K2|IF2_SYNS3 | Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9311) GN=infB PE=3 SV=1 | 583 | 1059 | 1.0E-33 |
| sp|A6Q226|IF2_NITSB | Translation initiation factor IF-2 OS=Nitratiruptor sp. (strain SB155-2) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-33 |
| sp|Q3AHW1|IF2_SYNSC | Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9605) GN=infB PE=3 SV=1 | 583 | 1059 | 2.0E-33 |
| sp|Q2RJM5|IF2_MOOTA | Translation initiation factor IF-2 OS=Moorella thermoacetica (strain ATCC 39073) GN=infB PE=3 SV=1 | 611 | 1081 | 2.0E-33 |
| sp|A6QBQ5|IF2_SULNB | Translation initiation factor IF-2 OS=Sulfurovum sp. (strain NBC37-1) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-33 |
| sp|C1F697|IF2_ACIC5 | Translation initiation factor IF-2 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=infB PE=3 SV=1 | 597 | 1128 | 2.0E-33 |
| sp|A5GNJ0|IF2_SYNPW | Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH7803) GN=infB PE=3 SV=1 | 611 | 1130 | 3.0E-33 |
| sp|B7KIU2|IF2_CYAP7 | Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7424) GN=infB PE=3 SV=1 | 611 | 1088 | 4.0E-33 |
| sp|A5E866|IF2_BRASB | Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=infB PE=3 SV=1 | 611 | 1143 | 4.0E-33 |
| sp|Q5N0A5|IF2_SYNP6 | Translation initiation factor IF-2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=infB PE=3 SV=1 | 613 | 1059 | 4.0E-33 |
| sp|A2C6Q5|IF2_PROM3 | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9303) GN=infB PE=3 SV=1 | 611 | 1059 | 7.0E-33 |
| sp|A4J5X2|IF2_DESRM | Translation initiation factor IF-2 OS=Desulfotomaculum reducens (strain MI-1) GN=infB PE=3 SV=1 | 610 | 1048 | 9.0E-33 |
| sp|Q7VA20|IF2_PROMA | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=infB PE=3 SV=1 | 611 | 1143 | 1.0E-32 |
| sp|Q3AZB7|IF2_SYNS9 | Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9902) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-32 |
| sp|Q7V5M4|IF2_PROMM | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9313) GN=infB PE=3 SV=1 | 611 | 1059 | 1.0E-32 |
| sp|A7GZZ3|IF2_CAMC5 | Translation initiation factor IF-2 OS=Campylobacter curvus (strain 525.92) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-32 |
| sp|Q6MD64|IF2_PARUW | Translation initiation factor IF-2 OS=Protochlamydia amoebophila (strain UWE25) GN=infB PE=3 SV=1 | 610 | 1127 | 2.0E-32 |
| sp|A5D2S0|IF2_PELTS | Translation initiation factor IF-2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=infB PE=3 SV=1 | 611 | 1064 | 2.0E-32 |
| sp|A0LHL8|IF2_SYNFM | Translation initiation factor IF-2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=infB PE=3 SV=1 | 611 | 1047 | 2.0E-32 |
| sp|A0Q8F3|IF2_FRATN | Translation initiation factor IF-2 OS=Francisella tularensis subsp. novicida (strain U112) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-32 |
| sp|A4IW10|IF2_FRATW | Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-32 |
| sp|B2SEW7|IF2_FRATM | Translation initiation factor IF-2 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-32 |
| sp|Q3J9B6|IF2_NITOC | Translation initiation factor IF-2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=infB PE=3 SV=1 | 611 | 1110 | 3.0E-32 |
| sp|A1AV99|IF2_RUTMC | Translation initiation factor IF-2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=infB PE=3 SV=1 | 611 | 1048 | 4.0E-32 |
| sp|Q5NIL7|IF2_FRATT | Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=infB PE=3 SV=1 | 611 | 1048 | 4.0E-32 |
| sp|Q14K20|IF2_FRAT1 | Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=infB PE=3 SV=1 | 611 | 1048 | 4.0E-32 |
| sp|Q7U8L9|IF2_SYNPX | Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH8102) GN=infB PE=3 SV=1 | 611 | 1048 | 5.0E-32 |
| sp|A4YJE9|IF2_BRASO | Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain ORS278) GN=infB PE=3 SV=1 | 611 | 1143 | 7.0E-32 |
| sp|B0JU67|IF2_MICAN | Translation initiation factor IF-2 OS=Microcystis aeruginosa (strain NIES-843) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-31 |
| sp|Q6FF40|IF2_ACIAD | Translation initiation factor IF-2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=infB PE=3 SV=1 | 599 | 1048 | 2.0E-31 |
| sp|B9EBE9|IF2_MACCJ | Translation initiation factor IF-2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=infB PE=3 SV=1 | 606 | 1048 | 2.0E-31 |
| sp|A7ZC69|IF2_CAMC1 | Translation initiation factor IF-2 OS=Campylobacter concisus (strain 13826) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-31 |
| sp|Q1QEP5|IF2_PSYCK | Translation initiation factor IF-2 OS=Psychrobacter cryohalolentis (strain K5) GN=infB PE=3 SV=1 | 611 | 1127 | 2.0E-31 |
| sp|Q3AB98|IF2_CARHZ | Translation initiation factor IF-2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=infB PE=3 SV=1 | 611 | 1108 | 2.0E-31 |
| sp|Q2KXY7|IF2_BORA1 | Translation initiation factor IF-2 OS=Bordetella avium (strain 197N) GN=infB PE=3 SV=1 | 611 | 1099 | 3.0E-31 |
| sp|Q0BK70|IF2_FRATO | Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-31 |
| sp|A7NEI8|IF2_FRATF | Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-31 |
| sp|Q2A1G8|IF2_FRATH | Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-31 |
| sp|C5CDZ4|IF2_KOSOT | Translation initiation factor IF-2 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=infB PE=3 SV=1 | 611 | 1127 | 5.0E-31 |
| sp|Q4FVL5|IF2_PSYA2 | Translation initiation factor IF-2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=infB PE=3 SV=1 | 611 | 1127 | 6.0E-31 |
| sp|Q46ZP1|IF2_CUPPJ | Translation initiation factor IF-2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=infB PE=3 SV=1 | 611 | 1064 | 6.0E-31 |
| sp|B7IF03|IF2_THEAB | Translation initiation factor IF-2 OS=Thermosipho africanus (strain TCF52B) GN=infB PE=3 SV=1 | 611 | 1052 | 7.0E-31 |
| sp|Q65JI1|IF2_BACLD | Translation initiation factor IF-2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=infB PE=3 SV=1 | 606 | 1052 | 8.0E-31 |
| sp|A8F5A0|IF2_PSELT | Translation initiation factor IF-2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=infB PE=3 SV=1 | 592 | 1048 | 1.0E-30 |
| sp|Q7M7X5|IF2_WOLSU | Translation initiation factor IF-2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-30 |
| sp|Q1GVI9|IF2_SPHAL | Translation initiation factor IF-2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=infB PE=3 SV=1 | 611 | 1046 | 2.0E-30 |
| sp|B1HR05|IF2_LYSSC | Translation initiation factor IF-2 OS=Lysinibacillus sphaericus (strain C3-41) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-30 |
| sp|Q1LLR6|IF2_CUPMC | Translation initiation factor IF-2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=infB PE=3 SV=1 | 611 | 1064 | 2.0E-30 |
| sp|B8HUA9|IF2_CYAP4 | Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=infB PE=3 SV=1 | 602 | 1073 | 3.0E-30 |
| sp|B1L7T1|IF2_THESQ | Translation initiation factor IF-2 OS=Thermotoga sp. (strain RQ2) GN=infB PE=3 SV=1 | 602 | 1048 | 4.0E-30 |
| sp|A2BYM0|IF2_PROM5 | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9515) GN=infB PE=3 SV=1 | 611 | 1108 | 5.0E-30 |
| sp|B9KEV0|IF2_CAMLR | Translation initiation factor IF-2 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=infB PE=3 SV=1 | 611 | 1048 | 5.0E-30 |
| sp|Q10XM3|IF2_TRIEI | Translation initiation factor IF-2 OS=Trichodesmium erythraeum (strain IMS101) GN=infB PE=3 SV=1 | 611 | 1048 | 6.0E-30 |
| sp|B3R1E4|IF2_CUPTR | Translation initiation factor IF-2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=infB PE=3 SV=1 | 611 | 1064 | 7.0E-30 |
| sp|Q7VYR2|IF2_BORPE | Translation initiation factor IF-2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=infB PE=3 SV=1 | 611 | 1099 | 7.0E-30 |
| sp|B0RDY9|IF2_CLAMS | Translation initiation factor IF-2 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=infB PE=3 SV=1 | 610 | 886 | 8.0E-30 |
| sp|A5CSZ4|IF2_CLAM3 | Translation initiation factor IF-2 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=infB PE=3 SV=1 | 610 | 886 | 8.0E-30 |
| sp|Q01W31|IF2_SOLUE | Translation initiation factor IF-2 OS=Solibacter usitatus (strain Ellin6076) GN=infB PE=3 SV=1 | 604 | 886 | 8.0E-30 |
| sp|B0VE81|IF2_ACIBY | Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AYE) GN=infB PE=3 SV=1 | 599 | 1048 | 8.0E-30 |
| sp|B2I2M7|IF2_ACIBC | Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain ACICU) GN=infB PE=3 SV=1 | 599 | 1048 | 8.0E-30 |
| sp|B7I3R9|IF2_ACIB5 | Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB0057) GN=infB PE=3 SV=1 | 599 | 1048 | 8.0E-30 |
| sp|B7H115|IF2_ACIB3 | Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB307-0294) GN=infB PE=3 SV=1 | 599 | 1048 | 8.0E-30 |
| sp|Q30SS6|IF2_SULDN | Translation initiation factor IF-2 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=infB PE=3 SV=1 | 611 | 1127 | 8.0E-30 |
| sp|Q5WFU2|IF2_BACSK | Translation initiation factor IF-2 OS=Bacillus clausii (strain KSM-K16) GN=infB PE=3 SV=1 | 611 | 1048 | 8.0E-30 |
| sp|Q7WHG2|IF2_BORBR | Translation initiation factor IF-2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=infB PE=3 SV=1 | 611 | 1099 | 9.0E-30 |
| sp|A0RQZ4|IF2_CAMFF | Translation initiation factor IF-2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-29 |
| sp|B7GG75|IF2_ANOFW | Translation initiation factor IF-2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=infB PE=3 SV=1 | 606 | 1052 | 1.0E-29 |
