Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|076580
Gene name
Locationscaffold_4:2649505..2651784
Strand-
Gene length (bp)2279
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 3.6E-55 211 506
PF13649 Methyltransf_25 Methyltransferase domain 1.1E-07 285 375
PF08241 Methyltransf_11 Methyltransferase domain 3.8E-05 286 370

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 140 514 1.0E-46
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 128 512 3.0E-41
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 128 512 3.0E-41
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 220 512 2.0E-30
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 209 521 3.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 140 514 1.0E-46
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 128 512 3.0E-41
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 128 512 3.0E-41
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 220 512 2.0E-30
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 209 521 3.0E-23
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 220 454 2.0E-22
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 154 521 3.0E-22
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 199 520 8.0E-21
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 206 512 5.0E-18
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 206 512 5.0E-18
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 206 512 5.0E-18
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 215 509 1.0E-17
sp|P9WPB1|MMAA1_MYCTU Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA1 PE=1 SV=1 218 460 6.0E-17
sp|P9WPB0|MMAA1_MYCTO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmaA1 PE=3 SV=1 218 460 6.0E-17
sp|A5U030|MMAA1_MYCTA Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA1 PE=1 SV=1 218 460 6.0E-17
sp|P0A5Q1|MMAA1_MYCBO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaD PE=3 SV=1 218 460 6.0E-17
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 205 461 8.0E-17
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 205 461 8.0E-17
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 199 521 9.0E-17
sp|P9WPB2|CMAS3_MYCTO Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pcaA PE=3 SV=1 215 477 1.0E-16
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 215 509 1.0E-16
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 215 509 1.0E-16
sp|P9WPB3|CMAS3_MYCTU Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pcaA PE=1 SV=1 215 477 1.0E-16
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 205 461 4.0E-16
sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 214 483 2.0E-13
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 220 461 4.0E-12
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 255 464 6.0E-11
sp|P9WPB5|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA2 PE=1 SV=1 208 469 2.0E-10
sp|P0A5P1|CMAS2_MYCBO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA2 PE=3 SV=1 208 469 2.0E-10
sp|P9WPB4|CMAS2_MYCTO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA2 PE=3 SV=1 208 469 2.0E-10
sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA2 PE=1 SV=1 218 512 8.0E-10
sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 218 512 8.0E-10
sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 218 512 1.0E-09
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 262 484 1.0E-07
sp|Q9KJ20|GSDMT_ACTHA Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 261 366 1.0E-06
sp|Q83WC3|SDMT_APHHA Sarcosine/dimethylglycine N-methyltransferase OS=Aphanothece halophytica PE=1 SV=1 265 366 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|076580
MWKGPEEEEHVLMRRGPGRTIHLMVLPDSPVDCKIYRSRLKLLHRLCSSIFSSTKMSASFQQPCLQFPSPSKALQ
APSRFSFSNLNPKTWAVVFARSSILTVLTDAIVVGHLTISDSEGTYYYGNYQKGCNDVHIKIINDNFWLRILLSG
DLGFSEAYMIGDIEVSSLKGAMNLWLDNQSGMEDTLSSTVAKISSAISGLYNSFLGQTRSQARLNAIASYDQSNE
LFKAFLSNEMMYSCGLWSDAEGGVRGDLEYGPTPGDLEAAQLRKIHHVLRQARVKPGHRILEFGSGWGGLAIEAA
RHFGCEVDTLTLSIEQKTLAEERIKAAGLEGRIRVHLLDYREIPAEFEKAFDAFVSIEMIEHVGAKYYNTYFKLV
DFALKSRDAVAVVTSSTFPESRYTGYQAEDFMRRYMWPNSCLPSATTLITAMNTGSQGRFTLEGVENHAAHYPRT
LREWGRRLEANLTQDLVAKDYPSLHDRADYDAFKRKWQYLFAYAGAGFAKGYITCHMLTFIRQNDTPERCD*
Coding >AgabiH97|076580
ATGTGGAAGGGTCCTGAGGAGGAGGAACATGTGTTGATGAGGAGAGGCCCTGGGAGAACGATCCATCTGATGGTC
CTTCCAGATTCACCCGTAGATTGTAAAATCTATAGATCTCGCCTAAAACTTCTTCACCGCCTCTGCTCTTCCATC
TTCTCTTCTACCAAAATGTCTGCCTCGTTCCAACAACCTTGCCTTCAATTCCCCTCCCCTTCCAAAGCTCTTCAA
GCTCCCTCGCGCTTCTCTTTCTCCAATCTCAACCCCAAGACCTGGGCAGTAGTGTTCGCCCGAAGCTCAATCTTG
ACTGTTCTCACCGACGCGATAGTCGTTGGCCACCTGACGATCTCCGATTCCGAAGGGACATACTATTATGGGAAC
TACCAAAAAGGGTGTAATGACGTCCATATCAAGATCATAAACGACAATTTCTGGCTACGCATCCTCCTATCAGGA
GACTTGGGCTTCAGCGAAGCATACATGATCGGTGATATTGAAGTTTCATCACTTAAAGGTGCCATGAATTTGTGG
CTGGACAACCAGAGTGGAATGGAAGACACACTTTCTTCCACCGTGGCAAAAATCTCGTCGGCAATTTCCGGCCTC
TACAACAGCTTCCTGGGTCAAACACGCTCGCAGGCACGCCTCAATGCAATTGCTAGCTATGATCAGTCAAATGAA