| sp|B0VLU2|IF2_ACIBS | Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain SDF) GN=infB PE=3 SV=1 | 599 | 1048 | 1.0E-29 |
| sp|Q8CST4|IF2_STAES | Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-29 |
| sp|Q5HPS2|IF2_STAEQ | Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-29 |
| sp|B8J1Y4|IF2_DESDA | Translation initiation factor IF-2 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=infB PE=3 SV=1 | 611 | 1146 | 1.0E-29 |
| sp|Q0K9B9|IF2_CUPNH | Translation initiation factor IF-2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=infB PE=3 SV=1 | 611 | 1064 | 1.0E-29 |
| sp|B0CK11|IF2_BRUSI | Translation initiation factor IF-2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=infB PE=3 SV=1 | 303 | 1127 | 2.0E-29 |
| sp|Q57AA0|IF2_BRUAB | Translation initiation factor IF-2 OS=Brucella abortus biovar 1 (strain 9-941) GN=infB PE=3 SV=1 | 303 | 1127 | 2.0E-29 |
| sp|Q2YQR7|IF2_BRUA2 | Translation initiation factor IF-2 OS=Brucella abortus (strain 2308) GN=infB PE=3 SV=1 | 303 | 1127 | 2.0E-29 |
| sp|B8CW72|IF2_HALOH | Translation initiation factor IF-2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=infB PE=3 SV=1 | 609 | 1048 | 2.0E-29 |
| sp|Q2JMD7|IF2_SYNJB | Translation initiation factor IF-2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=infB PE=3 SV=1 | 611 | 1052 | 2.0E-29 |
| sp|Q7W9A5|IF2_BORPA | Translation initiation factor IF-2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=infB PE=3 SV=1 | 611 | 1099 | 2.0E-29 |
| sp|A5IJ09|IF2_THEP1 | Translation initiation factor IF-2 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=infB PE=3 SV=1 | 602 | 1048 | 2.0E-29 |
| sp|A5CXX6|IF2_VESOH | Translation initiation factor IF-2 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-29 |
| sp|Q72ER1|IF2_DESVH | Translation initiation factor IF-2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-29 |
| sp|A1VG83|IF2_DESVV | Translation initiation factor IF-2 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-29 |
| sp|P17889|IF2_BACSU | Translation initiation factor IF-2 OS=Bacillus subtilis (strain 168) GN=infB PE=3 SV=1 | 606 | 1052 | 3.0E-29 |
| sp|A4JDX1|IF2_BURVG | Translation initiation factor IF-2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=infB PE=3 SV=1 | 611 | 1110 | 3.0E-29 |
| sp|Q8YEB3|IF2_BRUME | Translation initiation factor IF-2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=infB PE=3 SV=2 | 303 | 1127 | 3.0E-29 |
| sp|A3PEY3|IF2_PROM0 | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9301) GN=infB PE=3 SV=1 | 611 | 1108 | 3.0E-29 |
| sp|Q318P8|IF2_PROM9 | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 | 611 | 1108 | 4.0E-29 |
| sp|B9DPF5|IF2_STACT | Translation initiation factor IF-2 OS=Staphylococcus carnosus (strain TM300) GN=infB PE=3 SV=1 | 611 | 1052 | 4.0E-29 |
| sp|A8YVQ7|IF2_LACH4 | Translation initiation factor IF-2 OS=Lactobacillus helveticus (strain DPC 4571) GN=infB PE=3 SV=1 | 611 | 1059 | 4.0E-29 |
| sp|A8M746|IF2_SALAI | Translation initiation factor IF-2 OS=Salinispora arenicola (strain CNS-205) GN=infB PE=3 SV=1 | 611 | 1045 | 4.0E-29 |
| sp|Q9XEK9|IF2C_EUGGR | Translation initiation factor IF-2, chloroplastic (Fragment) OS=Euglena gracilis GN=INFB PE=2 SV=1 | 611 | 1052 | 4.0E-29 |
| sp|A7H9F3|IF2_ANADF | Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=infB PE=3 SV=1 | 606 | 1048 | 5.0E-29 |
| sp|B8FCY5|IF2_DESAA | Translation initiation factor IF-2 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=infB PE=3 SV=1 | 611 | 1048 | 5.0E-29 |
| sp|A9BJ54|IF2_PETMO | Translation initiation factor IF-2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=infB PE=3 SV=1 | 605 | 1048 | 5.0E-29 |
| sp|Q823F2|IF2_CHLCV | Translation initiation factor IF-2 OS=Chlamydophila caviae (strain GPIC) GN=infB PE=3 SV=1 | 611 | 1127 | 5.0E-29 |
| sp|A8G6Z5|IF2_PROM2 | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9215) GN=infB PE=3 SV=1 | 611 | 1108 | 6.0E-29 |
| sp|Q9PQH1|IF2_UREPA | Translation initiation factor IF-2 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=infB PE=3 SV=1 | 611 | 1044 | 6.0E-29 |
| sp|B1AIV8|IF2_UREP2 | Translation initiation factor IF-2 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=infB PE=3 SV=1 | 611 | 1044 | 6.0E-29 |
| sp|Q38W81|IF2_LACSS | Translation initiation factor IF-2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=infB PE=3 SV=1 | 611 | 1059 | 6.0E-29 |
| sp|A0K6X5|IF2_BURCH | Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain HI2424) GN=infB PE=3 SV=1 | 611 | 1127 | 6.0E-29 |
| sp|Q1BWS7|IF2_BURCA | Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain AU 1054) GN=infB PE=3 SV=1 | 611 | 1127 | 6.0E-29 |
| sp|A7I3V0|IF2_CAMHC | Translation initiation factor IF-2 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=infB PE=3 SV=1 | 611 | 1048 | 7.0E-29 |
| sp|Q9WZN3|IF2_THEMA | Translation initiation factor IF-2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=infB PE=3 SV=1 | 602 | 1048 | 7.0E-29 |
| sp|A5VTB2|IF2_BRUO2 | Translation initiation factor IF-2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=infB PE=3 SV=2 | 303 | 1127 | 8.0E-29 |
| sp|B2JKT4|IF2_BURP8 | Translation initiation factor IF-2 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=infB PE=3 SV=1 | 611 | 1127 | 9.0E-29 |
| sp|A8FDD1|IF2_BACP2 | Translation initiation factor IF-2 OS=Bacillus pumilus (strain SAFR-032) GN=infB PE=3 SV=1 | 610 | 1052 | 9.0E-29 |
| sp|Q1MQY8|IF2_LAWIP | Translation initiation factor IF-2 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=infB PE=3 SV=1 | 611 | 1048 | 9.0E-29 |
| sp|B1K0M0|IF2_BURCC | Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain MC0-3) GN=infB PE=3 SV=1 | 611 | 1127 | 1.0E-28 |
| sp|A5UF34|IF2_HAEIG | Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittGG) GN=infB PE=3 SV=1 | 611 | 874 | 1.0E-28 |
| sp|Q7UZZ9|IF2_PROMP | Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 | 611 | 1108 | 1.0E-28 |
| sp|A1U600|IF2_MARHV | Translation initiation factor IF-2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-28 |
| sp|Q4QK37|IF2_HAEI8 | Translation initiation factor IF-2 OS=Haemophilus influenzae (strain 86-028NP) GN=infB PE=3 SV=1 | 611 | 874 | 1.0E-28 |
| sp|Q2SVG8|IF2_BURTA | Translation initiation factor IF-2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=infB PE=3 SV=1 | 611 | 1127 | 1.0E-28 |
| sp|B4E7L1|IF2_BURCJ | Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=infB PE=3 SV=1 | 611 | 1110 | 1.0E-28 |
| sp|B0TWR3|IF2_FRAP2 | Translation initiation factor IF-2 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-28 |
| sp|Q0BFY3|IF2_BURCM | Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=infB PE=3 SV=1 | 611 | 1127 | 1.0E-28 |
| sp|Q1QS64|IF2_NITHX | Translation initiation factor IF-2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-28 |
| sp|Q89WA9|IF2_BRADU | Translation initiation factor IF-2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=infB PE=3 SV=1 | 611 | 1127 | 1.0E-28 |
| sp|B2UAA3|IF2_RALPJ | Translation initiation factor IF-2 OS=Ralstonia pickettii (strain 12J) GN=infB PE=3 SV=1 | 611 | 1110 | 1.0E-28 |
| sp|Q74IS8|IF2_LACJO | Translation initiation factor IF-2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=infB PE=3 SV=1 | 611 | 1059 | 2.0E-28 |
| sp|C5CLW3|IF2_VARPS | Translation initiation factor IF-2 OS=Variovorax paradoxus (strain S110) GN=infB PE=3 SV=1 | 611 | 1064 | 2.0E-28 |
| sp|Q0VSS1|IF2_ALCBS | Translation initiation factor IF-2 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=infB PE=3 SV=1 | 611 | 1108 | 2.0E-28 |
| sp|A9KNW4|IF2_CLOPH | Translation initiation factor IF-2 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=infB PE=3 SV=1 | 611 | 1044 | 2.0E-28 |
| sp|A1A0A2|IF2_BIFAA | Translation initiation factor IF-2 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-28 |
| sp|A7HN01|IF2_FERNB | Translation initiation factor IF-2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=infB PE=3 SV=1 | 606 | 1052 | 3.0E-28 |
| sp|Q9KA77|IF2_BACHD | Translation initiation factor IF-2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=infB PE=3 SV=1 | 611 | 1052 | 3.0E-28 |
| sp|Q49X54|IF2_STAS1 | Translation initiation factor IF-2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-28 |
| sp|Q9PKU0|IF2_CHLMU | Translation initiation factor IF-2 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=infB PE=3 SV=1 | 610 | 1098 | 3.0E-28 |
| sp|A1V3N4|IF2_BURMS | Translation initiation factor IF-2 OS=Burkholderia mallei (strain SAVP1) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-28 |
| sp|Q62KK9|IF2_BURMA | Translation initiation factor IF-2 OS=Burkholderia mallei (strain ATCC 23344) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-28 |
| sp|A2S2L1|IF2_BURM9 | Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10229) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-28 |
| sp|A3MJW4|IF2_BURM7 | Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10247) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-28 |
| sp|A3NUL0|IF2_BURP0 | Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1106a) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-28 |
| sp|Q63TP8|IF2_BURPS | Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain K96243) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-28 |
| sp|A3N8V8|IF2_BURP6 | Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 668) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-28 |
| sp|Q3JSY9|IF2_BURP1 | Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1710b) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-28 |
| sp|B1YP36|IF2_BURA4 | Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain MC40-6) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-28 |
| sp|Q39H30|IF2_BURL3 | Translation initiation factor IF-2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=infB PE=3 SV=1 | 611 | 1127 | 4.0E-28 |
| sp|Q67P86|IF2_SYMTH | Translation initiation factor IF-2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=infB PE=3 SV=1 | 611 | 1061 | 4.0E-28 |
| sp|A4X4N7|IF2_SALTO | Translation initiation factor IF-2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=infB PE=3 SV=1 | 611 | 1045 | 4.0E-28 |
| sp|A2BT70|IF2_PROMS | Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 | 611 | 1108 | 4.0E-28 |
| sp|A9ABD5|IF2_BURM1 | Translation initiation factor IF-2 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=infB PE=3 SV=1 | 611 | 1064 | 4.0E-28 |
| sp|Q21C31|IF2_RHOPB | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB18) GN=infB PE=3 SV=1 | 611 | 1048 | 4.0E-28 |
| sp|Q2JSB7|IF2_SYNJA | Translation initiation factor IF-2 OS=Synechococcus sp. (strain JA-3-3Ab) GN=infB PE=3 SV=1 | 611 | 1052 | 5.0E-28 |
| sp|Q044B7|IF2_LACGA | Translation initiation factor IF-2 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=infB PE=3 SV=1 | 611 | 1059 | 5.0E-28 |
| sp|Q3SWP9|IF2_NITWN | Translation initiation factor IF-2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=infB PE=3 SV=1 | 606 | 1048 | 5.0E-28 |
| sp|Q609C0|IF2_METCA | Translation initiation factor IF-2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=infB PE=3 SV=1 | 611 | 1110 | 5.0E-28 |
| sp|Q254H4|IF2_CHLFF | Translation initiation factor IF-2 OS=Chlamydophila felis (strain Fe/C-56) GN=infB PE=3 SV=1 | 610 | 1066 | 5.0E-28 |
| sp|Q038M5|IF2_LACC3 | Translation initiation factor IF-2 OS=Lactobacillus casei (strain ATCC 334) GN=infB PE=3 SV=1 | 605 | 1044 | 6.0E-28 |
| sp|A8FJU1|IF2_CAMJ8 | Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=infB PE=3 SV=1 | 611 | 1048 | 6.0E-28 |
| sp|A7Z4T4|IF2_BACMF | Translation initiation factor IF-2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=infB PE=3 SV=1 | 610 | 1052 | 6.0E-28 |
| sp|B3H163|IF2_ACTP7 | Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=infB PE=3 SV=1 | 611 | 874 | 6.0E-28 |
| sp|A3N005|IF2_ACTP2 | Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=infB PE=3 SV=1 | 611 | 874 | 6.0E-28 |
| sp|Q1AW55|IF2_RUBXD | Translation initiation factor IF-2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=infB PE=3 SV=1 | 613 | 1052 | 6.0E-28 |
| sp|B3WER5|IF2_LACCB | Translation initiation factor IF-2 OS=Lactobacillus casei (strain BL23) GN=infB PE=3 SV=1 | 605 | 1044 | 6.0E-28 |
| sp|Q03FS3|IF2_PEDPA | Translation initiation factor IF-2 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=infB PE=3 SV=1 | 611 | 1048 | 7.0E-28 |
| sp|Q2NC10|IF2_ERYLH | Translation initiation factor IF-2 OS=Erythrobacter litoralis (strain HTCC2594) GN=infB PE=3 SV=1 | 611 | 1048 | 7.0E-28 |
| sp|B1KWK7|IF2_CLOBM | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=infB PE=3 SV=1 | 611 | 1044 | 8.0E-28 |
| sp|Q5FJN6|IF2_LACAC | Translation initiation factor IF-2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=infB PE=3 SV=1 | 611 | 1059 | 8.0E-28 |
| sp|O83861|IF2_TREPA | Translation initiation factor IF-2 OS=Treponema pallidum (strain Nichols) GN=infB PE=3 SV=1 | 611 | 889 | 8.0E-28 |
| sp|Q1IIT3|IF2_KORVE | Translation initiation factor IF-2 OS=Koribacter versatilis (strain Ellin345) GN=infB PE=3 SV=1 | 610 | 1128 | 9.0E-28 |
| sp|Q3Z7U3|IF2_DEHM1 | Translation initiation factor IF-2 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=infB PE=3 SV=1 | 610 | 1048 | 9.0E-28 |
| sp|B5ZBC9|IF2_UREU1 | Translation initiation factor IF-2 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=infB PE=3 SV=1 | 611 | 1044 | 9.0E-28 |
| sp|Q5HX30|IF2_CAMJR | Translation initiation factor IF-2 OS=Campylobacter jejuni (strain RM1221) GN=infB PE=3 SV=1 | 611 | 1048 | 9.0E-28 |
| sp|Q7VHF6|IF2_HELHP | Translation initiation factor IF-2 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=infB PE=3 SV=1 | 611 | 1052 | 1.0E-27 |
| sp|Q9PIZ1|IF2_CAMJE | Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-27 |
| sp|Q2SML3|IF2_HAHCH | Translation initiation factor IF-2 OS=Hahella chejuensis (strain KCTC 2396) GN=infB PE=3 SV=1 | 611 | 1110 | 1.0E-27 |
| sp|B2J955|IF2_NOSP7 | Translation initiation factor IF-2 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=infB PE=3 SV=1 | 589 | 1073 | 1.0E-27 |
| sp|A7H1L5|IF2_CAMJD | Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-27 |
| sp|A6LP48|IF2_THEM4 | Translation initiation factor IF-2 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=infB PE=3 SV=1 | 611 | 1052 | 1.0E-27 |
| sp|Q73NP6|IF2_TREDE | Translation initiation factor IF-2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=infB PE=3 SV=1 | 608 | 1044 | 1.0E-27 |
| sp|A1VXL9|IF2_CAMJJ | Translation initiation factor IF-2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-27 |
| sp|B0K1D6|IF2_THEPX | Translation initiation factor IF-2 OS=Thermoanaerobacter sp. (strain X514) GN=infB PE=3 SV=1 | 611 | 1065 | 2.0E-27 |
| sp|B1II49|IF2_CLOBK | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Okra / Type B1) GN=infB PE=3 SV=1 | 611 | 1044 | 2.0E-27 |
| sp|C3L0B6|IF2_CLOB6 | Translation initiation factor IF-2 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=infB PE=3 SV=1 | 611 | 1044 | 2.0E-27 |
| sp|Q6GHG6|IF2_STAAR | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MRSA252) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-27 |
| sp|P44323|IF2_HAEIN | Translation initiation factor IF-2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=infB PE=3 SV=1 | 611 | 885 | 2.0E-27 |
| sp|B9IVA1|IF2_BACCQ | Translation initiation factor IF-2 OS=Bacillus cereus (strain Q1) GN=infB PE=3 SV=1 | 611 | 1059 | 2.0E-27 |
| sp|B7HLE6|IF2_BACC7 | Translation initiation factor IF-2 OS=Bacillus cereus (strain AH187) GN=infB PE=3 SV=1 | 611 | 1059 | 2.0E-27 |
| sp|A4G7S7|IF2_HERAR | Translation initiation factor IF-2 OS=Herminiimonas arsenicoxydans GN=infB PE=3 SV=1 | 611 | 1110 | 2.0E-27 |
| sp|Q732Q9|IF2_BACC1 | Translation initiation factor IF-2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=infB PE=3 SV=1 | 611 | 1059 | 2.0E-27 |
| sp|B3PI96|IF2_CELJU | Translation initiation factor IF-2 OS=Cellvibrio japonicus (strain Ueda107) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-27 |
| sp|A5I4J3|IF2_CLOBH | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=infB PE=3 SV=1 | 611 | 1044 | 2.0E-27 |
| sp|A7FVZ3|IF2_CLOB1 | Translation initiation factor IF-2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=infB PE=3 SV=1 | 611 | 1044 | 2.0E-27 |
| sp|A5UBT6|IF2_HAEIE | Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittEE) GN=infB PE=3 SV=1 | 611 | 885 | 2.0E-27 |
| sp|A8IG20|IF2_AZOC5 | Translation initiation factor IF-2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-27 |
| sp|Q6AG49|IF2_LEIXX | Translation initiation factor IF-2 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=infB PE=3 SV=1 | 609 | 885 | 2.0E-27 |
| sp|P65134|IF2_STAAN | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain N315) GN=infB PE=1 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|P65133|IF2_STAAM | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|Q2YXP7|IF2_STAAB | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|A5ISF3|IF2_STAA9 | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH9) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|A6U188|IF2_STAA2 | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH1) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|A7X1Q1|IF2_STAA1 | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|A4IMD7|IF2_GEOTN | Translation initiation factor IF-2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=infB PE=3 SV=1 | 611 | 1052 | 3.0E-27 |
| sp|B3QUN2|IF2_CHLT3 | Translation initiation factor IF-2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=infB PE=3 SV=1 | 611 | 1098 | 3.0E-27 |
| sp|A6MVX8|IF2C_RHDSA | Translation initiation factor IF-2, chloroplastic OS=Rhodomonas salina GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-27 |
| sp|A8Z3U9|IF2_STAAT | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|A6QGG8|IF2_STAAE | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Newman) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|Q5HGG2|IF2_STAAC | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain COL) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|Q2G2D0|IF2_STAA8 | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain NCTC 8325) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|Q2FHG9|IF2_STAA3 | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-27 |
| sp|A1WXV1|IF2_HALHL | Translation initiation factor IF-2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=infB PE=3 SV=1 | 611 | 1044 | 3.0E-27 |
| sp|Q3ZXU3|IF2_DEHMC | Translation initiation factor IF-2 OS=Dehalococcoides mccartyi (strain CBDB1) GN=infB PE=3 SV=1 | 610 | 1098 | 3.0E-27 |
| sp|A5FQR6|IF2_DEHMB | Translation initiation factor IF-2 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=infB PE=3 SV=1 | 610 | 1098 | 3.0E-27 |
| sp|C1FS59|IF2_CLOBJ | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=infB PE=3 SV=1 | 611 | 1044 | 3.0E-27 |
| sp|Q9Z8M1|IF2_CHLPN | Translation initiation factor IF-2 OS=Chlamydia pneumoniae GN=infB PE=3 SV=2 | 610 | 1050 | 4.0E-27 |
| sp|Q0I3P5|IF2_HAES1 | Translation initiation factor IF-2 OS=Haemophilus somnus (strain 129Pt) GN=infB PE=3 SV=1 | 611 | 874 | 4.0E-27 |
| sp|Q6HF02|IF2_BACHK | Translation initiation factor IF-2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=infB PE=3 SV=1 | 611 | 1059 | 4.0E-27 |
| sp|Q636L3|IF2_BACCZ | Translation initiation factor IF-2 OS=Bacillus cereus (strain ZK / E33L) GN=infB PE=3 SV=1 | 611 | 1059 | 4.0E-27 |
| sp|C1EP35|IF2_BACC3 | Translation initiation factor IF-2 OS=Bacillus cereus (strain 03BB102) GN=infB PE=3 SV=1 | 611 | 1059 | 4.0E-27 |
| sp|A0RHI4|IF2_BACAH | Translation initiation factor IF-2 OS=Bacillus thuringiensis (strain Al Hakam) GN=infB PE=3 SV=2 | 611 | 1059 | 4.0E-27 |
| sp|B0UU13|IF2_HISS2 | Translation initiation factor IF-2 OS=Histophilus somni (strain 2336) GN=infB PE=3 SV=1 | 611 | 885 | 4.0E-27 |
| sp|Q5L627|IF2_CHLAB | Translation initiation factor IF-2 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=infB PE=3 SV=1 | 610 | 1049 | 4.0E-27 |
| sp|A0Q0Q7|IF2_CLONN | Translation initiation factor IF-2 OS=Clostridium novyi (strain NT) GN=infB PE=3 SV=1 | 611 | 1052 | 4.0E-27 |
| sp|Q04GN0|IF2_OENOB | Translation initiation factor IF-2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=infB PE=3 SV=1 | 611 | 1044 | 4.0E-27 |
| sp|Q7URR0|IF2_RHOBA | Translation initiation factor IF-2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=infB PE=3 SV=1 | 611 | 1053 | 4.0E-27 |
| sp|Q7MI09|IF2_VIBVY | Translation initiation factor IF-2 OS=Vibrio vulnificus (strain YJ016) GN=infB PE=3 SV=1 | 611 | 1110 | 4.0E-27 |
| sp|Q4L5X1|IF2_STAHJ | Translation initiation factor IF-2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=infB PE=3 SV=1 | 611 | 1048 | 4.0E-27 |
| sp|Q812X7|IF2_BACCR | Translation initiation factor IF-2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=infB PE=3 SV=1 | 611 | 1059 | 5.0E-27 |
| sp|B7HDT6|IF2_BACC4 | Translation initiation factor IF-2 OS=Bacillus cereus (strain B4264) GN=infB PE=3 SV=1 | 611 | 1059 | 5.0E-27 |
| sp|A8MFA8|IF2_ALKOO | Translation initiation factor IF-2 OS=Alkaliphilus oremlandii (strain OhILAs) GN=infB PE=3 SV=1 | 611 | 1044 | 5.0E-27 |
| sp|B0K9Q0|IF2_THEP3 | Translation initiation factor IF-2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=infB PE=3 SV=1 | 611 | 1065 | 5.0E-27 |
| sp|Q8R5Z1|IF2_FUSNN | Translation initiation factor IF-2 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=infB PE=3 SV=1 | 611 | 1127 | 6.0E-27 |
| sp|Q8DBW0|IF2_VIBVU | Translation initiation factor IF-2 OS=Vibrio vulnificus (strain CMCP6) GN=infB PE=3 SV=1 | 611 | 1110 | 6.0E-27 |
| sp|Q2J2J9|IF2_RHOP2 | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain HaA2) GN=infB PE=3 SV=1 | 611 | 1127 | 6.0E-27 |
| sp|Q482T9|IF2_COLP3 | Translation initiation factor IF-2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=infB PE=3 SV=1 | 599 | 1110 | 6.0E-27 |
| sp|Q8NWZ1|IF2_STAAW | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MW2) GN=infB PE=3 SV=1 | 611 | 1048 | 6.0E-27 |
| sp|Q6G9U4|IF2_STAAS | Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MSSA476) GN=infB PE=3 SV=1 | 611 | 1048 | 6.0E-27 |
| sp|B4SQS0|IF2_STRM5 | Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=infB PE=3 SV=1 | 611 | 1048 | 7.0E-27 |
| sp|A0LV27|IF2_ACIC1 | Translation initiation factor IF-2 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=infB PE=3 SV=1 | 611 | 1045 | 7.0E-27 |
| sp|B0BNR5|IF2_ACTPJ | Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=infB PE=3 SV=1 | 611 | 874 | 7.0E-27 |
| sp|A6T0Y8|IF2_JANMA | Translation initiation factor IF-2 OS=Janthinobacterium sp. (strain Marseille) GN=infB PE=3 SV=1 | 611 | 1110 | 7.0E-27 |
| sp|Q6NCN5|IF2_RHOPA | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=infB PE=3 SV=1 | 611 | 1127 | 7.0E-27 |
| sp|C5D9C9|IF2_GEOSW | Translation initiation factor IF-2 OS=Geobacillus sp. (strain WCH70) GN=infB PE=3 SV=1 | 611 | 1052 | 8.0E-27 |
| sp|Q13EL8|IF2_RHOPS | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB5) GN=infB PE=3 SV=1 | 611 | 1048 | 8.0E-27 |
| sp|B2FN90|IF2_STRMK | Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain K279a) GN=infB PE=3 SV=1 | 611 | 1048 | 8.0E-27 |
| sp|B2T381|IF2_BURPP | Translation initiation factor IF-2 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=infB PE=3 SV=1 | 611 | 1064 | 8.0E-27 |
| sp|A8G907|IF2_SERP5 | Translation initiation factor IF-2 OS=Serratia proteamaculans (strain 568) GN=infB PE=3 SV=1 | 611 | 1110 | 8.0E-27 |
| sp|A8AVQ2|IF2_STRGC | Translation initiation factor IF-2 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=infB PE=3 SV=1 | 606 | 1048 | 9.0E-27 |
| sp|Q8RA37|IF2_CALS4 | Translation initiation factor IF-2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=infB PE=3 SV=1 | 611 | 1065 | 9.0E-27 |
| sp|Q049V5|IF2_LACDB | Translation initiation factor IF-2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=infB PE=3 SV=1 | 610 | 1059 | 1.0E-26 |
| sp|Q1G9P9|IF2_LACDA | Translation initiation factor IF-2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=infB PE=3 SV=1 | 610 | 1059 | 1.0E-26 |
| sp|A9M9Z4|IF2_BRUC2 | Translation initiation factor IF-2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=infB PE=3 SV=1 | 611 | 1127 | 1.0E-26 |
| sp|Q8DK04|IF2_THEEB | Translation initiation factor IF-2 OS=Thermosynechococcus elongatus (strain BP-1) GN=infB PE=3 SV=1 | 611 | 781 | 1.0E-26 |
| sp|A6VNE0|IF2_ACTSZ | Translation initiation factor IF-2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=infB PE=3 SV=1 | 611 | 885 | 1.0E-26 |
| sp|P04766|IF2_GEOSE | Translation initiation factor IF-2 OS=Geobacillus stearothermophilus GN=infB PE=1 SV=1 | 611 | 1052 | 1.0E-26 |
| sp|Q8XZV6|IF2_RALSO | Translation initiation factor IF-2 OS=Ralstonia solanacearum (strain GMI1000) GN=infB PE=3 SV=1 | 611 | 1052 | 1.0E-26 |
| sp|Q07V78|IF2_RHOP5 | Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisA53) GN=infB PE=3 SV=1 | 611 | 1127 | 1.0E-26 |
| sp|B0S1E5|IF2_FINM2 | Translation initiation factor IF-2 OS=Finegoldia magna (strain ATCC 29328) GN=infB PE=3 SV=1 | 607 | 889 | 1.0E-26 |
| sp|Q8EQU1|IF2_OCEIH | Translation initiation factor IF-2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=infB PE=3 SV=1 | 611 | 1045 | 2.0E-26 |
| sp|B7IUH1|IF2_BACC2 | Translation initiation factor IF-2 OS=Bacillus cereus (strain G9842) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-26 |
| sp|Q3IJ53|IF2_PSEHT | Translation initiation factor IF-2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=infB PE=3 SV=1 | 606 | 1110 | 2.0E-26 |
| sp|Q81WM3|IF2_BACAN | Translation initiation factor IF-2 OS=Bacillus anthracis GN=infB PE=3 SV=1 | 611 | 1059 | 2.0E-26 |
| sp|C3L7B4|IF2_BACAC | Translation initiation factor IF-2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=infB PE=3 SV=1 | 611 | 1059 | 2.0E-26 |
| sp|C3P5L5|IF2_BACAA | Translation initiation factor IF-2 OS=Bacillus anthracis (strain A0248) GN=infB PE=3 SV=1 | 611 | 1059 | 2.0E-26 |
| sp|Q5L0I8|IF2_GEOKA | Translation initiation factor IF-2 OS=Geobacillus kaustophilus (strain HTA426) GN=infB PE=3 SV=1 | 611 | 1052 | 2.0E-26 |
| sp|Q97S57|IF2_STRPN | Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=infB PE=3 SV=1 | 606 | 1048 | 2.0E-26 |
| sp|B5E266|IF2_STRP4 | Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=infB PE=3 SV=1 | 606 | 1048 | 2.0E-26 |
| sp|Q8FXT2|IF2_BRUSU | Translation initiation factor IF-2 OS=Brucella suis biovar 1 (strain 1330) GN=infB PE=3 SV=1 | 611 | 1127 | 2.0E-26 |
| sp|Q9ZF25|IF2_ENTCL | Translation initiation factor IF-2 OS=Enterobacter cloacae GN=infB PE=3 SV=1 | 611 | 1052 | 2.0E-26 |
| sp|B0BB83|IF2_CHLTB | Translation initiation factor IF-2 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=infB PE=3 SV=1 | 610 | 1127 | 2.0E-26 |
| sp|B0B9K4|IF2_CHLT2 | Translation initiation factor IF-2 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=infB PE=3 SV=1 | 610 | 1127 | 2.0E-26 |
| sp|A7GRE3|IF2_BACCN | Translation initiation factor IF-2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=infB PE=3 SV=1 | 611 | 1044 | 2.0E-26 |
| sp|B1MZH4|IF2_LEUCK | Translation initiation factor IF-2 OS=Leuconostoc citreum (strain KM20) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-26 |
| sp|Q5ZRV4|IF2_LEGPH | Translation initiation factor IF-2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=infB PE=3 SV=1 | 601 | 1098 | 3.0E-26 |
| sp|A9VT50|IF2_BACWK | Translation initiation factor IF-2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-26 |
| sp|Q5YSC6|IF2_NOCFA | Translation initiation factor IF-2 OS=Nocardia farcinica (strain IFM 10152) GN=infB PE=3 SV=2 | 606 | 1048 | 3.0E-26 |
| sp|Q5X1C3|IF2_LEGPA | Translation initiation factor IF-2 OS=Legionella pneumophila (strain Paris) GN=infB PE=3 SV=1 | 601 | 1098 | 3.0E-26 |
| sp|Q8UJ51|IF2_AGRFC | Translation initiation factor IF-2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=infB PE=3 SV=1 | 611 | 1127 | 3.0E-26 |
| sp|Q03QT5|IF2_LACBA | Translation initiation factor IF-2 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=infB PE=3 SV=1 | 596 | 1048 | 3.0E-26 |
| sp|C5BFB7|IF2_EDWI9 | Translation initiation factor IF-2 OS=Edwardsiella ictaluri (strain 93-146) GN=infB PE=3 SV=1 | 611 | 1110 | 3.0E-26 |
| sp|A4XL70|IF2_CALS8 | Translation initiation factor IF-2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=infB PE=3 SV=1 | 611 | 1059 | 3.0E-26 |
| sp|Q8YQJ1|IF2_NOSS1 | Translation initiation factor IF-2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=infB PE=3 SV=1 | 611 | 1048 | 3.0E-26 |
| sp|B1ZDQ8|IF2_METPB | Translation initiation factor IF-2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=infB PE=3 SV=1 | 611 | 1052 | 3.0E-26 |
| sp|P75590|IF2_MYCPN | Translation initiation factor IF-2 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=infB PE=3 SV=1 | 611 | 1046 | 3.0E-26 |
| sp|O84098|IF2_CHLTR | Translation initiation factor IF-2 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=infB PE=3 SV=1 | 610 | 1127 | 3.0E-26 |
| sp|Q3KMS4|IF2_CHLTA | Translation initiation factor IF-2 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=infB PE=3 SV=1 | 610 | 1127 | 3.0E-26 |
| sp|A5N842|IF2_CLOK5 | Translation initiation factor IF-2 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=infB PE=3 SV=1 | 611 | 1045 | 3.0E-26 |
| sp|Q140U6|IF2_BURXL | Translation initiation factor IF-2 OS=Burkholderia xenovorans (strain LB400) GN=infB PE=3 SV=1 | 611 | 1070 | 4.0E-26 |
| sp|A9ITX6|IF2_BORPD | Translation initiation factor IF-2 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=infB PE=3 SV=1 | 611 | 1099 | 4.0E-26 |
| sp|B8EIA7|IF2_METSB | Translation initiation factor IF-2 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=infB PE=3 SV=1 | 611 | 1160 | 4.0E-26 |
| sp|Q895J8|IF2_CLOTE | Translation initiation factor IF-2 OS=Clostridium tetani (strain Massachusetts / E88) GN=infB PE=3 SV=1 | 546 | 1044 | 4.0E-26 |
| sp|A5IHU7|IF2_LEGPC | Translation initiation factor IF-2 OS=Legionella pneumophila (strain Corby) GN=infB PE=3 SV=1 | 601 | 1098 | 4.0E-26 |
| sp|C1CQ48|IF2_STRZT | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=infB PE=3 SV=1 | 606 | 1048 | 4.0E-26 |
| sp|C1C5S8|IF2_STRP7 | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain 70585) GN=infB PE=3 SV=1 | 606 | 1048 | 4.0E-26 |
| sp|A4SJR5|IF2_AERS4 | Translation initiation factor IF-2 OS=Aeromonas salmonicida (strain A449) GN=infB PE=3 SV=1 | 611 | 874 | 4.0E-26 |
| sp|C1CCT8|IF2_STRZJ | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain JJA) GN=infB PE=3 SV=1 | 606 | 1048 | 4.0E-26 |
| sp|Q8DQV2|IF2_STRR6 | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=infB PE=3 SV=1 | 606 | 1048 | 4.0E-26 |
| sp|Q04LW0|IF2_STRP2 | Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=infB PE=3 SV=1 | 606 | 1048 | 4.0E-26 |
| sp|Q5WT36|IF2_LEGPL | Translation initiation factor IF-2 OS=Legionella pneumophila (strain Lens) GN=infB PE=3 SV=1 | 601 | 1098 | 4.0E-26 |
| sp|B7GNA3|IF2_BIFLS | Translation initiation factor IF-2 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=infB PE=3 SV=1 | 611 | 1127 | 4.0E-26 |
| sp|B0TQA2|IF2_SHEHH | Translation initiation factor IF-2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=infB PE=3 SV=1 | 602 | 874 | 5.0E-26 |
| sp|Q3MBZ7|IF2_ANAVT | Translation initiation factor IF-2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=infB PE=3 SV=1 | 611 | 1048 | 5.0E-26 |
| sp|C5C9T1|IF2_MICLC | Translation initiation factor IF-2 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=infB PE=3 SV=1 | 611 | 741 | 5.0E-26 |
| sp|Q2KDZ5|IF2_RHIEC | Translation initiation factor IF-2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=infB PE=3 SV=1 | 611 | 1064 | 5.0E-26 |
| sp|B2IME4|IF2_STRPS | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain CGSP14) GN=infB PE=3 SV=1 | 606 | 1048 | 5.0E-26 |
| sp|B8ZM93|IF2_STRPJ | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=infB PE=3 SV=1 | 606 | 1048 | 5.0E-26 |
| sp|Q28WF7|IF2_JANSC | Translation initiation factor IF-2 OS=Jannaschia sp. (strain CCS1) GN=infB PE=3 SV=1 | 611 | 889 | 5.0E-26 |
| sp|Q4UWA2|IF2_XANC8 | Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=infB PE=3 SV=2 | 611 | 1048 | 6.0E-26 |
| sp|A3CQ18|IF2_STRSV | Translation initiation factor IF-2 OS=Streptococcus sanguinis (strain SK36) GN=infB PE=3 SV=1 | 606 | 1048 | 6.0E-26 |
| sp|A6TRK7|IF2_ALKMQ | Translation initiation factor IF-2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=infB PE=3 SV=1 | 611 | 878 | 6.0E-26 |
| sp|Q8DVP9|IF2_STRMU | Translation initiation factor IF-2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=infB PE=3 SV=1 | 611 | 1048 | 6.0E-26 |
| sp|B1IA80|IF2_STRPI | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=infB PE=3 SV=1 | 606 | 1048 | 6.0E-26 |
| sp|B0RRB4|IF2_XANCB | Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=infB PE=3 SV=1 | 611 | 1048 | 6.0E-26 |
| sp|Q8P7U7|IF2_XANCP | Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=infB PE=3 SV=1 | 611 | 1048 | 6.0E-26 |
| sp|Q6A7M5|IF2_PROAC | Translation initiation factor IF-2 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=infB PE=3 SV=1 | 611 | 1099 | 6.0E-26 |
| sp|B8DG02|IF2_LISMH | Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=infB PE=3 SV=1 | 611 | 1052 | 7.0E-26 |
| sp|B8GP02|IF2_THISH | Translation initiation factor IF-2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=infB PE=3 SV=1 | 611 | 1110 | 7.0E-26 |
| sp|Q5M1B9|IF2_STRT1 | Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=infB PE=3 SV=1 | 606 | 1048 | 7.0E-26 |
| sp|Q5M5V5|IF2_STRT2 | Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=infB PE=3 SV=1 | 606 | 1048 | 7.0E-26 |
| sp|C4L8X4|IF2_TOLAT | Translation initiation factor IF-2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=infB PE=3 SV=1 | 611 | 885 | 8.0E-26 |
| sp|A0AIC6|IF2_LISW6 | Translation initiation factor IF-2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=infB PE=3 SV=1 | 611 | 1052 | 8.0E-26 |
| sp|C1CJ39|IF2_STRZP | Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain P1031) GN=infB PE=3 SV=1 | 606 | 1048 | 8.0E-26 |
| sp|Q8G3Y5|IF2_BIFLO | Translation initiation factor IF-2 OS=Bifidobacterium longum (strain NCC 2705) GN=infB PE=3 SV=1 | 611 | 1127 | 8.0E-26 |
| sp|A0KNE3|IF2_AERHH | Translation initiation factor IF-2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=infB PE=3 SV=1 | 611 | 885 | 8.0E-26 |
| sp|P9WKK1|IF2_MYCTU | Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=infB PE=1 SV=1 | 610 | 765 | 8.0E-26 |
| sp|P9WKK0|IF2_MYCTO | Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=infB PE=3 SV=1 | 610 | 765 | 8.0E-26 |
| sp|A5U6J1|IF2_MYCTA | Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=infB PE=3 SV=1 | 610 | 765 | 8.0E-26 |
| sp|C1AFV3|IF2_MYCBT | Translation initiation factor IF-2 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=infB PE=3 SV=1 | 610 | 765 | 8.0E-26 |
| sp|A1KMI2|IF2_MYCBP | Translation initiation factor IF-2 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=infB PE=3 SV=1 | 610 | 765 | 8.0E-26 |
| sp|P65132|IF2_MYCBO | Translation initiation factor IF-2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=infB PE=3 SV=1 | 610 | 765 | 8.0E-26 |
| sp|B9JYK6|IF2_AGRVS | Translation initiation factor IF-2 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=infB PE=3 SV=1 | 611 | 1127 | 9.0E-26 |
| sp|Q03M88|IF2_STRTD | Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=infB PE=3 SV=1 | 606 | 1048 | 9.0E-26 |
| sp|Q1QSZ0|IF2_CHRSD | Translation initiation factor IF-2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=infB PE=3 SV=1 | 611 | 1048 | 9.0E-26 |
| sp|B8JFY6|IF2_ANAD2 | Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=infB PE=3 SV=1 | 610 | 1048 | 1.0E-25 |
| sp|A0PQC4|IF2_MYCUA | Translation initiation factor IF-2 OS=Mycobacterium ulcerans (strain Agy99) GN=infB PE=3 SV=1 | 611 | 741 | 1.0E-25 |
| sp|B3DQF0|IF2_BIFLD | Translation initiation factor IF-2 OS=Bifidobacterium longum (strain DJO10A) GN=infB PE=3 SV=1 | 611 | 1127 | 1.0E-25 |
| sp|B2HKS2|IF2_MYCMM | Translation initiation factor IF-2 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=infB PE=3 SV=1 | 611 | 741 | 1.0E-25 |
| sp|Q5GXU9|IF2_XANOR | Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=infB PE=3 SV=2 | 611 | 1048 | 1.0E-25 |
| sp|Q2P0X1|IF2_XANOM | Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-25 |
| sp|B2SVK3|IF2_XANOP | Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-25 |
| sp|Q8CJQ8|IF2_STRCO | Translation initiation factor IF-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=infB PE=3 SV=1 | 610 | 886 | 1.0E-25 |
| sp|Q92C29|IF2_LISIN | Translation initiation factor IF-2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=infB PE=3 SV=1 | 611 | 1052 | 1.0E-25 |
| sp|A4VPP0|IF2_PSEU5 | Translation initiation factor IF-2 OS=Pseudomonas stutzeri (strain A1501) GN=infB PE=3 SV=1 | 611 | 893 | 1.0E-25 |
| sp|B4SCE7|IF2_PELPB | Translation initiation factor IF-2 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-25 |
| sp|Q82WD0|IF2_NITEU | Translation initiation factor IF-2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-25 |
| sp|A6L030|IF2_BACV8 | Translation initiation factor IF-2 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=infB PE=3 SV=1 | 606 | 1044 | 1.0E-25 |
| sp|Q5PAJ5|IF2_ANAMM | Translation initiation factor IF-2 OS=Anaplasma marginale (strain St. Maries) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-25 |
| sp|Q2IPZ7|IF2_ANADE | Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=infB PE=3 SV=1 | 610 | 1048 | 1.0E-25 |
| sp|B1MD87|IF2_MYCA9 | Translation initiation factor IF-2 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=infB PE=3 SV=1 | 606 | 741 | 1.0E-25 |
| sp|B8DW43|IF2_BIFA0 | Translation initiation factor IF-2 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=infB PE=3 SV=1 | 611 | 1108 | 1.0E-25 |
| sp|Q8Y7F6|IF2_LISMO | Translation initiation factor IF-2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=infB PE=3 SV=1 | 611 | 1052 | 1.0E-25 |
| sp|Q9PGR3|IF2_XYLFA | Translation initiation factor IF-2 OS=Xylella fastidiosa (strain 9a5c) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-25 |
| sp|A7GG06|IF2_CLOBL | Translation initiation factor IF-2 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=infB PE=3 SV=1 | 611 | 1044 | 1.0E-25 |
| sp|Q18BH4|IF2_PEPD6 | Translation initiation factor IF-2 OS=Peptoclostridium difficile (strain 630) GN=infB PE=3 SV=1 | 611 | 788 | 1.0E-25 |
| sp|B3PXE3|IF2_RHIE6 | Translation initiation factor IF-2 OS=Rhizobium etli (strain CIAT 652) GN=infB PE=3 SV=1 | 611 | 1064 | 1.0E-25 |
| sp|P47388|IF2_MYCGE | Translation initiation factor IF-2 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=infB PE=3 SV=1 | 600 | 1046 | 1.0E-25 |
| sp|Q30WJ0|IF2_DESAG | Translation initiation factor IF-2 OS=Desulfovibrio alaskensis (strain G20) GN=infB PE=3 SV=1 | 611 | 1046 | 2.0E-25 |
| sp|A4SY78|IF2_POLSQ | Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-25 |
| sp|Q8E1H3|IF2_STRA5 | Translation initiation factor IF-2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=infB PE=3 SV=1 | 606 | 1048 | 2.0E-25 |
| sp|O78489|IF2C_GUITH | Translation initiation factor IF-2, chloroplastic OS=Guillardia theta GN=infB PE=3 SV=1 | 611 | 741 | 2.0E-25 |
| sp|B2GKR5|IF2_KOCRD | Translation initiation factor IF-2 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=infB PE=3 SV=1 | 599 | 750 | 2.0E-25 |
| sp|Q71ZZ7|IF2_LISMF | Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=infB PE=3 SV=1 | 611 | 1052 | 2.0E-25 |
| sp|C1L2N1|IF2_LISMC | Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=infB PE=3 SV=1 | 611 | 1052 | 2.0E-25 |
| sp|Q0SSD4|IF2_CLOPS | Translation initiation factor IF-2 OS=Clostridium perfringens (strain SM101 / Type A) GN=infB PE=3 SV=1 | 611 | 886 | 2.0E-25 |
| sp|Q7VQM3|IF2_BLOFL | Translation initiation factor IF-2 OS=Blochmannia floridanus GN=infB PE=3 SV=1 | 611 | 873 | 2.0E-25 |
| sp|Q8XJR8|IF2_CLOPE | Translation initiation factor IF-2 OS=Clostridium perfringens (strain 13 / Type A) GN=infB PE=3 SV=1 | 611 | 886 | 2.0E-25 |
| sp|Q0TPR7|IF2_CLOP1 | Translation initiation factor IF-2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=infB PE=3 SV=1 | 611 | 886 | 2.0E-25 |
| sp|Q3BRP5|IF2_XANC5 | Translation initiation factor IF-2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-25 |
| sp|P0A3K7|IF2_STRAG | Translation initiation factor IF-2 OS=Streptococcus agalactiae GN=infB PE=3 SV=1 | 606 | 1048 | 2.0E-25 |
| sp|P0A3K6|IF2_STRA3 | Translation initiation factor IF-2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=infB PE=3 SV=1 | 606 | 1048 | 2.0E-25 |
| sp|Q3K302|IF2_STRA1 | Translation initiation factor IF-2 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=infB PE=3 SV=1 | 606 | 1048 | 2.0E-25 |
| sp|Q8PJ55|IF2_XANAC | Translation initiation factor IF-2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-25 |
| sp|Q3AQK7|IF2_CHLCH | Translation initiation factor IF-2 OS=Chlorobium chlorochromatii (strain CaD3) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-25 |
| sp|B4UHG0|IF2_ANASK | Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain K) GN=infB PE=3 SV=1 | 610 | 1048 | 2.0E-25 |
| sp|A1ST45|IF2_PSYIN | Translation initiation factor IF-2 OS=Psychromonas ingrahamii (strain 37) GN=infB PE=3 SV=1 | 611 | 1057 | 3.0E-25 |
| sp|Q0AFJ3|IF2_NITEC | Translation initiation factor IF-2 OS=Nitrosomonas eutropha (strain C91) GN=infB PE=3 SV=1 | 611 | 1108 | 3.0E-25 |
| sp|A3QGU5|IF2_SHELP | Translation initiation factor IF-2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=infB PE=3 SV=1 | 611 | 885 | 3.0E-25 |
| sp|Q73FL0|IF2_WOLPM | Translation initiation factor IF-2 OS=Wolbachia pipientis wMel GN=infB PE=3 SV=1 | 613 | 1108 | 3.0E-25 |
| sp|A6VCK1|IF2_PSEA7 | Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain PA7) GN=infB PE=3 SV=1 | 611 | 893 | 4.0E-25 |
| sp|B2IIJ7|IF2_BEII9 | Translation initiation factor IF-2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=infB PE=3 SV=1 | 611 | 1048 | 4.0E-25 |
| sp|Q64ZR4|IF2_BACFR | Translation initiation factor IF-2 OS=Bacteroides fragilis (strain YCH46) GN=infB PE=3 SV=1 | 611 | 1044 | 4.0E-25 |
| sp|Q5LIN1|IF2_BACFN | Translation initiation factor IF-2 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=infB PE=3 SV=1 | 611 | 1044 | 4.0E-25 |
| sp|B1XV89|IF2_POLNS | Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=infB PE=3 SV=1 | 611 | 1048 | 4.0E-25 |
| sp|Q02FS8|IF2_PSEAB | Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=infB PE=3 SV=1 | 611 | 893 | 4.0E-25 |
| sp|B7V1F6|IF2_PSEA8 | Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain LESB58) GN=infB PE=3 SV=1 | 611 | 893 | 4.0E-25 |
| sp|Q03WH4|IF2_LEUMM | Translation initiation factor IF-2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=infB PE=3 SV=1 | 611 | 1048 | 4.0E-25 |
| sp|Q39VA6|IF2_GEOMG | Translation initiation factor IF-2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=infB PE=3 SV=1 | 611 | 1044 | 4.0E-25 |
| sp|Q9HV55|IF2_PSEAE | Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=infB PE=3 SV=1 | 611 | 893 | 5.0E-25 |
| sp|A8H740|IF2_SHEPA | Translation initiation factor IF-2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=infB PE=3 SV=1 | 602 | 874 | 5.0E-25 |
| sp|A1K7B9|IF2_AZOSB | Translation initiation factor IF-2 OS=Azoarcus sp. (strain BH72) GN=infB PE=3 SV=1 | 611 | 1108 | 5.0E-25 |
| sp|B0U1Q8|IF2_XYLFM | Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M12) GN=infB PE=3 SV=1 | 611 | 1048 | 5.0E-25 |
| sp|C1B313|IF2_RHOOB | Translation initiation factor IF-2 OS=Rhodococcus opacus (strain B4) GN=infB PE=3 SV=1 | 611 | 1048 | 5.0E-25 |
| sp|A8EWD7|IF2_ARCB4 | Translation initiation factor IF-2 OS=Arcobacter butzleri (strain RM4018) GN=infB PE=3 SV=1 | 611 | 923 | 5.0E-25 |
| sp|Q24UI6|IF2_DESHY | Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 | 611 | 1052 | 5.0E-25 |
| sp|Q47D94|IF2_DECAR | Translation initiation factor IF-2 OS=Dechloromonas aromatica (strain RCB) GN=infB PE=3 SV=1 | 611 | 1110 | 5.0E-25 |
| sp|C5BWS3|IF2_BEUC1 | Translation initiation factor IF-2 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=infB PE=3 SV=1 | 599 | 1044 | 6.0E-25 |
| sp|Q1LSK8|IF2_BAUCH | Translation initiation factor IF-2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=infB PE=3 SV=1 | 611 | 1084 | 6.0E-25 |
| sp|Q8A2A1|IF2_BACTN | Translation initiation factor IF-2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=infB PE=3 SV=1 | 611 | 1044 | 6.0E-25 |
| sp|B0SQH4|IF2_LEPBP | Translation initiation factor IF-2 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=infB PE=3 SV=1 | 611 | 740 | 6.0E-25 |
| sp|B0SH18|IF2_LEPBA | Translation initiation factor IF-2 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=infB PE=3 SV=1 | 611 | 740 | 6.0E-25 |
| sp|Q89AF5|IF2_BUCBP | Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=infB PE=3 SV=1 | 611 | 1048 | 6.0E-25 |
| sp|Q5NQ27|IF2_ZYMMO | Translation initiation factor IF-2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=infB PE=3 SV=1 | 611 | 1052 | 6.0E-25 |
| sp|Q9Z5I9|IF2_MYCLE | Translation initiation factor IF-2 OS=Mycobacterium leprae (strain TN) GN=infB PE=3 SV=1 | 610 | 870 | 6.0E-25 |
| sp|B8ZRT4|IF2_MYCLB | Translation initiation factor IF-2 OS=Mycobacterium leprae (strain Br4923) GN=infB PE=3 SV=1 | 610 | 870 | 6.0E-25 |
| sp|Q8F7K1|IF2_LEPIN | Translation initiation factor IF-2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=infB PE=3 SV=2 | 606 | 1048 | 6.0E-25 |
| sp|Q1IZ02|IF2_DEIGD | Translation initiation factor IF-2 OS=Deinococcus geothermalis (strain DSM 11300) GN=infB PE=3 SV=1 | 611 | 871 | 6.0E-25 |
| sp|A7NID1|IF2_ROSCS | Translation initiation factor IF-2 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=infB PE=3 SV=1 | 601 | 1046 | 6.0E-25 |
| sp|Q72NX3|IF2_LEPIC | Translation initiation factor IF-2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=infB PE=3 SV=2 | 606 | 1048 | 6.0E-25 |
| sp|Q87EV4|IF2_XYLFT | Translation initiation factor IF-2 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=infB PE=3 SV=1 | 611 | 1048 | 6.0E-25 |
| sp|B2I726|IF2_XYLF2 | Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M23) GN=infB PE=3 SV=1 | 611 | 1048 | 6.0E-25 |
| sp|Q2S1N7|IF2_SALRD | Translation initiation factor IF-2 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=infB PE=3 SV=1 | 611 | 1044 | 7.0E-25 |
| sp|Q88VK7|IF2_LACPL | Translation initiation factor IF-2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=infB PE=3 SV=1 | 606 | 1048 | 7.0E-25 |
| sp|A8FYS0|IF2_SHESH | Translation initiation factor IF-2 OS=Shewanella sediminis (strain HAW-EB3) GN=infB PE=3 SV=1 | 611 | 874 | 7.0E-25 |
| sp|Q1MN39|IF2_RHIL3 | Translation initiation factor IF-2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=infB PE=3 SV=1 | 611 | 887 | 8.0E-25 |
| sp|Q82K53|IF2_STRAW | Translation initiation factor IF-2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=infB PE=3 SV=1 | 611 | 740 | 8.0E-25 |
| sp|B1VYN5|IF2_STRGG | Translation initiation factor IF-2 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=infB PE=3 SV=1 | 611 | 1052 | 8.0E-25 |
| sp|A1RGX5|IF2_SHESW | Translation initiation factor IF-2 OS=Shewanella sp. (strain W3-18-1) GN=infB PE=3 SV=1 | 611 | 874 | 9.0E-25 |
| sp|A4Y9C0|IF2_SHEPC | Translation initiation factor IF-2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=infB PE=3 SV=1 | 611 | 874 | 9.0E-25 |
| sp|Q1WUF4|IF2_LACS1 | Translation initiation factor IF-2 OS=Lactobacillus salivarius (strain UCC118) GN=infB PE=3 SV=1 | 611 | 1048 | 9.0E-25 |
| sp|A2SH40|IF2_METPP | Translation initiation factor IF-2 OS=Methylibium petroleiphilum (strain PM1) GN=infB PE=3 SV=1 | 611 | 1048 | 9.0E-25 |
| sp|Q15V72|IF2_PSEA6 | Translation initiation factor IF-2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=infB PE=3 SV=1 | 611 | 1110 | 9.0E-25 |
| sp|Q83HG7|IF2_TROW8 | Translation initiation factor IF-2 OS=Tropheryma whipplei (strain TW08/27) GN=infB PE=3 SV=1 | 602 | 886 | 1.0E-24 |
| sp|Q04U31|IF2_LEPBJ | Translation initiation factor IF-2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-24 |
| sp|Q83GT8|IF2_TROWT | Translation initiation factor IF-2 OS=Tropheryma whipplei (strain Twist) GN=infB PE=3 SV=1 | 602 | 886 | 1.0E-24 |
| sp|A5FV21|IF2_ACICJ | Translation initiation factor IF-2 OS=Acidiphilium cryptum (strain JF-5) GN=infB PE=3 SV=1 | 610 | 741 | 1.0E-24 |
| sp|A1BDF1|IF2_CHLPD | Translation initiation factor IF-2 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=infB PE=3 SV=1 | 610 | 1048 | 1.0E-24 |
| sp|Q0S219|IF2_RHOJR | Translation initiation factor IF-2 OS=Rhodococcus jostii (strain RHA1) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-24 |
| sp|Q97I51|IF2_CLOAB | Translation initiation factor IF-2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-24 |
| sp|B8CKH3|IF2_SHEPW | Translation initiation factor IF-2 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=infB PE=3 SV=1 | 602 | 874 | 1.0E-24 |
| sp|Q04ZJ5|IF2_LEPBL | Translation initiation factor IF-2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=infB PE=3 SV=1 | 611 | 1048 | 1.0E-24 |
| sp|A6W7Z2|IF2_KINRD | Translation initiation factor IF-2 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=infB PE=3 SV=1 | 599 | 918 | 1.0E-24 |
| sp|Q73VV4|IF2_MYCPA | Translation initiation factor IF-2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=infB PE=3 SV=1 | 611 | 785 | 1.0E-24 |
| sp|A8L6F4|IF2_FRASN | Translation initiation factor IF-2 OS=Frankia sp. (strain EAN1pec) GN=infB PE=3 SV=1 | 611 | 886 | 1.0E-24 |
| sp|Q65SK9|IF2_MANSM | Translation initiation factor IF-2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=infB PE=3 SV=1 | 611 | 874 | 1.0E-24 |
| sp|A8LQ56|IF2_DINSH | Translation initiation factor IF-2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=infB PE=3 SV=1 | 611 | 892 | 2.0E-24 |
| sp|A7HZ93|IF2_PARL1 | Translation initiation factor IF-2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=infB PE=3 SV=1 | 611 | 1127 | 2.0E-24 |
| sp|A4VXH3|IF2_STRSY | Translation initiation factor IF-2 OS=Streptococcus suis (strain 05ZYH33) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-24 |
| sp|A4W3R7|IF2_STRS2 | Translation initiation factor IF-2 OS=Streptococcus suis (strain 98HAH33) GN=infB PE=3 SV=1 | 611 | 1048 | 2.0E-24 |
| sp|C3PH19|IF2_CORA7 | Translation initiation factor IF-2 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=infB PE=3 SV=1 | 611 | 886 | 2.0E-24 |
| sp|Q086H2|IF2_SHEFN | Translation initiation factor IF-2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=infB PE=3 SV=1 | 611 | 874 | 2.0E-24 |
| sp|A9KZX1|IF2_SHEB9 | Translation initiation factor IF-2 OS=Shewanella baltica (strain OS195) GN=infB PE=3 SV=1 | 607 | 874 | 2.0E-24 |
| sp|A6WRG8|IF2_SHEB8 | Translation initiation factor IF-2 OS=Shewanella baltica (strain OS185) GN=infB PE=3 SV=1 | 607 | 874 | 2.0E-24 |
| sp|A3D7K6|IF2_SHEB5 | Translation initiation factor IF-2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=infB PE=3 SV=1 | 607 | 874 | 2.0E-24 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005525 | GTP binding | Yes |
| GO:0003924 | GTPase activity | Yes |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0032561 | guanyl ribonucleotide binding | No |
| GO:0036094 | small molecule binding | No |
| GO:0019001 | guanyl nucleotide binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:0016462 | pyrophosphatase activity | No |
| GO:0043168 | anion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0003674 | molecular_function | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| GO:0000166 | nucleotide binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 60 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|076610 MPPKNKGKKGKKNDDDYWANAGETVDPIESAPASIPDDDIGPSTKPKSVFSAFSSLADTEDVGAFDEEDEGGGGL MSLLKANNKKKEKKEKKKFKAHAVDLPVDDIPEEGDNPPAAKQAVEVTAEDLADEEWGPVTEKKKGKKSKKKGKA AEDQDEETPPKTEATKEEAIVSEPAAASTKEVPENEDENTLDSGAKILSKKEKEKLKKEREKAKKKAQAAAKKAA AADEPPDSQVPAAETPVATKNDGNDEGNDDDDGEEAATGTTSKDKKKKKKKPKKDEEVPVPAAGKKKTTGISALK AMMDEKKRIEEEARRREEEERKRIEEEERQAEEEARKKEEEKQRKKEKEKAKRELAKKEGRLLTKKQKEERQMAE RRKEALLASGVYIEGLQQPSGGGAPKKPVYGNKKKKPLKTSSPAADSRPRSPAHIPEPDTQETPKVEVVDDVKSD WENSADEQKSISGTQPESQSEVKDTWDASSDEEKEASASKHTADAGPSEKAKPTVNGEPTAKTTPTQKNAKEIKA KETKVKETKAKMTSPEPSKTEETSSESEDESDSTEDSSSEEDSTESSDEELTAVQRLAAQKKAEATERRAKAHEA ALAARNKDDLRSPICCILGHVDTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVEAIKEKTAVMNKDGSQEYK IPGLLIIDTPGHESFTNLRSRGSSLCNIAILVVDIMHGLEAQTLESLRLLRDRKTPFIVALNKIDRMYDWEATPD NAFRDSLAKQKRQVQREFEDRVAKTILAFAEEGLNACLYYENKNFARNVSLVPTSAVTGEGVPDMINLLVNLTQQ RMSDRLMYLAELECTVLEVKVIEGLGTTIDIVLSNGILREGERIVVCGLNGPIVTQVRALLTPQPLRELRIKSAY VHHKQVKAALGVKLVAPDLDKAIAGSRLLVVGPDDDEDDLKEEVMSDLTSLLNSIDKSGRGVCVQASTLGSLEAL LDFLKASKIPVSGINIGPVHKRDVMRASPMLEKAKELACILCFDVTVDRDADRMAEEMGIRLFKADIIYHLFDAF TAYNQEIVEAKRRDAAPQAVWPCRLKIIATFCKRDPIIVGVDILDGTLRVGTPLAVVKINPTNGQKEIIDLGKIT SLEINHKNHELIKKSQAGGGVAVKIEHAVYQSAKMFGRHFDEKDELLSHVTRQSIDVLKDTFRKDATSEDWLLIR ALKQRFGIP* |
| Coding | >AgabiH97|076610 ATGCCACCCAAAAACAAGGGAAAGAAAGGGAAGAAGAATGACGATGATTACTGGGCAAACGCAGGCGAAACTGTG GATCCCATCGAATCTGCCCCGGCCAGCATACCTGATGATGATATTGGCCCTTCAACAAAGCCCAAAAGCGTGTTT TCTGCATTTTCATCGCTTGCTGATACCGAGGATGTTGGAGCTTTTGATGAAGAAGATGAGGGGGGTGGTGGACTG ATGTCACTGCTGAAGGCAAACAATAAAAAGAAGGAGAAGAAAGAAAAGAAGAAGTTCAAAGCGCATGCTGTGGAT CTTCCTGTCGATGATATACCGGAGGAAGGAGACAACCCTCCTGCCGCAAAGCAAGCCGTAGAAGTCACCGCAGAA GACCTTGCTGATGAGGAGTGGGGTCCGGTGACAGAAAAGAAGAAAGGCAAAAAGTCTAAGAAGAAAGGTAAGGCG GCGGAAGATCAGGACGAAGAAACCCCGCCAAAGACAGAAGCGACGAAAGAAGAGGCTATAGTTTCGGAGCCAGCA GCAGCCTCCACGAAGGAAGTGCCCGAGAATGAGGACGAAAATACTCTAGATTCTGGTGCTAAGATCCTTTCTAAG AAGGAAAAGGAGAAACTCAAGAAAGAACGAGAAAAGGCTAAGAAGAAGGCACAGGCTGCAGCAAAGAAAGCCGCA GCAGCCGATGAGCCGCCCGATTCGCAAGTGCCGGCAGCAGAGACACCTGTGGCTACAAAAAATGATGGGAACGAC GAAGGTAATGATGATGATGATGGTGAAGAGGCGGCGACAGGTACTACATCGAAAGACAAGAAGAAGAAGAAGAAA AAGCCCAAGAAGGATGAGGAGGTACCTGTACCTGCAGCCGGAAAGAAGAAGACTACTGGTATAAGTGCATTAAAA GCAATGATGGACGAGAAAAAACGTATAGAGGAAGAAGCCCGGCGTCGGGAGGAAGAGGAGCGCAAGCGAATTGAG GAAGAGGAGAGGCAGGCCGAGGAAGAGGCACGGAAAAAGGAAGAAGAGAAACAACGTAAAAAAGAAAAAGAAAAG GCCAAGCGCGAACTGGCGAAGAAAGAGGGGCGCCTTCTCACAAAGAAACAGAAAGAGGAACGGCAAATGGCTGAG AGACGCAAGGAGGCTCTTTTGGCCTCGGGGGTTTACATCGAGGGTTTGCAGCAACCATCTGGTGGTGGCGCACCC AAGAAACCAGTATATGGTAACAAGAAAAAGAAGCCGCTGAAAACATCATCTCCTGCAGCGGACTCACGGCCGCGA TCTCCTGCGCATATCCCTGAGCCTGACACTCAGGAAACACCCAAAGTTGAAGTTGTGGATGATGTGAAATCCGAT TGGGAGAATAGCGCTGACGAACAAAAGAGCATTTCAGGGACGCAGCCAGAGTCTCAGTCAGAGGTGAAGGATACC TGGGATGCCTCGAGTGATGAGGAGAAGGAAGCTTCTGCATCAAAACATACTGCGGATGCTGGACCGTCTGAAAAA GCTAAACCAACTGTCAATGGCGAGCCAACGGCCAAGACAACCCCGACTCAGAAAAATGCCAAAGAAATAAAGGCC AAAGAAACAAAGGTCAAGGAAACGAAGGCGAAAATGACTTCACCAGAACCCTCGAAAACTGAAGAGACCTCATCT GAATCTGAGGATGAATCGGATTCAACGGAAGACTCGAGTTCTGAAGAGGATTCTACAGAATCCTCAGATGAAGAA CTCACTGCTGTCCAGAGATTAGCTGCTCAGAAAAAGGCAGAAGCTACAGAGCGGCGTGCTAAAGCTCACGAAGCT GCCCTTGCAGCTCGTAACAAAGATGATCTCCGCAGTCCAATTTGCTGCATTCTTGGGCACGTCGACACCGGGAAA ACAAAGCTTTTGGATAAGATTCGTCAAACCAACGTCCAAGAAGGTGAAGCAGGAGGTATCACACAACAGATCGGT GCAACATACTTCCCTGTCGAAGCCATCAAAGAGAAAACGGCGGTCATGAACAAGGATGGTTCCCAAGAGTATAAA ATTCCTGGTCTGCTCATCATTGATACACCCGGACACGAATCCTTCACAAATTTACGTTCCCGCGGAAGTTCTTTA TGCAACATTGCCATTCTCGTTGTAGATATCATGCATGGCCTTGAAGCACAGACCCTAGAGTCCTTGCGGTTATTG CGTGATCGCAAAACCCCATTCATAGTAGCCTTAAATAAGATCGATCGTATGTACGACTGGGAGGCGACACCTGAC AATGCGTTCCGCGATTCACTCGCCAAACAAAAACGGCAAGTTCAAAGAGAATTTGAGGATCGAGTAGCAAAAACG ATTTTAGCTTTCGCAGAAGAGGGTCTTAACGCTTGCCTCTACTATGAGAACAAGAATTTCGCTCGCAACGTGTCC CTTGTTCCAACTTCTGCCGTCACGGGAGAGGGTGTTCCAGACATGATCAACCTACTCGTCAACCTCACTCAACAA CGCATGAGCGATCGACTCATGTACCTCGCAGAGTTGGAGTGTACTGTGCTTGAAGTCAAAGTCATTGAAGGTTTG GGTACTACAATTGACATAGTATTATCGAATGGTATCCTTCGTGAGGGAGAAAGGATCGTGGTTTGTGGTCTTAAC GGGCCAATCGTCACCCAGGTCAGAGCTTTGCTCACGCCGCAACCTCTAAGGGAGCTTCGTATCAAGTCTGCTTAT GTCCATCACAAACAAGTGAAGGCGGCTTTGGGTGTCAAGCTAGTGGCGCCCGATCTCGACAAAGCTATTGCCGGA TCGCGGTTACTCGTCGTTGGACCCGATGATGACGAAGATGATTTGAAAGAGGAAGTGATGTCTGATCTGACATCA CTGCTCAACAGCATCGATAAGTCAGGTCGTGGTGTCTGCGTTCAGGCATCTACTCTAGGTTCTTTAGAGGCCCTC CTAGATTTCCTGAAAGCCAGTAAAATTCCAGTTTCTGGTATCAACATTGGCCCAGTACATAAGCGTGATGTCATG CGTGCTTCGCCGATGTTGGAAAAGGCCAAAGAACTCGCGTGTATCCTCTGTTTCGATGTCACCGTCGACAGGGAT GCCGACAGAATGGCAGAGGAAATGGGCATCCGTTTATTCAAAGCGGATATCATATATCACTTGTTCGATGCCTTT ACCGCATACAATCAAGAAATAGTTGAAGCTAAGCGACGAGATGCTGCCCCCCAGGCTGTATGGCCTTGCCGACTG AAGATTATTGCAACGTTCTGTAAGCGAGATCCCATCATCGTCGGTGTTGATATTCTCGACGGTACTTTACGCGTC GGTACACCTTTGGCGGTGGTCAAAATCAATCCAACAAATGGACAAAAGGAGATTATAGACCTTGGAAAAATCACG TCCCTCGAAATCAACCACAAGAACCACGAGTTGATCAAGAAGTCCCAAGCTGGTGGAGGTGTTGCTGTCAAAATC GAGCATGCGGTCTACCAATCAGCAAAAATGTTCGGCCGCCACTTCGATGAAAAAGATGAACTACTGAGTCATGTC ACGCGCCAGAGTATCGACGTTTTAAAGGACACTTTCAGGAAAGATGCCACCAGTGAAGATTGGCTACTTATTCGT GCCCTCAAGCAGCGCTTTGGAATCCCCTGA |
| Transcript | >AgabiH97|076610 ATGCCACCCAAAAACAAGGGAAAGAAAGGGAAGAAGAATGACGATGATTACTGGGCAAACGCAGGCGAAACTGTG GATCCCATCGAATCTGCCCCGGCCAGCATACCTGATGATGATATTGGCCCTTCAACAAAGCCCAAAAGCGTGTTT TCTGCATTTTCATCGCTTGCTGATACCGAGGATGTTGGAGCTTTTGATGAAGAAGATGAGGGGGGTGGTGGACTG ATGTCACTGCTGAAGGCAAACAATAAAAAGAAGGAGAAGAAAGAAAAGAAGAAGTTCAAAGCGCATGCTGTGGAT CTTCCTGTCGATGATATACCGGAGGAAGGAGACAACCCTCCTGCCGCAAAGCAAGCCGTAGAAGTCACCGCAGAA GACCTTGCTGATGAGGAGTGGGGTCCGGTGACAGAAAAGAAGAAAGGCAAAAAGTCTAAGAAGAAAGGTAAGGCG GCGGAAGATCAGGACGAAGAAACCCCGCCAAAGACAGAAGCGACGAAAGAAGAGGCTATAGTTTCGGAGCCAGCA GCAGCCTCCACGAAGGAAGTGCCCGAGAATGAGGACGAAAATACTCTAGATTCTGGTGCTAAGATCCTTTCTAAG AAGGAAAAGGAGAAACTCAAGAAAGAACGAGAAAAGGCTAAGAAGAAGGCACAGGCTGCAGCAAAGAAAGCCGCA GCAGCCGATGAGCCGCCCGATTCGCAAGTGCCGGCAGCAGAGACACCTGTGGCTACAAAAAATGATGGGAACGAC GAAGGTAATGATGATGATGATGGTGAAGAGGCGGCGACAGGTACTACATCGAAAGACAAGAAGAAGAAGAAGAAA AAGCCCAAGAAGGATGAGGAGGTACCTGTACCTGCAGCCGGAAAGAAGAAGACTACTGGTATAAGTGCATTAAAA GCAATGATGGACGAGAAAAAACGTATAGAGGAAGAAGCCCGGCGTCGGGAGGAAGAGGAGCGCAAGCGAATTGAG GAAGAGGAGAGGCAGGCCGAGGAAGAGGCACGGAAAAAGGAAGAAGAGAAACAACGTAAAAAAGAAAAAGAAAAG GCCAAGCGCGAACTGGCGAAGAAAGAGGGGCGCCTTCTCACAAAGAAACAGAAAGAGGAACGGCAAATGGCTGAG AGACGCAAGGAGGCTCTTTTGGCCTCGGGGGTTTACATCGAGGGTTTGCAGCAACCATCTGGTGGTGGCGCACCC AAGAAACCAGTATATGGTAACAAGAAAAAGAAGCCGCTGAAAACATCATCTCCTGCAGCGGACTCACGGCCGCGA TCTCCTGCGCATATCCCTGAGCCTGACACTCAGGAAACACCCAAAGTTGAAGTTGTGGATGATGTGAAATCCGAT TGGGAGAATAGCGCTGACGAACAAAAGAGCATTTCAGGGACGCAGCCAGAGTCTCAGTCAGAGGTGAAGGATACC TGGGATGCCTCGAGTGATGAGGAGAAGGAAGCTTCTGCATCAAAACATACTGCGGATGCTGGACCGTCTGAAAAA GCTAAACCAACTGTCAATGGCGAGCCAACGGCCAAGACAACCCCGACTCAGAAAAATGCCAAAGAAATAAAGGCC AAAGAAACAAAGGTCAAGGAAACGAAGGCGAAAATGACTTCACCAGAACCCTCGAAAACTGAAGAGACCTCATCT GAATCTGAGGATGAATCGGATTCAACGGAAGACTCGAGTTCTGAAGAGGATTCTACAGAATCCTCAGATGAAGAA CTCACTGCTGTCCAGAGATTAGCTGCTCAGAAAAAGGCAGAAGCTACAGAGCGGCGTGCTAAAGCTCACGAAGCT GCCCTTGCAGCTCGTAACAAAGATGATCTCCGCAGTCCAATTTGCTGCATTCTTGGGCACGTCGACACCGGGAAA ACAAAGCTTTTGGATAAGATTCGTCAAACCAACGTCCAAGAAGGTGAAGCAGGAGGTATCACACAACAGATCGGT GCAACATACTTCCCTGTCGAAGCCATCAAAGAGAAAACGGCGGTCATGAACAAGGATGGTTCCCAAGAGTATAAA ATTCCTGGTCTGCTCATCATTGATACACCCGGACACGAATCCTTCACAAATTTACGTTCCCGCGGAAGTTCTTTA TGCAACATTGCCATTCTCGTTGTAGATATCATGCATGGCCTTGAAGCACAGACCCTAGAGTCCTTGCGGTTATTG CGTGATCGCAAAACCCCATTCATAGTAGCCTTAAATAAGATCGATCGTATGTACGACTGGGAGGCGACACCTGAC AATGCGTTCCGCGATTCACTCGCCAAACAAAAACGGCAAGTTCAAAGAGAATTTGAGGATCGAGTAGCAAAAACG ATTTTAGCTTTCGCAGAAGAGGGTCTTAACGCTTGCCTCTACTATGAGAACAAGAATTTCGCTCGCAACGTGTCC CTTGTTCCAACTTCTGCCGTCACGGGAGAGGGTGTTCCAGACATGATCAACCTACTCGTCAACCTCACTCAACAA CGCATGAGCGATCGACTCATGTACCTCGCAGAGTTGGAGTGTACTGTGCTTGAAGTCAAAGTCATTGAAGGTTTG GGTACTACAATTGACATAGTATTATCGAATGGTATCCTTCGTGAGGGAGAAAGGATCGTGGTTTGTGGTCTTAAC GGGCCAATCGTCACCCAGGTCAGAGCTTTGCTCACGCCGCAACCTCTAAGGGAGCTTCGTATCAAGTCTGCTTAT GTCCATCACAAACAAGTGAAGGCGGCTTTGGGTGTCAAGCTAGTGGCGCCCGATCTCGACAAAGCTATTGCCGGA TCGCGGTTACTCGTCGTTGGACCCGATGATGACGAAGATGATTTGAAAGAGGAAGTGATGTCTGATCTGACATCA CTGCTCAACAGCATCGATAAGTCAGGTCGTGGTGTCTGCGTTCAGGCATCTACTCTAGGTTCTTTAGAGGCCCTC CTAGATTTCCTGAAAGCCAGTAAAATTCCAGTTTCTGGTATCAACATTGGCCCAGTACATAAGCGTGATGTCATG CGTGCTTCGCCGATGTTGGAAAAGGCCAAAGAACTCGCGTGTATCCTCTGTTTCGATGTCACCGTCGACAGGGAT GCCGACAGAATGGCAGAGGAAATGGGCATCCGTTTATTCAAAGCGGATATCATATATCACTTGTTCGATGCCTTT ACCGCATACAATCAAGAAATAGTTGAAGCTAAGCGACGAGATGCTGCCCCCCAGGCTGTATGGCCTTGCCGACTG AAGATTATTGCAACGTTCTGTAAGCGAGATCCCATCATCGTCGGTGTTGATATTCTCGACGGTACTTTACGCGTC GGTACACCTTTGGCGGTGGTCAAAATCAATCCAACAAATGGACAAAAGGAGATTATAGACCTTGGAAAAATCACG TCCCTCGAAATCAACCACAAGAACCACGAGTTGATCAAGAAGTCCCAAGCTGGTGGAGGTGTTGCTGTCAAAATC GAGCATGCGGTCTACCAATCAGCAAAAATGTTCGGCCGCCACTTCGATGAAAAAGATGAACTACTGAGTCATGTC ACGCGCCAGAGTATCGACGTTTTAAAGGACACTTTCAGGAAAGATGCCACCAGTGAAGATTGGCTACTTATTCGT GCCCTCAAGCAGCGCTTTGGAATCCCCTGA |
| Gene | >AgabiH97|076610 ATGCCACCCAAAAACAAGGGAAAGAAAGGGAAGAAGAATGACGATGATTACTGGTTAATGAATCAATATTCCAAT CACGCACATGTCAATCTCACTCTTTGTTCCAGGGCAAACGCAGGCGAAACTGTGGATCCCATCGAATCTGCCCCG GCCAGCATACCTGATGATGATATTGGCCCTTCAACAAAGCCCAAAAGCGTGTTTTCTGCATTTTCATCGCTTGCT GATACCGAGGATGTTGGAGCTTTTGATGAAGAAGATGAGGGGGGTGGTGGACTGATGGTACGCACCGACGTTATT CTCTATTGAAAATGACTTATATAGGCTGCGTTAGTCACTGCTGAAGGCAAACAATAAAAAGAAGGAGAAGAAAGA AAAGAAGAAGTTCAAAGCGCATGCTGTGGATCTTCCTGTCGATGATATACCGGAGGAAGGAGACAACCCTCCTGC CGCAAAGCAAGCCGTAGAAGTCACCGCAGAAGACCTTGCTGATGAGGAGTGGGGTCCGGTGACAGAAAAGAAGAA AGGCAAAAAGTCTAAGAAGAAAGGTAAGGCGGCGGAAGATCAGGACGAAGAAACCCCGCCAAAGACAGGTGAGTT ATATTATGAGCGTTGTATGCAACCACCTTTACAACATGTGTAGAAGCGACGAAAGAAGAGGCTATAGTTTCGGAG CCAGCAGCAGCCTCCACGAAGGAAGTGCCCGAGAATGAGGACGAAAATACTCTAGATTCTGGTGCTAAGATCCTT TCTAAGAAGGAAAAGGAGAAACTCAAGAAAGAACGAGAAAAGGCCAGTAGAGACGGTCTGGTTGATTTTTTAAAT CTGGCTAATTTTTTTCTACAGGCTAAGAAGAAGGCACAGGCTGCAGCAAAGAAAGCCGCAGCAGCCGATGAGCCG CCCGATTCGCAAGTGCCGGCAGCAGAGACACCTGTGGCTACAAAAAATGATGGGAACGACGAAGGTAATGATGAT GATGATGGTGAAGAGGCGGCGACAGGTACTACATCGAAAGACAAGAAGAAGAAGAAGAAAAAGCCCAAGAAGGAT GAGGAGGTACCTGTACCTGCAGCCGGAAAGAAGAAGACTACTGGTATAAGTGCATTAAAAGCAATGATGGACGAG AAAAAACGTATAGAGGAAGAAGCCCGGCGTCGGGAGGAAGAGGAGCGCAAGCGAATTGAGGAAGAGGAGAGGCAG GCCGAGGAAGAGGCACGGAAAAAGGAAGAAGAGAAACAACGTAAAAAAGAAAAAGAAAAGGTGCGATCGTTTTAT CTTCGAACTAAACCCTATGGCTCAAAATATCCAAGGCCAAGCGCGAACTGGCGAAGAAAGAGGGGCGCCTTCTCA CAAAGAAACAGAAAGAGGAACGGCAAATGGCTGAGAGACGCAAGGAGGCTCTTTTGGCCTCGGGGGTTTACATCG AGGGTTTGCAGCAACCATCTGGTGGTGGCGCACCCAAGAAACCAGTATATGGTAACAAGAAAAAGAAGCCGCTGA AAACATCATCTCCTGCAGCGGACTCACGGCCGCGATCTCCTGCGCATATCCCTGAGCCTGACACTCAGGAAACAC CCAAAGTTGAAGTTGTGGATGATGTGAAATCCGATTGGGAGAATAGCGCTGACGAACAAAAGAGCATTTCAGGGA CGCAGCCAGAGTCTCAGTCAGAGGTGAAGGATACCTGGGATGCCTCGAGTGATGAGGAGAAGGAAGCTTCTGCAT CAAAACATACTGCGGATGCTGGACCGTCTGAAAAAGGTATACATCTTTACCTATTCAACCATCATTAACCTTTGA TAACGTCTTCCAAATATCTACCAGCTAAACCAACTGTCAATGGCGAGCCAACGGCCAAGACAACCCCGACTCAGA AAAATGCCAAAGAAATAAAGGCCAAAGAAACAAAGGTCAAGGAAACGAAGGCGAAAATGACTTCACCAGAACCCT CGAAAACTGAAGAGACCTCATCTGAATCTGAGGATGAATCGGATTCAACGGAAGACTCGAGTTCTGAAGAGGATT CTACAGAATCCTCAGATGAAGAACTCACTGCTGTCCAGAGATTAGCTGCTCAGAAAAAGGCAGAAGCTACAGAGC GGCGTGCTAAAGCTCACGAAGCTGCCCTTGCAGCTCGTAACAAAGATGATCTCCGCAGTCCAATTTGCTGCATTC TTGGGCACGTCGACACCGGGAAAACAAAGCTTTTGGATAAGGTGTATTTCATTCACAGTTCAAACATCAGTCCTC TTCGCTTACATCAATCAGATTCGTCAAACCAACGTCCAAGAAGGTGAAGCAGGAGGTATCACACAACAGATCGGT GCAACATACTTCCCTGTCGAAGCCATCAAAGAGAAAACGGCGGTCATGAACAAGGTAAGAAGTCAGCCTTTGCAA ATGTATTCAATGGTCAACGTCCTAGTTAGGATGGTTCCCAAGAGTATAAAATTCCTGGTCTGCTCATCATTGATA CACCCGGACACGAATCCTTCACAAATTTACGTTCCCGCGGAAGTTCTTTATGCAACATTGCCATTCTCGTTGTAG ATATCATGCATGGCCTTGAAGCACAGACCCTAGAGTCCTTGCGGTTATTGCGTGATCGCAAAACCCCATTCATAG TAGCCTTAAATAAGGTGTGTGTTTTATTTTACAACCAACTGGGGCTTGCGATCAATGATGGTTCGGTACATTTTG TAGATCGATCGTATGTACGACTGGGAGGCGACACCTGACAATGCGTTCCGCGATTCACTCGCCAAACAAAAACGG CAAGTTCAAAGAGAATTTGAGGATCGAGTAGCAAAAACGATTTTAGCTTTCGCAGAAGAGGGTCTTAACGCTTGC CTCTACTATGAGAACAAGAATTTCGCTCGCAACGTGTCCCTTGTTCCAACTTCTGCCGTCACGGGAGAGGGTGTT CCAGACATGATCAACCTACTCGTCAACCTCACTCAACAACGCATGAGCGATCGACTCATGTACCTCGCAGAGTTG GAGTGTACTGTGCTTGAAGTCAAAGTCATTGAAGGTTTGGGTACTACAATTGACATAGTATTATCGAATGGTATC CTTCGTGAGGGAGAAAGGATCGTGGTTTGTGGTCTTAACGGGCCAATCGTCACCCAGGTCAGAGCTTTGCTCACG CCGCAACCTCTAAGGGAGCTTCGTATCAAGGTAAGGATCAACTCTACAACCCTGCATCTACTTGCTTAGTGGTGT ACCTCCCTCTTAGTCTGCTTATGTCCATCACAAACAAGTGAAGGCGGCTTTGGGTGTCAAGCTAGTGGCGCCCGA TCTCGACAAAGCTATTGCCGGATCGCGGTTACTCGTCGTTGGACCCGATGATGACGAAGATGATTTGAAAGAGGA AGTGATGTCTGATCTGACATCACTGCTCAACAGCATCGATAAGTCAGGTCGTGGTGTCTGCGTTCAGGCATCTAC TCTAGGTTCTTTAGAGGCCCTCCTAGATTTCCTGAAAGCCAGTAAAATTCCAGTTTCTGGTATCAACATTGGCCC AGTACATAAGCGTGATGTCATGCGTGCTTCGCCGATGTTGGAAAAGGCCAAAGAACTCGCGTGTATCCTCTGTTT CGATGTCACCGTCGACAGGGATGCCGACAGAATGGCAGAGGAAATGGGCATCCGTTTATTCAAAGGTATGACCTG CTTCAGCTCAAGTTCAAATCCACTGACGATAAACCTTTTGCCACAGCGGATATCATATATCACTTGTTCGATGCC TTTACCGCATACAATCAAGAAATAGTTGAAGCTAAGCGACGAGATGCTGCCCCCCAGGCTGTATGGCCTTGCCGA CTGAAGATTATTGCAACGTTCTGTAAGCGAGATCCCATCATCGTCGGTGTTGATATTCTCGACGGTACTTTACGC GTCGGTACACCTTTGGCGGTGGTCAAAATCAATCCAACAAATGGACAAAAGGAGATTATAGACCTTGGAAAAATG TAAGCTTTTTTGGTAATCTCTCCTCTTCATGACTCGAATACTGACATCATACCTAGCACGTCCCTCGAAATCAAC CACAAGAACCACGAGGTACGAGTTCTTATTACTCCATAGCCTCAGAACTTTGCTAAAATAAAACAGTTGATCAAG AAGTCCCAAGCTGGTGGAGGTGTTGCTGTCAAAATCGAGCATGCGGTCTACCAATCAGCAAAAATGTTCGGCCGC CACTTCGATGAAAAAGATGAACTACTGAGTCATGTCACGCGCCAGAGTATCGACGTTTTAAAGGTAGAAGCATAT ACATATACCGGCTCATTCTGATCATCTGCCTTGGCTTATTTTTAACACAGGACACTTTCAGGAAAGATGCCACCA GTGAAGATTGGCTACTTATTCGTGCCCTCAAGCAGGTATGTTTGCGTACTCTATTCTTACATTTTATCTCTTCCT CACTGTTTAAACAGCGCTTTGGAATCCCCTGA |