CTATTCAAGGCTTTCCTCAGTAACGAGATGATGTACTCCTGCGGCCTCTGGTCTGATGCAGAAGGTGGTGTTCGT
GGTGATCTCGAGTATGGACCAACCCCAGGAGACTTAGAAGCTGCTCAACTACGCAAAATTCACCATGTATTGCGC
CAGGCTCGTGTTAAACCTGGCCACCGAATCCTCGAATTCGGCAGCGGCTGGGGTGGTCTCGCCATCGAGGCTGCT
CGTCATTTTGGATGTGAAGTTGACACCCTGACGCTGTCCATTGAACAAAAAACCCTTGCGGAGGAAAGAATCAAG
GCTGCCGGACTCGAAGGTCGTATTCGCGTACACCTCCTTGACTATCGTGAAATTCCCGCGGAATTTGAAAAGGCT
TTCGATGCTTTTGTTTCCATTGAAATGATTGAGCATGTGGGTGCGAAGTACTACAACACCTACTTCAAACTCGTC
GACTTCGCTTTAAAATCAAGAGATGCAGTGGCTGTCGTCACCTCATCGACCTTCCCAGAGTCAAGATACACCGGC
TATCAAGCCGAAGACTTTATGCGTCGCTATATGTGGCCTAACTCTTGCCTACCGAGTGCTACGACTCTTATCACT
GCCATGAACACTGGCTCACAAGGTCGCTTCACTCTTGAAGGCGTGGAGAATCACGCAGCTCACTATCCTCGCACG
CTGCGCGAATGGGGCCGCCGTCTTGAGGCCAACCTCACCCAGGATCTTGTGGCCAAAGACTATCCTTCTCTACAC
GATCGTGCGGACTATGACGCCTTCAAGCGCAAGTGGCAATATCTTTTTGCCTATGCTGGTGCTGGTTTCGCCAAA
GGCTACATCACATGTCATATGCTCACATTCATACGCCAAAACGACACGCCTGAGCGCTGCGATTGA
Transcript >AgabiH97|076580
ATGTGGAAGGGTCCTGAGGAGGAGGAACATGTGTTGATGAGGAGAGGCCCTGGGAGAACGATCCATCTGATGGTC
CTTCCAGATTCACCCGTAGATTGTAAAATCTATAGATCTCGCCTAAAACTTCTTCACCGCCTCTGCTCTTCCATC
TTCTCTTCTACCAAAATGTCTGCCTCGTTCCAACAACCTTGCCTTCAATTCCCCTCCCCTTCCAAAGCTCTTCAA
GCTCCCTCGCGCTTCTCTTTCTCCAATCTCAACCCCAAGACCTGGGCAGTAGTGTTCGCCCGAAGCTCAATCTTG
ACTGTTCTCACCGACGCGATAGTCGTTGGCCACCTGACGATCTCCGATTCCGAAGGGACATACTATTATGGGAAC
TACCAAAAAGGGTGTAATGACGTCCATATCAAGATCATAAACGACAATTTCTGGCTACGCATCCTCCTATCAGGA
GACTTGGGCTTCAGCGAAGCATACATGATCGGTGATATTGAAGTTTCATCACTTAAAGGTGCCATGAATTTGTGG
CTGGACAACCAGAGTGGAATGGAAGACACACTTTCTTCCACCGTGGCAAAAATCTCGTCGGCAATTTCCGGCCTC
TACAACAGCTTCCTGGGTCAAACACGCTCGCAGGCACGCCTCAATGCAATTGCTAGCTATGATCAGTCAAATGAA
CTATTCAAGGCTTTCCTCAGTAACGAGATGATGTACTCCTGCGGCCTCTGGTCTGATGCAGAAGGTGGTGTTCGT
GGTGATCTCGAGTATGGACCAACCCCAGGAGACTTAGAAGCTGCTCAACTACGCAAAATTCACCATGTATTGCGC
CAGGCTCGTGTTAAACCTGGCCACCGAATCCTCGAATTCGGCAGCGGCTGGGGTGGTCTCGCCATCGAGGCTGCT
CGTCATTTTGGATGTGAAGTTGACACCCTGACGCTGTCCATTGAACAAAAAACCCTTGCGGAGGAAAGAATCAAG
GCTGCCGGACTCGAAGGTCGTATTCGCGTACACCTCCTTGACTATCGTGAAATTCCCGCGGAATTTGAAAAGGCT
TTCGATGCTTTTGTTTCCATTGAAATGATTGAGCATGTGGGTGCGAAGTACTACAACACCTACTTCAAACTCGTC
GACTTCGCTTTAAAATCAAGAGATGCAGTGGCTGTCGTCACCTCATCGACCTTCCCAGAGTCAAGATACACCGGC
TATCAAGCCGAAGACTTTATGCGTCGCTATATGTGGCCTAACTCTTGCCTACCGAGTGCTACGACTCTTATCACT
GCCATGAACACTGGCTCACAAGGTCGCTTCACTCTTGAAGGCGTGGAGAATCACGCAGCTCACTATCCTCGCACG
CTGCGCGAATGGGGCCGCCGTCTTGAGGCCAACCTCACCCAGGATCTTGTGGCCAAAGACTATCCTTCTCTACAC
GATCGTGCGGACTATGACGCCTTCAAGCGCAAGTGGCAATATCTTTTTGCCTATGCTGGTGCTGGTTTCGCCAAA
GGCTACATCACATGTCATATGCTCACATTCATACGCCAAAACGACACGCCTGAGCGCTGCGATTGA
Gene >AgabiH97|076580
ATGTGGAAGGGTCCTGAGGAGGAGGAACATGTGTTGATGAGGAGAGGCCCTGGGAGAACGATCCATCTGGCAAGT
ACGATTTCATCTTTGCGATGCAATCTGTCGCGAATCCTCCCTTGCGGTTGTTGACTTGTACTGTTCATAACTTCC
CGCCCTCTATACAGATGGTCCTTCCAGATTCACCCGTAGATTGTAAAATCTATAGATCTCGCCGTTCGTCCGTCC
AATGCATATAAAGTCCTCCACTCTCCTCTGTTCATCCTCACTCCCAGTAAAACTTCTTCACCGCCTCTGCTCTTC
CATCTTCTCTTCTACCAAAATGTCTGCCTCGTTCCAACAACCTTGCCTTCAATTCCCCTCCCCTTCCAAAGCTCT
TCAAGCTCCCTCGCGCTTCTCTTTCTCCAATCTCAACCCCAAGACCTGGGCAGTAGTGTTCGGTATGCGCCCCCC
ATGCGCTCCAGGAATAGTTCCAGTTTTAACCAGCATTCTAGCCCGAAGCTCAATCTTGACTGTTCTCACCGACGC
GATAGTCGTTGGCCACCTGACGATCTCCGATTCCGAAGGGACATACTATTATGGGAACTACCAAAAAGGGTGTAA
TGACGTCCATATCAAGATCATAAACGACAATTTCTGGCTACGCATCCTCCTGTGAGCATCCAGGCCTTTGTTTAT
TTTGTTATTTTGGCTAACGATTTCACGCAGATCAGGAGACTTGGGCTGTGAGTTTATAACTCATCCATCACAACA
AGAGTTGGTTTAACTAAAGTTCCACACCTATATAGTCAGCGAAGCATACATGATCGGTGATATTGAAGTTTCATC
ACTTAAAGGTGCCATGAATGTAAGGGGATACTCTGGCTTCAATCGTCGCTCTCTGACATTATTCTCCTAGTTGTG
GCTGGACAACCAGAGTGGAATGGAAGACACACTTTCTTCCACCGTGGCAAAAATCTCGTCGGCAATTTCCGGCCT
CTACAACAGCTTCCTGGGTCAAACACGCTCGCAGGCACGCCTCAATGCAATTGCTAGCTATGATCAGTCAAATGA
ACTATTCAAGGTAAATTCGTTTCGTGTCTCTCTTACACCTTGCTTCATCCTCACATCTGCGCTTAGGCTTTCCTC
AGTAACGAGATGATGTACTCCTGCGGCCTCTGGTCTGATGCAGAAGGTGGTGTTCGTGGTGATCTCGAGTATGGA
CCAACCCCAGGAGACTTAGAAGCTGCTCAACTACGCAAAATTCACCATGTATTGCGCCAGGCTCGTGTTAAACCT
GGCCACCGAATCCTCGAATTCGGCAGCGGCTGGGGTGGTCTCGCCATCGAGGTAGGCATATATTATTACACTATC
GCCAAATCTTGACGCTGACGTTCTGACTAGGCTGCTCGTCATTTTGGATGTGAAGTTGACACCCTGACGCTGTCC
ATTGAACAAAAAACCCTTGCGGAGGAAAGAATCAAGGCTGCCGGACTCGAAGGTCGTATTCGCGTACACCTCCTT
GACTATCGTGAAATTCCCGCGGAATTTGAAAAGGCTTTCGATGCTTTTGTTTCCATTGAAATGATTGAGGTTTGT
TATTACTCCTTCTTAGGCCTTGAATCGTCAAATTGATGGAATTGTGCCTTAGCATGTGGGTGCGAAGTACTACAA
CACCTACTTCAAACTCGTCGACTTCGCTTTAAAATCAAGAGATGCAGTGGCTGTCGTCACCTCATCGACCTTCCC
AGAGTCAAGATACACCGGCTATCAGTGCGTTTTTCTGTTGGAAAGGTCTCTAAAACAGGAAACTGACGTATTCAT
TCTTCTCTTAACAGAGCCGAAGACTTTATGCGTCGCTATATGTGGCCTAACTCTTGCCTACCGAGTGCTACGACT
CTTATCACTGCCATGAACACTGGCTCACAAGGTCGCTTCACTCTTGAAGGCGTGGAGAATCACGCAGCTCGTATG
TTCAGCCTTCCGATTGTGATACCCTTTTCCTGACACATTCATCAGACTATCCTCGCACGCTGCGCGAATGGGGCC
GCCGTCTTGAGGCCAACCTCACCCAGGATCTTGTGGCCAAAGACTATCCTTCTCTACACGATCGTGCGGACTATG
ACGCCTTCAAGCGCAAGTGGCAATATCTTTTTGCCTATGCTGGTGCTGGTTTCGCCAAAGGCTACATCACATGTC
ATATGCTCACATTCATACGCCAAGTGAGTAGACTTGATGTACTACCATTTAATACCTCATGGCTAAACTTACTCT
AGAACGACACGCCTGAGCGCTGCGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail