Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|076570
Gene name
Locationscaffold_4:2641102..2647326
Strand+
Gene length (bp)6224
Transcript length (bp)4806
Coding sequence length (bp)4806
Protein length (aa) 1602

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00225 Kinesin Kinesin motor domain 5.5E-111 14 365
PF12473 DUF3694 Kinesin protein 3.0E-42 1186 1333
PF16183 Kinesin_assoc Kinesin-associated 5.7E-07 369 426
PF16183 Kinesin_assoc Kinesin-associated 7.5E-32 418 510
PF16796 Microtub_bd Microtubule binding 8.8E-22 7 170
PF00169 PH PH domain 4.5E-10 1503 1594
PF12423 KIF1B Kinesin protein 1B 7.1E-07 909 951
PF00498 FHA FHA domain 4.3E-05 513 580

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1ZAJ2|KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster GN=unc-104 PE=1 SV=1 8 660 0.0E+00
sp|Q28WQ1|KIF1A_DROPS Kinesin-like protein unc-104 OS=Drosophila pseudoobscura pseudoobscura GN=unc-104 PE=3 SV=1 8 660 0.0E+00
sp|Q7PHR1|KIF1A_ANOGA Kinesin-like protein unc-104 OS=Anopheles gambiae GN=unc-104 PE=3 SV=3 8 654 0.0E+00
sp|Q17BU3|KIF1A_AEDAE Kinesin-like protein unc-104 OS=Aedes aegypti GN=unc-104 PE=3 SV=1 8 654 0.0E+00
sp|P23678|UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans GN=unc-104 PE=2 SV=4 8 602 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1ZAJ2|KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster GN=unc-104 PE=1 SV=1 8 660 0.0E+00
sp|Q28WQ1|KIF1A_DROPS Kinesin-like protein unc-104 OS=Drosophila pseudoobscura pseudoobscura GN=unc-104 PE=3 SV=1 8 660 0.0E+00
sp|Q7PHR1|KIF1A_ANOGA Kinesin-like protein unc-104 OS=Anopheles gambiae GN=unc-104 PE=3 SV=3 8 654 0.0E+00
sp|Q17BU3|KIF1A_AEDAE Kinesin-like protein unc-104 OS=Aedes aegypti GN=unc-104 PE=3 SV=1 8 654 0.0E+00
sp|P23678|UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans GN=unc-104 PE=2 SV=4 8 602 0.0E+00
sp|O88658|KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus GN=Kif1b PE=1 SV=2 7 654 0.0E+00
sp|Q12756|KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens GN=KIF1A PE=1 SV=2 7 654 0.0E+00
sp|Q60575|KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus GN=Kif1b PE=1 SV=2 7 654 0.0E+00
sp|P33173|KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus GN=Kif1a PE=1 SV=2 7 654 0.0E+00
sp|O43896|KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens GN=KIF1C PE=1 SV=3 7 658 0.0E+00
sp|O35071|KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus GN=Kif1c PE=1 SV=2 7 658 0.0E+00
sp|O35787|KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus GN=Kif1c PE=1 SV=1 7 601 0.0E+00
sp|Q9NGQ2|KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum GN=kif1 PE=1 SV=1 8 602 2.0E-174
sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=2 5 595 2.0E-157
sp|Q9H1H9|KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens GN=KIF13A PE=1 SV=2 6 660 5.0E-155
sp|Q9EQW7|KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus GN=Kif13a PE=1 SV=1 6 660 4.0E-154
sp|O60333|KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens GN=KIF1B PE=1 SV=5 7 391 8.0E-143
sp|Q96L93|KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens GN=KIF16B PE=1 SV=2 7 599 7.0E-142
sp|B1AVY7|KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus GN=Kif16b PE=1 SV=1 7 599 1.0E-140
sp|Q15058|KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens GN=KIF14 PE=1 SV=1 6 595 2.0E-130
sp|L0N7N1|KIF14_MOUSE Kinesin-like protein KIF14 OS=Mus musculus GN=Kif14 PE=1 SV=1 6 619 1.0E-129
sp|Q9P2P6|STAR9_HUMAN StAR-related lipid transfer protein 9 OS=Homo sapiens GN=STARD9 PE=1 SV=3 7 657 4.0E-114
sp|Q80TF6|STAR9_MOUSE StAR-related lipid transfer protein 9 OS=Mus musculus GN=Stard9 PE=1 SV=2 7 657 4.0E-111
sp|D3YXS5|KIF28_MOUSE Kinesin-like protein KIF28P OS=Mus musculus GN=Kif28p PE=3 SV=1 8 587 5.0E-100
sp|F8WLE0|KIF28_RAT Kinesin-like protein KIF28P OS=Rattus norvegicus GN=Kif28p PE=2 SV=1 8 587 7.0E-98
sp|P46872|KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP85 PE=1 SV=1 4 400 1.0E-89
sp|Q5R4H3|KIF3A_PONAB Kinesin-like protein KIF3A OS=Pongo abelii GN=KIF3A PE=2 SV=1 8 401 9.0E-85
sp|Q4R628|KIF3A_MACFA Kinesin-like protein KIF3A OS=Macaca fascicularis GN=KIF3A PE=2 SV=1 8 401 1.0E-84
sp|Q9Y496|KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens GN=KIF3A PE=1 SV=4 8 401 1.0E-84
sp|P28741|KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus GN=Kif3a PE=1 SV=2 8 401 3.0E-84
sp|B7ZC32|KIF28_HUMAN Kinesin-like protein KIF28P OS=Homo sapiens GN=KIF28P PE=3 SV=2 13 372 6.0E-83
sp|Q61771|KIF3B_MOUSE Kinesin-like protein KIF3B OS=Mus musculus GN=Kif3b PE=1 SV=1 8 398 2.0E-82
sp|O15066|KIF3B_HUMAN Kinesin-like protein KIF3B OS=Homo sapiens GN=KIF3B PE=1 SV=1 8 398 3.0E-82
sp|P46865|KINL_LEICH Kinesin-like protein K39 (Fragment) OS=Leishmania chagasi GN=KIN PE=2 SV=1 9 396 3.0E-81
sp|P46869|FLA10_CHLRE Kinesin-like protein FLA10 OS=Chlamydomonas reinhardtii GN=FLA10 PE=1 SV=1 2 394 4.0E-81
sp|P46871|KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP95 PE=1 SV=1 1 391 2.0E-80
sp|P46867|KLP68_DROME Kinesin-like protein Klp68D OS=Drosophila melanogaster GN=Klp68D PE=2 SV=2 9 427 3.0E-79
sp|Q29DY1|KLP68_DROPS Kinesin-like protein Klp68D OS=Drosophila pseudoobscura pseudoobscura GN=Klp68D PE=3 SV=1 9 395 4.0E-79
sp|P46873|OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans GN=osm-3 PE=2 SV=4 1 437 1.0E-76
sp|Q99PW8|KIF17_MOUSE Kinesin-like protein KIF17 OS=Mus musculus GN=Kif17 PE=1 SV=1 8 477 2.0E-76
sp|Q9P2E2|KIF17_HUMAN Kinesin-like protein KIF17 OS=Homo sapiens GN=KIF17 PE=2 SV=3 9 472 1.0E-75
sp|O35066|KIF3C_MOUSE Kinesin-like protein KIF3C OS=Mus musculus GN=Kif3c PE=1 SV=3 9 394 4.0E-72
sp|Q91784|KIF4_XENLA Chromosome-associated kinesin KIF4 OS=Xenopus laevis GN=kif4 PE=2 SV=1 9 399 7.0E-72
sp|O55165|KIF3C_RAT Kinesin-like protein KIF3C OS=Rattus norvegicus GN=Kif3c PE=2 SV=1 9 394 1.0E-71
sp|O14782|KIF3C_HUMAN Kinesin-like protein KIF3C OS=Homo sapiens GN=KIF3C PE=1 SV=3 9 394 2.0E-71
sp|Q5R706|KIF3C_PONAB Kinesin-like protein KIF3C OS=Pongo abelii GN=KIF3C PE=2 SV=1 9 394 2.0E-71
sp|A0JN40|KIF3C_BOVIN Kinesin-like protein KIF3C OS=Bos taurus GN=KIF3C PE=2 SV=1 9 394 6.0E-71
sp|Q2VIQ3|KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens GN=KIF4B PE=2 SV=2 9 384 1.0E-70
sp|P48467|KINH_NEUCR Kinesin heavy chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kin PE=1 SV=2 8 372 4.0E-70
sp|Q90640|KIF4_CHICK Chromosome-associated kinesin KIF4 OS=Gallus gallus GN=KIF4 PE=2 SV=1 12 384 5.0E-70
sp|O95239|KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens GN=KIF4A PE=1 SV=3 9 384 6.0E-70
sp|P33174|KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus GN=Kif4 PE=1 SV=3 9 377 3.0E-69
sp|Q86Z98|KINH_GIBMO Kinesin heavy chain OS=Gibberella moniliformis GN=KLP1 PE=3 SV=1 8 372 4.0E-69
sp|Q27IK7|POK1_ARATH Phragmoplast orienting kinesin-1 OS=Arabidopsis thaliana GN=POK1 PE=1 SV=1 6 394 7.0E-69
sp|Q27IK6|POK2_ARATH Phragmoplast orienting kinesin 2 OS=Arabidopsis thaliana GN=POK2 PE=2 SV=1 6 376 1.0E-68
sp|Q86Y91|KI18B_HUMAN Kinesin-like protein KIF18B OS=Homo sapiens GN=KIF18B PE=1 SV=3 6 394 3.0E-68
sp|P33176|KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens GN=KIF5B PE=1 SV=1 1 372 9.0E-68
sp|O43093|KINH_SYNRA Kinesin heavy chain OS=Syncephalastrum racemosum PE=2 SV=1 8 400 1.0E-67
sp|Q61768|KINH_MOUSE Kinesin-1 heavy chain OS=Mus musculus GN=Kif5b PE=1 SV=3 1 372 1.0E-67
sp|Q2PQA9|KINH_RAT Kinesin-1 heavy chain OS=Rattus norvegicus GN=Kif5b PE=1 SV=1 1 372 1.0E-67
sp|Q8GS71|FRA1_ARATH Kinesin-like protein FRA1 OS=Arabidopsis thaliana GN=FRA1 PE=1 SV=1 6 401 1.0E-67
sp|Q86ZC1|KINH_BOTFU Kinesin heavy chain OS=Botryotinia fuckeliana GN=klp1 PE=3 SV=1 8 400 1.0E-65
sp|Q6YUL8|BC2_ORYSJ Kinesin-like protein BC2 OS=Oryza sativa subsp. japonica GN=BC2 PE=1 SV=1 1 399 3.0E-65
sp|O60282|KIF5C_HUMAN Kinesin heavy chain isoform 5C OS=Homo sapiens GN=KIF5C PE=1 SV=1 1 372 9.0E-65
sp|P28738|KIF5C_MOUSE Kinesin heavy chain isoform 5C OS=Mus musculus GN=Kif5c PE=1 SV=3 1 372 1.0E-64
sp|Q5ZLK6|KI18B_CHICK Kinesin-like protein KIF18B OS=Gallus gallus GN=KIF18B PE=2 SV=1 58 394 3.0E-64
sp|Q4KLL9|KI18B_RAT Kinesin-like protein KIF18B OS=Rattus norvegicus GN=Kif18b PE=2 SV=1 58 408 6.0E-64
sp|Q9LDN0|KN12A_ARATH Kinesin-like protein KIN12A OS=Arabidopsis thaliana GN=KIN12A PE=1 SV=1 6 391 7.0E-64
sp|Q6PFD6|KI18B_MOUSE Kinesin-like protein KIF18B OS=Mus musculus GN=Kif18b PE=2 SV=2 58 394 3.0E-63
sp|Q7ZXX2|KIF19_XENLA Kinesin-like protein KIF19 OS=Xenopus laevis GN=kif19 PE=2 SV=1 2 453 3.0E-63
sp|Q8NI77|KI18A_HUMAN Kinesin-like protein KIF18A OS=Homo sapiens GN=KIF18A PE=1 SV=2 8 471 3.0E-63
sp|P33175|KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus musculus GN=Kif5a PE=1 SV=3 1 372 3.0E-63
sp|Q12840|KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sapiens GN=KIF5A PE=1 SV=2 1 372 4.0E-63
sp|Q02224|CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens GN=CENPE PE=1 SV=2 4 400 5.0E-63
sp|Q6QLM7|KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus norvegicus GN=Kif5a PE=1 SV=1 1 372 1.0E-62
sp|Q5R9K7|KIF5A_PONAB Kinesin heavy chain isoform 5A OS=Pongo abelii GN=KIF5A PE=2 SV=1 1 372 1.0E-62
sp|Q2TAC6|KIF19_HUMAN Kinesin-like protein KIF19 OS=Homo sapiens GN=KIF19 PE=2 SV=2 1 453 2.0E-62
sp|Q9QXL1|KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus GN=Kif21b PE=1 SV=2 1 403 3.0E-62
sp|O75037|KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens GN=KIF21B PE=1 SV=2 1 403 5.0E-62
sp|Q8L7Y8|KN12B_ARATH Kinesin-like protein KIN12B OS=Arabidopsis thaliana GN=KIN12B PE=1 SV=1 26 391 9.0E-62
sp|Q91WD7|KI18A_MOUSE Kinesin-like protein KIF18A OS=Mus musculus GN=Kif18a PE=2 SV=1 9 366 2.0E-61
sp|Q6RT24|CENPE_MOUSE Centromere-associated protein E OS=Mus musculus GN=Cenpe PE=1 SV=1 4 394 3.0E-61
sp|Q8T135|KIF5_DICDI Kinesin-related protein 5 OS=Dictyostelium discoideum GN=kif5 PE=1 SV=1 4 392 3.0E-61
sp|Q54UC9|KIF3_DICDI Kinesin-related protein 3 OS=Dictyostelium discoideum GN=kif3 PE=1 SV=1 9 394 3.0E-61
sp|Q99PT9|KIF19_MOUSE Kinesin-like protein KIF19 OS=Mus musculus GN=Kif19 PE=1 SV=2 1 453 7.0E-61
sp|Q7M6Z4|KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus GN=Kif27 PE=1 SV=1 9 391 1.0E-60
sp|P21613|KINH_DORPE Kinesin heavy chain OS=Doryteuthis pealeii PE=2 SV=1 1 469 1.0E-60
sp|Q7M6Z5|KIF27_RAT Kinesin-like protein KIF27 OS=Rattus norvegicus GN=Kif27 PE=1 SV=1 9 391 2.0E-60
sp|Q6P9L6|KIF15_MOUSE Kinesin-like protein KIF15 OS=Mus musculus GN=Kif15 PE=1 SV=1 5 430 2.0E-60
sp|Q54TL0|KIF7_DICDI Kinesin-related protein 7 OS=Dictyostelium discoideum GN=kif7 PE=2 SV=1 8 373 4.0E-60
sp|Q7TSP2|KIF15_RAT Kinesin-like protein KIF15 OS=Rattus norvegicus GN=Kif15 PE=2 SV=1 6 430 4.0E-60
sp|Q9NS87|KIF15_HUMAN Kinesin-like protein KIF15 OS=Homo sapiens GN=KIF15 PE=1 SV=1 81 430 4.0E-60
sp|Q6P9P6|KIF11_MOUSE Kinesin-like protein KIF11 OS=Mus musculus GN=Kif11 PE=1 SV=1 8 460 7.0E-60
sp|Q9GYZ0|KIF15_STRPU Kinesin-like protein KIF15 OS=Strongylocentrotus purpuratus GN=KIF15 PE=1 SV=1 2 410 1.0E-59
sp|Q54NP8|KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum GN=kif4 PE=2 SV=1 9 397 2.0E-59
sp|P52732|KIF11_HUMAN Kinesin-like protein KIF11 OS=Homo sapiens GN=KIF11 PE=1 SV=2 8 460 3.0E-59
sp|P17210|KINH_DROME Kinesin heavy chain OS=Drosophila melanogaster GN=Khc PE=1 SV=2 5 396 5.0E-59
sp|O14343|KLP5_SCHPO Kinesin-like protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp5 PE=1 SV=1 7 395 6.0E-59
sp|Q86VH2|KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens GN=KIF27 PE=2 SV=1 9 391 9.0E-59
sp|Q9US60|KLP3_SCHPO Kinesin-like protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp3 PE=2 SV=1 9 387 3.0E-58
sp|Q6S001|KIF11_DICDI Kinesin-related protein 11 OS=Dictyostelium discoideum GN=kif11 PE=3 SV=1 77 445 1.0E-57
sp|P34540|KINH_CAEEL Kinesin heavy chain OS=Caenorhabditis elegans GN=unc-116 PE=2 SV=2 2 378 2.0E-57
sp|P17120|BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimC PE=2 SV=2 6 397 2.0E-57
sp|Q8J1G4|KIP1_ASHGO Kinesin-like protein KIP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP1 PE=3 SV=1 8 478 3.0E-57
sp|Q498L9|KI15B_XENLA Kinesin-like protein KIF15-B OS=Xenopus laevis GN=kif15-b PE=1 SV=1 81 390 3.0E-57
sp|P53086|KIP3_YEAST Kinesin-like protein KIP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP3 PE=1 SV=1 47 393 5.0E-57
sp|O23826|K125_TOBAC 125 kDa kinesin-related protein OS=Nicotiana tabacum GN=TKRP125 PE=1 SV=1 8 394 5.0E-57
sp|B2GU58|KIF11_XENTR Kinesin-like protein KIF11 OS=Xenopus tropicalis GN=kif11 PE=2 SV=1 8 478 1.0E-56
sp|P82266|K125_ARATH Probable 125 kDa kinesin-related protein OS=Arabidopsis thaliana GN=At2g36200 PE=2 SV=2 8 449 1.0E-56
sp|Q91783|KI11A_XENLA Kinesin-like protein KIF11-A OS=Xenopus laevis GN=kif11-a PE=1 SV=1 8 469 2.0E-56
sp|B7ZNG0|KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus GN=Kif7 PE=1 SV=1 4 382 2.0E-56
sp|P28025|KI11B_XENLA Kinesin-like protein KIF11-B OS=Xenopus laevis GN=kif11-b PE=1 SV=2 8 469 3.0E-56
sp|Q7Z4S6|KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens GN=KIF21A PE=1 SV=2 82 391 4.0E-56
sp|Q9QXL2|KI21A_MOUSE Kinesin-like protein KIF21A OS=Mus musculus GN=Kif21a PE=1 SV=2 1 391 5.0E-56
sp|Q91785|KI15A_XENLA Kinesin-like protein KIF15-A OS=Xenopus laevis GN=kif15-a PE=1 SV=1 81 390 5.0E-56
sp|P35978|KINH_STRPU Kinesin heavy chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1 372 6.0E-56
sp|P46863|KL61_DROME Bipolar kinesin KRP-130 OS=Drosophila melanogaster GN=Klp61F PE=1 SV=2 8 471 7.0E-56
sp|O59751|KLP6_SCHPO Kinesin-like protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp6 PE=1 SV=1 26 400 8.0E-55
sp|Q2M1P5|KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens GN=KIF7 PE=1 SV=2 4 378 1.0E-54
sp|P28742|KIP1_YEAST Kinesin-like protein KIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP1 PE=1 SV=1 2 445 1.0E-53
sp|Q58G59|KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio GN=kif7 PE=1 SV=1 9 372 1.0E-53
sp|Q6S002|KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum GN=kif10 PE=3 SV=1 11 394 8.0E-53
sp|P46874|KLP2_BOMMO Kinesin-like protein KLP2 (Fragment) OS=Bombyx mori PE=2 SV=1 8 366 3.0E-52
sp|Q6ZMV9|KIF6_HUMAN Kinesin-like protein KIF6 OS=Homo sapiens GN=KIF6 PE=1 SV=3 81 410 6.0E-52
sp|Q8S905|NACK1_ARATH Kinesin-like protein NACK1 OS=Arabidopsis thaliana GN=NACK1 PE=1 SV=1 9 403 2.0E-51
sp|O35231|KIFC3_MOUSE Kinesin-like protein KIFC3 OS=Mus musculus GN=Kifc3 PE=1 SV=4 7 366 8.0E-51
sp|Q8J1G7|CIN8_ASHGO Kinesin-like protein CIN8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIN8 PE=3 SV=1 8 483 9.0E-51
sp|P46870|KLP1_CHLRE Kinesin-like protein KLP1 OS=Chlamydomonas reinhardtii GN=KLP1 PE=2 SV=1 9 395 2.0E-50
sp|Q9BVG8|KIFC3_HUMAN Kinesin-like protein KIFC3 OS=Homo sapiens GN=KIFC3 PE=1 SV=4 7 366 4.0E-50
sp|Q9HAQ2|KIF9_HUMAN Kinesin-like protein KIF9 OS=Homo sapiens GN=KIF9 PE=1 SV=4 80 395 8.0E-50
sp|Q8J1G1|KIP2_ASHGO Kinesin-like protein KIP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP2 PE=3 SV=1 62 455 1.0E-49
sp|Q96FN5|KIF12_HUMAN Kinesin-like protein KIF12 OS=Homo sapiens GN=KIF12 PE=1 SV=3 3 391 3.0E-49
sp|Q8S950|NACK1_TOBAC Kinesin-like protein NACK1 OS=Nicotiana tabacum GN=NACK1 PE=1 SV=1 9 394 4.0E-49
sp|Q9WV04|KIF9_MOUSE Kinesin-like protein KIF9 OS=Mus musculus GN=Kif9 PE=1 SV=2 80 395 1.0E-48
sp|P79955|CTK2_XENLA Carboxy-terminal kinesin 2 OS=Xenopus laevis PE=2 SV=1 7 361 2.0E-48
sp|F4JGP4|ATK5_ARATH Kinesin-5 OS=Arabidopsis thaliana GN=ATK5 PE=2 SV=1 7 359 3.0E-48
sp|Q07970|ATK1_ARATH Kinesin-1 OS=Arabidopsis thaliana GN=ATK1 PE=2 SV=1 7 359 5.0E-48
sp|Q8S949|NACK2_TOBAC Kinesin-like protein NACK2 OS=Nicotiana tabacum GN=NACK2 PE=1 SV=1 9 394 6.0E-48
sp|Q1MTQ1|TEA2_SCHPO Kinesin-like protein tea2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea2 PE=1 SV=1 85 365 1.0E-47
sp|Q9FHN8|KCBP_ARATH Kinesin-like calmodulin-binding protein OS=Arabidopsis thaliana GN=KCBP PE=1 SV=1 7 401 1.0E-47
sp|P46864|ATK2_ARATH Kinesin-2 OS=Arabidopsis thaliana GN=ATK2 PE=2 SV=1 7 359 2.0E-47
sp|O81635|ATK4_ARATH Kinesin-4 OS=Arabidopsis thaliana GN=ATK4 PE=1 SV=2 7 415 2.0E-47
sp|Q9D2Z8|KIF12_MOUSE Kinesin-like protein KIF12 OS=Mus musculus GN=Kif12 PE=1 SV=1 3 391 7.0E-47
sp|Q6RZZ9|KIF13_DICDI Kinesin-related protein 13 OS=Dictyostelium discoideum GN=kif13 PE=1 SV=1 8 391 9.0E-47
sp|Q7XPJ0|KCBP_ORYSJ Kinesin-like calmodulin-binding protein homolog OS=Oryza sativa subsp. japonica GN=Os04g0666900 PE=2 SV=1 7 367 1.0E-46
sp|A8WFU8|KIF22_DANRE Kinesin-like protein KIF22 OS=Danio rerio GN=kif22 PE=2 SV=1 9 400 1.0E-46
sp|F9W301|KPSS1_ORYSJ Kinesin-1-like protein PSS1 OS=Oryza sativa subsp. japonica GN=PSS1 PE=1 SV=1 8 366 2.0E-46
sp|Q9UTL2|KLP8_SCHPO Kinesin-like protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp8 PE=1 SV=1 7 372 4.0E-46
sp|P28739|KLPA_EMENI Kinesin-like protein klpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=klpA PE=2 SV=3 7 359 4.0E-46
sp|P46875|ATK3_ARATH Kinesin-3 OS=Arabidopsis thaliana GN=ATK3 PE=2 SV=1 62 359 5.0E-46
sp|Q5REP4|KIF22_PONAB Kinesin-like protein KIF22 OS=Pongo abelii GN=KIF22 PE=2 SV=1 9 373 8.0E-46
sp|Q5I0E8|KIF22_RAT Kinesin-like protein KIF22 OS=Rattus norvegicus GN=Kif22 PE=2 SV=1 57 373 1.0E-45
sp|Q14807|KIF22_HUMAN Kinesin-like protein KIF22 OS=Homo sapiens GN=KIF22 PE=1 SV=5 9 373 1.0E-45
sp|P23678|UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans GN=unc-104 PE=2 SV=4 793 1402 2.0E-45
sp|Q3V300|KIF22_MOUSE Kinesin-like protein KIF22 OS=Mus musculus GN=Kif22 PE=2 SV=2 57 373 2.0E-45
sp|Q6P3R1|KIF22_XENTR Kinesin-like protein KIF22 OS=Xenopus tropicalis GN=kif22 PE=2 SV=1 9 373 2.0E-45
sp|Q9I869|KF22A_XENLA Kinesin-like protein KIF22-A OS=Xenopus laevis GN=kif22-a PE=1 SV=1 9 373 2.0E-45
sp|A6QPL4|KIF22_BOVIN Kinesin-like protein KIF22 OS=Bos taurus GN=KIF22 PE=2 SV=2 57 373 2.0E-45
sp|P45962|KLP3_CAEEL Kinesin-like protein klp-3 OS=Caenorhabditis elegans GN=klp-3 PE=1 SV=1 6 369 3.0E-45
sp|O60333|KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens GN=KIF1B PE=1 SV=5 430 654 4.0E-45
sp|Q5T7B8|KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens GN=KIF24 PE=1 SV=2 9 366 4.0E-45
sp|Q6NWW5|KIF24_MOUSE Kinesin-like protein KIF24 OS=Mus musculus GN=Kif24 PE=1 SV=2 9 366 5.0E-45
sp|Q7ZYL5|KF22B_XENLA Kinesin-like protein KIF22-B OS=Xenopus laevis GN=kif22-b PE=2 SV=2 58 478 7.0E-45
sp|P24339|CUT7_SCHPO Kinesin-like protein cut7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut7 PE=3 SV=3 1 391 1.0E-44
sp|Q9BPU3|KIF2_DICDI Kinesin-related protein 2 OS=Dictyostelium discoideum GN=kif2 PE=2 SV=1 7 359 4.0E-44
sp|Q8LNZ2|NACK2_ARATH Kinesin-like protein NACK2 OS=Arabidopsis thaliana GN=NACK2 PE=1 SV=1 9 394 4.0E-44
sp|Q8W1Y3|KP1_ARATH Kinesin KP1 OS=Arabidopsis thaliana GN=KP1 PE=1 SV=2 7 392 6.0E-44
sp|Q9US03|KLP2_SCHPO Kinesin-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp2 PE=3 SV=1 7 359 9.0E-44
sp|A1ZAJ2|KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster GN=unc-104 PE=1 SV=1 796 1402 4.0E-43
sp|P17119|KAR3_YEAST Kinesin-like protein KAR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR3 PE=1 SV=1 7 362 6.0E-43
sp|Q6S004|KIF6_DICDI Kinesin-related protein 6 OS=Dictyostelium discoideum GN=kif6 PE=2 SV=1 1 365 1.0E-42
sp|P70096|KIF2C_CRIGR Kinesin-like protein KIF2C OS=Cricetulus griseus GN=KIF2C PE=1 SV=2 9 451 8.0E-42
sp|Q922S8|KIF2C_MOUSE Kinesin-like protein KIF2C OS=Mus musculus GN=Kif2c PE=1 SV=1 9 365 1.0E-41
sp|P56536|KIF5C_RAT Kinesin heavy chain isoform 5C (Fragment) OS=Rattus norvegicus GN=Kif5c PE=1 SV=2 1 267 5.0E-41
sp|P33173|KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus GN=Kif1a PE=1 SV=2 797 1402 7.0E-41
sp|P18105|NOD_DROME Kinesin-like protein Nod OS=Drosophila melanogaster GN=nod PE=1 SV=1 62 366 8.0E-41
sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein 3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1 9 390 1.0E-40
sp|Q8C0N1|KIF2B_MOUSE Kinesin-like protein KIF2B OS=Mus musculus GN=Kif2b PE=1 SV=1 6 365 2.0E-40
sp|Q62909|KIF2C_RAT Kinesin-like protein KIF2C OS=Rattus norvegicus GN=Kif2c PE=2 SV=3 9 365 3.0E-40
sp|A6H750|KIF2B_BOVIN Kinesin-like protein KIF2B OS=Bos taurus GN=KIF2B PE=2 SV=1 3 365 4.0E-40
sp|Q95LP1|KIF2C_MACFA Kinesin-like protein KIF2C OS=Macaca fascicularis GN=KIF2C PE=2 SV=1 9 365 9.0E-40
sp|P28743|KIP2_YEAST Kinesin-like protein KIP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP2 PE=1 SV=1 62 395 1.0E-39
sp|Q60443|KIFC1_CRIGR Kinesin-like protein KIFC1 OS=Cricetulus griseus PE=2 SV=1 7 372 2.0E-39
sp|Q555I8|KIF9_DICDI Kinesin-related protein 9 OS=Dictyostelium discoideum GN=kif9 PE=2 SV=1 7 394 3.0E-39
sp|Q960Z0|KI10A_DROME Kinesin-like protein Klp10A OS=Drosophila melanogaster GN=Klp10A PE=1 SV=1 6 375 3.0E-39
sp|Q99661|KIF2C_HUMAN Kinesin-like protein KIF2C OS=Homo sapiens GN=KIF2C PE=1 SV=2 9 365 3.0E-39
sp|Q91637|KIF2A_XENLA Kinesin-like protein KIF2A OS=Xenopus laevis GN=kif2a PE=1 SV=2 9 365 4.0E-39
sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2 SV=1 9 413 7.0E-39
sp|P28740|KIF2A_MOUSE Kinesin-like protein KIF2A OS=Mus musculus GN=Kif2a PE=1 SV=2 9 365 7.0E-39
sp|Q92376|KLP1_SCHPO Kinesin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp1 PE=2 SV=2 7 366 7.0E-39
sp|Q9BW19|KIFC1_HUMAN Kinesin-like protein KIFC1 OS=Homo sapiens GN=KIFC1 PE=1 SV=2 7 372 8.0E-39
sp|Q5XI51|KIF2B_RAT Kinesin-like protein KIF2B OS=Rattus norvegicus GN=Kif2b PE=2 SV=2 6 365 8.0E-39
sp|O00139|KIF2A_HUMAN Kinesin-like protein KIF2A OS=Homo sapiens GN=KIF2A PE=1 SV=3 9 365 9.0E-39
sp|Q8N4N8|KIF2B_HUMAN Kinesin-like protein KIF2B OS=Homo sapiens GN=KIF2B PE=1 SV=3 9 365 1.0E-38
sp|Q9WV63|KIF2A_RAT Kinesin-like protein KIF2A OS=Rattus norvegicus GN=Kif2a PE=1 SV=2 9 365 1.0E-38
sp|Q17BU3|KIF1A_AEDAE Kinesin-like protein unc-104 OS=Aedes aegypti GN=unc-104 PE=3 SV=1 1133 1596 2.0E-38
sp|Q9W1U4|KI59C_DROME Kinesin-like protein Klp59C OS=Drosophila melanogaster GN=Klp59C PE=3 SV=1 9 379 2.0E-38
sp|Q5R9Y9|KIF2A_PONAB Kinesin-like protein KIF2A OS=Pongo abelii GN=KIF2A PE=2 SV=1 9 365 2.0E-38
sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2 80 394 3.0E-38
sp|Q2NL05|KIF2A_BOVIN Kinesin-like protein KIF2A OS=Bos taurus GN=KIF2A PE=2 SV=1 9 365 3.0E-38
sp|Q95LT1|KIF2B_MACFA Kinesin-like protein KIF2B OS=Macaca fascicularis GN=KIF2B PE=2 SV=1 9 365 3.0E-38
sp|P20480|NCD_DROME Protein claret segregational OS=Drosophila melanogaster GN=ncd PE=1 SV=1 7 366 5.0E-38
sp|Q5ZKV8|KIF2A_CHICK Kinesin-like protein KIF2A OS=Gallus gallus GN=KIF2A PE=2 SV=2 9 365 7.0E-38
sp|Q5XI63|KIFC1_RAT Kinesin-like protein KIFC1 OS=Rattus norvegicus GN=Kifc1 PE=2 SV=1 7 372 1.0E-37
sp|E9Q5G3|KIF23_MOUSE Kinesin-like protein KIF23 OS=Mus musculus GN=Kif23 PE=1 SV=1 9 366 3.0E-37
sp|Q9QWT9|KIFC1_MOUSE Kinesin-like protein KIFC1 OS=Mus musculus GN=Kifc1 PE=1 SV=2 7 372 9.0E-37
sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIN8 PE=3 SV=1 185 401 1.0E-36
sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN8 PE=1 SV=3 187 401 2.0E-36
sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2 SV=2 9 476 2.0E-36
sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2 7 457 3.0E-36
sp|Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens GN=KIFC2 PE=2 SV=1 7 345 3.0E-36
sp|Q91636|KIF2C_XENLA Kinesin-like protein KIF2C OS=Xenopus laevis GN=kif2c PE=1 SV=2 4 379 9.0E-36
sp|Q940B8|KIN13_ARATH Kinesin-13A OS=Arabidopsis thaliana GN=KINESIN-13A PE=1 SV=1 9 377 1.0E-35
sp|Q02241|KIF23_HUMAN Kinesin-like protein KIF23 OS=Homo sapiens GN=KIF23 PE=1 SV=3 9 366 1.0E-33
sp|Q60575|KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus GN=Kif1b PE=1 SV=2 1135 1399 2.0E-32
sp|O60333|KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens GN=KIF1B PE=1 SV=5 1135 1399 2.0E-32
sp|O08672|KIFC2_MOUSE Kinesin-like protein KIFC2 OS=Mus musculus GN=Kifc2 PE=1 SV=1 7 366 3.0E-32
sp|O95235|KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens GN=KIF20A PE=1 SV=1 149 470 5.0E-32
sp|P97329|KI20A_MOUSE Kinesin-like protein KIF20A OS=Mus musculus GN=Kif20a PE=2 SV=1 149 470 2.0E-31
sp|Q7PHR1|KIF1A_ANOGA Kinesin-like protein unc-104 OS=Anopheles gambiae GN=unc-104 PE=3 SV=3 1133 1402 5.0E-31
sp|O88658|KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus GN=Kif1b PE=1 SV=2 1135 1399 7.0E-31
sp|Q29RT6|KI20A_BOVIN Kinesin-like protein KIF20A OS=Bos taurus GN=KIF20A PE=2 SV=1 149 470 2.0E-30
sp|Q9V877|SUB_DROME Kinesin-like protein subito OS=Drosophila melanogaster GN=sub PE=1 SV=1 141 365 2.0E-30
sp|Q9FKP4|KCA2_ARATH Kinesin-like protein KCA2 OS=Arabidopsis thaliana GN=KCA2 PE=1 SV=1 7 363 1.0E-29
sp|Q12756|KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens GN=KIF1A PE=1 SV=2 1143 1402 3.0E-29
sp|Q9UIL4|KIF25_HUMAN Kinesin-like protein KIF25 OS=Homo sapiens GN=KIF25 PE=2 SV=2 59 378 4.0E-29
sp|Q6S000|KIF12_DICDI Kinesin-related protein 12 OS=Dictyostelium discoideum GN=kif12 PE=3 SV=1 150 365 6.0E-29
sp|Q28WQ1|KIF1A_DROPS Kinesin-like protein unc-104 OS=Drosophila pseudoobscura pseudoobscura GN=unc-104 PE=3 SV=1 1133 1402 8.0E-29
sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum GN=kif8 PE=2 SV=1 254 391 8.0E-29
sp|Q96Q89|KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens GN=KIF20B PE=1 SV=3 150 365 3.0E-27
sp|Q80WE4|KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus GN=Kif20b PE=1 SV=3 149 365 6.0E-27
sp|P32364|SMY1_YEAST Kinesin-related protein SMY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMY1 PE=1 SV=1 62 372 8.0E-27
sp|Q9LX99|KCA1_ARATH Kinesin-like protein KCA1 OS=Arabidopsis thaliana GN=KCA1 PE=1 SV=1 7 363 1.0E-26
sp|Q39493|DSK1_CYLFU Diatom spindle kinesin-1 OS=Cylindrotheca fusiformis GN=DSK1 PE=2 SV=1 93 364 1.0E-26
sp|Q7TNC6|KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus GN=Kif26b PE=1 SV=3 5 365 9.0E-26
sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum GN=kif8 PE=2 SV=1 9 237 7.0E-25
sp|Q2KJY2|KI26B_HUMAN Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=2 SV=1 5 365 2.0E-24
sp|Q52KG5|KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus GN=Kif26a PE=1 SV=2 7 368 4.0E-24
sp|Q9ULI4|KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens GN=KIF26A PE=2 SV=3 7 368 2.0E-21
sp|Q1MTQ7|KLP9_SCHPO Kinesin-like motor protein 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp9 PE=1 SV=2 37 365 1.0E-19
sp|O16844|COS_DROME Kinesin-like protein costa OS=Drosophila melanogaster GN=cos PE=1 SV=2 77 381 2.0E-18
sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIN8 PE=3 SV=1 8 176 2.0E-16
sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN8 PE=1 SV=3 8 176 2.0E-14
sp|Q292S8|COS_DROPS Kinesin-like protein costa OS=Drosophila pseudoobscura pseudoobscura GN=cos PE=3 SV=2 81 372 6.0E-14
sp|Q7PHR1|KIF1A_ANOGA Kinesin-like protein unc-104 OS=Anopheles gambiae GN=unc-104 PE=3 SV=3 796 1007 1.0E-12
sp|Q28WQ1|KIF1A_DROPS Kinesin-like protein unc-104 OS=Drosophila pseudoobscura pseudoobscura GN=unc-104 PE=3 SV=1 796 971 2.0E-12
sp|Q17BU3|KIF1A_AEDAE Kinesin-like protein unc-104 OS=Aedes aegypti GN=unc-104 PE=3 SV=1 796 971 2.0E-11
sp|Q60575|KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus GN=Kif1b PE=1 SV=2 729 972 3.0E-09
sp|Q29RT6|KI20A_BOVIN Kinesin-like protein KIF20A OS=Bos taurus GN=KIF20A PE=2 SV=1 2 169 4.0E-09
sp|Q12756|KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens GN=KIF1A PE=1 SV=2 797 992 1.0E-08
sp|O88658|KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus GN=Kif1b PE=1 SV=2 729 972 2.0E-08
sp|O60333|KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens GN=KIF1B PE=1 SV=5 729 940 4.0E-08
sp|Q6PDH0|PHLB1_MOUSE Pleckstrin homology-like domain family B member 1 OS=Mus musculus GN=Phldb1 PE=1 SV=1 442 594 1.0E-07
sp|Q86UU1|PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens GN=PHLDB1 PE=1 SV=1 480 594 2.0E-07
sp|Q12756|KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens GN=KIF1A PE=1 SV=2 1489 1596 4.0E-07
sp|P97329|KI20A_MOUSE Kinesin-like protein KIF20A OS=Mus musculus GN=Kif20a PE=2 SV=1 9 167 5.0E-07
sp|P33173|KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus GN=Kif1a PE=1 SV=2 1489 1596 9.0E-07
sp|A1ZAJ2|KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster GN=unc-104 PE=1 SV=1 1488 1596 2.0E-06
sp|Q7PHR1|KIF1A_ANOGA Kinesin-like protein unc-104 OS=Anopheles gambiae GN=unc-104 PE=3 SV=3 1488 1596 3.0E-06
sp|P23678|UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans GN=unc-104 PE=2 SV=4 1501 1596 3.0E-06
sp|O88658|KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus GN=Kif1b PE=1 SV=2 1463 1596 4.0E-06
sp|Q28WQ1|KIF1A_DROPS Kinesin-like protein unc-104 OS=Drosophila pseudoobscura pseudoobscura GN=unc-104 PE=3 SV=1 1488 1596 6.0E-06
sp|O95235|KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens GN=KIF20A PE=1 SV=1 9 167 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003777 microtubule motor activity Yes
GO:0005515 protein binding Yes
GO:0005524 ATP binding Yes
GO:0008017 microtubule binding Yes
GO:0007018 microtubule-based movement Yes
GO:0008092 cytoskeletal protein binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0007017 microtubule-based process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0140657 ATP-dependent activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0015631 tubulin binding No
GO:0003774 cytoskeletal motor activity No
GO:0032553 ribonucleotide binding No
GO:0009987 cellular process No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|076570
MAEAGDGNIKVVVRCRPLNTRELARGAKCLIRMQGNQTLLDPPETGSSQDSKRATERKTMPFSFDKSYWSAGPRD
DPGYCSQQTLYDDLGKELLDHGFSGFNACILAYGQTGSGKSYSMMGYGQDKGIIPLTCSELFQRVESKKAQDPNI
NFTVEVSYIEIYNEKVRDLLNPKNTGNLRVREHPSLGPYVEDLSKLVVTSYEGMMTLMDEGNKARTVAATNMNET
SSRSHAVFTLLLTMKRHDNDTNLDTEKVSRISLVDLAGSERANSTGATGQRLKEGANINKSLTTLGKVISALAVQ
SSSEGKKGKKGKAEEFIPYRDSVLTWLLKDSLGGNSKTAMIAAISPADYEETLSTLRYADQAKKIKNKAVVNEDP
NAKLVRELKEELETLRARVAGSSGEEHFDPKIPAEKQIVTYQTKEGVIKKVTKAELQEQMETREKLMNELNETWE
QKLVRTQEVQKEREKALEELGITVEKNLVGVHTPKKMPHLVNLNEDPLMSECLIYQIKPGKTLVGRLDNEKPAAI
RLSGDKILEEHCYFDNIDGKVTLECMPDSITFLNGKQIAAGQPHKLRSGFRIIMGDNHVFRFNNPEEVRKKRDRA
TAKSNLHMSISAADLEGAEGSPRPESPTTSEDDRGDVDWTFAQREAAFARLGLDPTLDNLPDDDLNKLFEKITRV
KTLRDINSKPRPESSLSQADDIWSEAGGRPLPSEAPTDDTSLHGSPAVDDSLKDAQHHLENRLNEIQENGVMSNV
EAEDLKAEKEHMELQLNRVRTQMKRLIDARARGETEFEGMDFEPVIYSARQLRLIRKVLDKWRAHRSFSMAEMIL
TNAVAVKETNIISKELGKSVSYNFAIASGGSLAAPVSAIDSIAGLDQFGDVADPILRSNTQPSVAVKVIDRKHNA
IYVWSLDRLQQQLQRMRNLTTYIDRPSYTQHFSSDEPFYDSPPPEYSFIGNALISLAPLSRRLSSSSTVAIFCRY
TAEAIGSCRVDIKLVSAISPSKYASASSASTRASSPVPGTIHPGTKLNFFLTVDSVKGLSPHDFSAIHLQIRLSS
FVGAAVTSEEVFPSSAIDIDHASLSELKFRRSFTIVASSKVLNHLRQGYAPIEFFATLKPTYLERMERWDEMRDQ
KQNYTPRVPSPPNPNLPLPPSPSRPASSLSPMRRSENEFMVEQMHDVIAWVQICELGLNGSYVPVPVISQGSIDP
GAFSLHQGLQRRIVVNLSSNSGQQLPWSEFTKIRIGNVRLLDAKGRMHDSTSRALVTLALQKEQNLEFKRDGTGT
LSAEALWDSSMHDSVLLNRVTAANQRIILKLTWGVAVDICQEPVQFSMDVAIAMHARDASPPSKFLTFFASNKVL
AKSSTLFSVKLSPPLTRSAKDLWRLDTSEKYVRGEETLGAWKPRGITVVEDYGRLITTERRAADVQAIRVIVATN
PPRQIQADALVWKGEDILRRSVQLWQKQFGHRGKITLSQEPDPEETIPNGKTERMENAEAFKYISETRVIPRSDS
TTKKGHLLILSDASQNTWERRWFVLRRPYLHMYAHSNELEELGIISLSGVNVESDPRKESLLGKPYSFTLFTASN
SHALAAPSLKELQSWTTKLDPTRLPG*
Coding >AgabiH97|076570
ATGGCCGAGGCTGGAGATGGCAACATCAAAGTCGTCGTCCGCTGCCGCCCCCTAAATACTCGCGAACTCGCCAGG
GGAGCCAAATGCCTCATTCGCATGCAAGGGAATCAGACCTTGTTAGACCCGCCAGAAACTGGCTCATCCCAGGAC
TCGAAGCGTGCAACCGAGCGCAAGACAATGCCCTTTAGCTTTGATAAAAGTTACTGGAGTGCTGGCCCACGCGAT
GACCCCGGTTACTGTTCCCAACAGACTTTGTACGACGACTTAGGAAAGGAACTCTTGGACCATGGCTTTTCTGGC
TTCAATGCGTGTATCCTTGCCTATGGTCAAACAGGTTCTGGCAAGTCCTACAGTATGATGGGCTATGGTCAAGAC
AAGGGCATCATCCCACTCACCTGTTCCGAACTTTTCCAACGTGTCGAGTCGAAGAAAGCACAAGATCCCAACATC
AACTTTACCGTCGAAGTCTCCTACATCGAGATCTACAATGAAAAAGTCCGTGACCTTCTCAACCCAAAGAACACC
GGCAACCTTCGCGTTCGTGAACATCCAAGTCTAGGTCCCTACGTCGAAGATCTATCCAAGCTCGTGGTAACGAGC
TACGAGGGTATGATGACACTCATGGATGAGGGGAACAAAGCGCGTACTGTGGCTGCTACCAATATGAATGAAACC
TCTTCACGTTCACATGCTGTCTTTACTCTCCTTCTCACAATGAAACGGCACGATAACGACACGAACCTCGACACC
GAAAAGGTTTCGCGTATCAGTCTCGTCGATTTGGCAGGTTCCGAACGCGCCAATTCAACGGGTGCGACAGGTCAA
CGTCTCAAGGAAGGTGCCAACATCAACAAATCCCTAACCACCCTTGGTAAAGTCATTTCTGCTCTCGCTGTGCAA
AGTTCATCAGAGGGTAAGAAGGGAAAGAAGGGGAAGGCTGAAGAGTTCATACCCTACCGTGATTCTGTCCTTACA
TGGCTCCTTAAAGACAGTCTTGGTGGTAATTCCAAAACTGCCATGATAGCTGCAATCTCGCCCGCCGATTATGAA
GAAACACTGAGCACGTTGCGCTATGCCGATCAAGCGAAGAAGATCAAGAACAAAGCTGTAGTGAACGAGGATCCC
AATGCGAAGTTGGTCAGAGAGCTCAAGGAGGAATTGGAAACGCTCAGAGCCCGCGTTGCGGGATCAAGCGGCGAA
GAACATTTTGATCCCAAAATTCCCGCTGAAAAGCAAATTGTGACTTATCAGACCAAGGAAGGTGTCATCAAAAAG
GTCACCAAAGCAGAGTTGCAGGAACAGATGGAAACGCGAGAAAAGTTGATGAATGAGTTGAATGAGACTTGGGAA
CAGAAGTTGGTGAGAACTCAGGAGGTACAGAAGGAGCGGGAGAAGGCGTTGGAGGAGTTGGGTATTACGGTCGAG
AAGAACTTGGTCGGTGTGCATACACCCAAGAAGATGCCTCATCTCGTGAATTTGAACGAAGATCCTCTGATGAGC
GAGTGTCTGATATATCAAATCAAACCCGGAAAGACACTCGTTGGGAGGTTAGACAACGAGAAACCCGCCGCGATT
CGCTTAAGTGGAGACAAAATCCTAGAAGAACACTGCTATTTCGATAATATAGATGGTAAAGTCACGCTAGAGTGT
ATGCCTGACAGTATTACGTTTCTAAATGGGAAGCAAATCGCGGCCGGGCAGCCTCATAAACTTCGATCTGGGTTT
CGTATCATCATGGGTGATAACCATGTATTTCGATTTAACAACCCGGAGGAAGTGCGAAAGAAACGAGATCGCGCA
ACTGCCAAATCCAATCTTCACATGAGCATCTCCGCTGCTGATCTGGAGGGAGCAGAAGGTTCCCCTCGTCCCGAA
TCTCCGACAACCTCAGAAGACGACCGAGGTGACGTTGATTGGACTTTTGCGCAACGTGAAGCAGCTTTTGCACGA
TTGGGTTTGGACCCGACTTTGGATAACCTGCCGGATGATGACTTGAACAAGTTGTTTGAGAAGATTACTAGAGTC
AAGACGTTGAGGGATATTAATTCTAAACCTCGCCCGGAAAGTAGTCTTTCACAAGCGGATGATATTTGGAGTGAA
GCTGGTGGAAGGCCGTTACCAAGTGAAGCTCCTACGGATGATACGAGTTTACATGGAAGTCCCGCCGTAGATGAT
TCCCTCAAAGACGCTCAACACCATCTCGAGAATAGATTAAACGAAATCCAGGAGAATGGTGTAATGTCGAATGTA
GAGGCAGAAGATTTGAAAGCGGAGAAGGAGCATATGGAACTTCAATTGAACCGCGTTCGTACTCAGATGAAGAGG
CTAATTGATGCACGGGCTAGAGGGGAAACGGAATTCGAAGGGATGGATTTTGAACCTGTCATTTACTCTGCGAGA
CAGTTACGGCTTATACGCAAGGTTTTGGACAAGTGGAGGGCTCATAGATCATTTTCAATGGCGGAAATGATCTTG
ACCAATGCGGTCGCTGTGAAGGAAACAAATATCATCAGTAAAGAATTGGGGAAATCTGTTTCCTATAATTTTGCG
ATCGCATCTGGGGGATCGCTGGCCGCTCCAGTATCTGCGATCGATAGCATCGCAGGTTTAGACCAATTCGGTGAC
GTTGCAGATCCAATTCTGCGTTCGAATACCCAGCCTTCTGTGGCAGTTAAAGTCATCGATCGCAAACACAATGCG
ATTTATGTATGGTCCCTGGATAGGCTACAGCAACAACTACAACGCATGCGTAATCTCACAACCTATATCGATCGG
CCTTCGTATACCCAACATTTCTCTTCTGACGAACCCTTCTATGATTCCCCGCCTCCTGAATACTCCTTTATTGGC
AATGCATTAATCTCACTTGCACCACTTTCTCGTCGATTATCGTCTTCTTCGACTGTTGCGATTTTCTGCAGATAT
ACTGCAGAAGCTATCGGTTCCTGTCGTGTTGATATCAAACTTGTCAGCGCGATATCGCCGTCGAAGTATGCTAGT
GCTTCGTCTGCGTCTACGCGCGCTTCATCCCCTGTCCCCGGAACTATTCATCCAGGCACTAAGCTCAATTTCTTC
TTGACGGTGGATTCTGTCAAGGGACTTTCACCACATGATTTCTCTGCCATTCACCTCCAAATTCGGTTATCGTCA
TTCGTAGGGGCCGCCGTGACATCTGAAGAAGTGTTTCCTTCGTCAGCGATTGATATTGACCACGCGTCGTTATCA
GAACTCAAGTTCCGGCGAAGTTTTACGATAGTCGCATCGTCCAAGGTTTTGAACCACTTACGGCAAGGATATGCG
CCTATAGAATTCTTTGCGACTTTGAAGCCTACCTATTTGGAACGGATGGAAAGATGGGATGAGATGCGTGACCAG
AAGCAAAATTATACCCCTCGAGTACCTTCGCCCCCGAATCCAAATTTGCCTCTGCCGCCGTCTCCGTCTCGACCT
GCTTCCTCATTGAGTCCGATGCGCCGGTCAGAGAATGAATTTATGGTTGAGCAAATGCATGATGTTATTGCTTGG
GTTCAGATATGCGAGTTGGGGCTTAATGGGTCCTATGTCCCTGTACCAGTGATCTCCCAAGGAAGCATCGACCCC
GGAGCGTTCTCTCTTCATCAAGGACTTCAACGTAGGATCGTGGTCAATCTCTCATCGAATTCTGGGCAGCAACTT
CCTTGGTCGGAGTTTACCAAGATACGAATTGGGAACGTGAGGCTTCTGGATGCGAAAGGACGCATGCATGACTCG
ACTTCAAGAGCACTCGTGACTTTGGCTTTGCAGAAGGAACAGAATTTAGAGTTTAAACGAGACGGGACGGGTACT
CTGTCTGCAGAAGCACTTTGGGATTCGAGTATGCATGATTCGGTGTTGCTTAATCGCGTCACTGCGGCAAACCAA
AGGATCATTTTGAAACTGACGTGGGGAGTGGCGGTGGATATATGTCAGGAACCCGTGCAGTTTAGTATGGATGTG
GCGATTGCCATGCATGCAAGGGATGCGAGTCCACCGTCGAAGTTTCTGACATTCTTCGCCTCGAACAAGGTCCTT
GCAAAGTCGAGTACCTTGTTTAGTGTCAAGTTATCGCCGCCTTTGACAAGATCGGCGAAGGATTTGTGGAGGTTG
GATACGTCGGAGAAATATGTGAGGGGTGAAGAGACGCTTGGTGCTTGGAAACCCCGAGGTATAACGGTTGTGGAA
GATTATGGTCGCTTGATCACGACCGAGCGGCGAGCTGCTGATGTACAAGCTATCAGAGTTATTGTGGCTACAAAT
CCACCCCGTCAAATTCAGGCTGATGCTTTGGTCTGGAAAGGAGAAGATATCCTGAGACGCTCTGTCCAACTCTGG
CAGAAGCAATTTGGTCATCGTGGGAAGATCACTCTCAGCCAAGAACCTGATCCTGAGGAGACTATACCGAACGGA
AAGACAGAGAGGATGGAGAATGCAGAAGCATTCAAATATATTTCCGAAACGAGAGTGATACCCCGGAGTGACAGC
ACGACGAAGAAAGGACACCTCCTGATCCTCAGTGACGCAAGTCAGAACACTTGGGAGCGACGATGGTTTGTGTTA
AGAAGACCATACTTACATATGTATGCACACTCCAACGAACTGGAAGAACTTGGCATAATTAGTCTTTCCGGTGTC
AATGTGGAAAGCGATCCTCGCAAAGAATCTCTCCTTGGCAAACCATATTCTTTTACTCTCTTTACCGCTTCCAAC
TCGCATGCCCTAGCTGCACCTAGTCTCAAAGAACTCCAGTCATGGACAACAAAACTAGACCCCACCCGGTTACCC
GGTTAA
Transcript >AgabiH97|076570
ATGGCCGAGGCTGGAGATGGCAACATCAAAGTCGTCGTCCGCTGCCGCCCCCTAAATACTCGCGAACTCGCCAGG
GGAGCCAAATGCCTCATTCGCATGCAAGGGAATCAGACCTTGTTAGACCCGCCAGAAACTGGCTCATCCCAGGAC
TCGAAGCGTGCAACCGAGCGCAAGACAATGCCCTTTAGCTTTGATAAAAGTTACTGGAGTGCTGGCCCACGCGAT
GACCCCGGTTACTGTTCCCAACAGACTTTGTACGACGACTTAGGAAAGGAACTCTTGGACCATGGCTTTTCTGGC
TTCAATGCGTGTATCCTTGCCTATGGTCAAACAGGTTCTGGCAAGTCCTACAGTATGATGGGCTATGGTCAAGAC
AAGGGCATCATCCCACTCACCTGTTCCGAACTTTTCCAACGTGTCGAGTCGAAGAAAGCACAAGATCCCAACATC
AACTTTACCGTCGAAGTCTCCTACATCGAGATCTACAATGAAAAAGTCCGTGACCTTCTCAACCCAAAGAACACC
GGCAACCTTCGCGTTCGTGAACATCCAAGTCTAGGTCCCTACGTCGAAGATCTATCCAAGCTCGTGGTAACGAGC
TACGAGGGTATGATGACACTCATGGATGAGGGGAACAAAGCGCGTACTGTGGCTGCTACCAATATGAATGAAACC
TCTTCACGTTCACATGCTGTCTTTACTCTCCTTCTCACAATGAAACGGCACGATAACGACACGAACCTCGACACC
GAAAAGGTTTCGCGTATCAGTCTCGTCGATTTGGCAGGTTCCGAACGCGCCAATTCAACGGGTGCGACAGGTCAA
CGTCTCAAGGAAGGTGCCAACATCAACAAATCCCTAACCACCCTTGGTAAAGTCATTTCTGCTCTCGCTGTGCAA
AGTTCATCAGAGGGTAAGAAGGGAAAGAAGGGGAAGGCTGAAGAGTTCATACCCTACCGTGATTCTGTCCTTACA
TGGCTCCTTAAAGACAGTCTTGGTGGTAATTCCAAAACTGCCATGATAGCTGCAATCTCGCCCGCCGATTATGAA
GAAACACTGAGCACGTTGCGCTATGCCGATCAAGCGAAGAAGATCAAGAACAAAGCTGTAGTGAACGAGGATCCC
AATGCGAAGTTGGTCAGAGAGCTCAAGGAGGAATTGGAAACGCTCAGAGCCCGCGTTGCGGGATCAAGCGGCGAA
GAACATTTTGATCCCAAAATTCCCGCTGAAAAGCAAATTGTGACTTATCAGACCAAGGAAGGTGTCATCAAAAAG
GTCACCAAAGCAGAGTTGCAGGAACAGATGGAAACGCGAGAAAAGTTGATGAATGAGTTGAATGAGACTTGGGAA
CAGAAGTTGGTGAGAACTCAGGAGGTACAGAAGGAGCGGGAGAAGGCGTTGGAGGAGTTGGGTATTACGGTCGAG
AAGAACTTGGTCGGTGTGCATACACCCAAGAAGATGCCTCATCTCGTGAATTTGAACGAAGATCCTCTGATGAGC
GAGTGTCTGATATATCAAATCAAACCCGGAAAGACACTCGTTGGGAGGTTAGACAACGAGAAACCCGCCGCGATT
CGCTTAAGTGGAGACAAAATCCTAGAAGAACACTGCTATTTCGATAATATAGATGGTAAAGTCACGCTAGAGTGT
ATGCCTGACAGTATTACGTTTCTAAATGGGAAGCAAATCGCGGCCGGGCAGCCTCATAAACTTCGATCTGGGTTT
CGTATCATCATGGGTGATAACCATGTATTTCGATTTAACAACCCGGAGGAAGTGCGAAAGAAACGAGATCGCGCA
ACTGCCAAATCCAATCTTCACATGAGCATCTCCGCTGCTGATCTGGAGGGAGCAGAAGGTTCCCCTCGTCCCGAA
TCTCCGACAACCTCAGAAGACGACCGAGGTGACGTTGATTGGACTTTTGCGCAACGTGAAGCAGCTTTTGCACGA
TTGGGTTTGGACCCGACTTTGGATAACCTGCCGGATGATGACTTGAACAAGTTGTTTGAGAAGATTACTAGAGTC
AAGACGTTGAGGGATATTAATTCTAAACCTCGCCCGGAAAGTAGTCTTTCACAAGCGGATGATATTTGGAGTGAA
GCTGGTGGAAGGCCGTTACCAAGTGAAGCTCCTACGGATGATACGAGTTTACATGGAAGTCCCGCCGTAGATGAT
TCCCTCAAAGACGCTCAACACCATCTCGAGAATAGATTAAACGAAATCCAGGAGAATGGTGTAATGTCGAATGTA
GAGGCAGAAGATTTGAAAGCGGAGAAGGAGCATATGGAACTTCAATTGAACCGCGTTCGTACTCAGATGAAGAGG
CTAATTGATGCACGGGCTAGAGGGGAAACGGAATTCGAAGGGATGGATTTTGAACCTGTCATTTACTCTGCGAGA
CAGTTACGGCTTATACGCAAGGTTTTGGACAAGTGGAGGGCTCATAGATCATTTTCAATGGCGGAAATGATCTTG
ACCAATGCGGTCGCTGTGAAGGAAACAAATATCATCAGTAAAGAATTGGGGAAATCTGTTTCCTATAATTTTGCG
ATCGCATCTGGGGGATCGCTGGCCGCTCCAGTATCTGCGATCGATAGCATCGCAGGTTTAGACCAATTCGGTGAC
GTTGCAGATCCAATTCTGCGTTCGAATACCCAGCCTTCTGTGGCAGTTAAAGTCATCGATCGCAAACACAATGCG
ATTTATGTATGGTCCCTGGATAGGCTACAGCAACAACTACAACGCATGCGTAATCTCACAACCTATATCGATCGG
CCTTCGTATACCCAACATTTCTCTTCTGACGAACCCTTCTATGATTCCCCGCCTCCTGAATACTCCTTTATTGGC
AATGCATTAATCTCACTTGCACCACTTTCTCGTCGATTATCGTCTTCTTCGACTGTTGCGATTTTCTGCAGATAT
ACTGCAGAAGCTATCGGTTCCTGTCGTGTTGATATCAAACTTGTCAGCGCGATATCGCCGTCGAAGTATGCTAGT
GCTTCGTCTGCGTCTACGCGCGCTTCATCCCCTGTCCCCGGAACTATTCATCCAGGCACTAAGCTCAATTTCTTC
TTGACGGTGGATTCTGTCAAGGGACTTTCACCACATGATTTCTCTGCCATTCACCTCCAAATTCGGTTATCGTCA
TTCGTAGGGGCCGCCGTGACATCTGAAGAAGTGTTTCCTTCGTCAGCGATTGATATTGACCACGCGTCGTTATCA
GAACTCAAGTTCCGGCGAAGTTTTACGATAGTCGCATCGTCCAAGGTTTTGAACCACTTACGGCAAGGATATGCG
CCTATAGAATTCTTTGCGACTTTGAAGCCTACCTATTTGGAACGGATGGAAAGATGGGATGAGATGCGTGACCAG
AAGCAAAATTATACCCCTCGAGTACCTTCGCCCCCGAATCCAAATTTGCCTCTGCCGCCGTCTCCGTCTCGACCT
GCTTCCTCATTGAGTCCGATGCGCCGGTCAGAGAATGAATTTATGGTTGAGCAAATGCATGATGTTATTGCTTGG
GTTCAGATATGCGAGTTGGGGCTTAATGGGTCCTATGTCCCTGTACCAGTGATCTCCCAAGGAAGCATCGACCCC
GGAGCGTTCTCTCTTCATCAAGGACTTCAACGTAGGATCGTGGTCAATCTCTCATCGAATTCTGGGCAGCAACTT
CCTTGGTCGGAGTTTACCAAGATACGAATTGGGAACGTGAGGCTTCTGGATGCGAAAGGACGCATGCATGACTCG
ACTTCAAGAGCACTCGTGACTTTGGCTTTGCAGAAGGAACAGAATTTAGAGTTTAAACGAGACGGGACGGGTACT
CTGTCTGCAGAAGCACTTTGGGATTCGAGTATGCATGATTCGGTGTTGCTTAATCGCGTCACTGCGGCAAACCAA
AGGATCATTTTGAAACTGACGTGGGGAGTGGCGGTGGATATATGTCAGGAACCCGTGCAGTTTAGTATGGATGTG
GCGATTGCCATGCATGCAAGGGATGCGAGTCCACCGTCGAAGTTTCTGACATTCTTCGCCTCGAACAAGGTCCTT
GCAAAGTCGAGTACCTTGTTTAGTGTCAAGTTATCGCCGCCTTTGACAAGATCGGCGAAGGATTTGTGGAGGTTG
GATACGTCGGAGAAATATGTGAGGGGTGAAGAGACGCTTGGTGCTTGGAAACCCCGAGGTATAACGGTTGTGGAA
GATTATGGTCGCTTGATCACGACCGAGCGGCGAGCTGCTGATGTACAAGCTATCAGAGTTATTGTGGCTACAAAT
CCACCCCGTCAAATTCAGGCTGATGCTTTGGTCTGGAAAGGAGAAGATATCCTGAGACGCTCTGTCCAACTCTGG
CAGAAGCAATTTGGTCATCGTGGGAAGATCACTCTCAGCCAAGAACCTGATCCTGAGGAGACTATACCGAACGGA
AAGACAGAGAGGATGGAGAATGCAGAAGCATTCAAATATATTTCCGAAACGAGAGTGATACCCCGGAGTGACAGC
ACGACGAAGAAAGGACACCTCCTGATCCTCAGTGACGCAAGTCAGAACACTTGGGAGCGACGATGGTTTGTGTTA
AGAAGACCATACTTACATATGTATGCACACTCCAACGAACTGGAAGAACTTGGCATAATTAGTCTTTCCGGTGTC
AATGTGGAAAGCGATCCTCGCAAAGAATCTCTCCTTGGCAAACCATATTCTTTTACTCTCTTTACCGCTTCCAAC
TCGCATGCCCTAGCTGCACCTAGTCTCAAAGAACTCCAGTCATGGACAACAAAACTAGACCCCACCCGGTTACCC
GGTTAA
Gene >AgabiH97|076570
ATGGCCGAGGCTGGAGATGGCAACATCAAAGTCGTCGTCCGCTGCCGCCCCCTAAATACTCGCGGTCCGTCGTCC
TCATCACCTCGTTTTGTATCGCCCTCACCTTCCTCTAGAACTCGCCAGGGGAGCCAAATGCCTCATTCGCATGCA
AGGGAATCAGACCTTGTTAGACCCGCCAGAAACTGGCTCATCCCAGGACTCGAAGCGTGCAACCGAGCGCAAGAC
AATGCCCTTTAGCTTTGATAAAAGTTACTGGAGTGCTGGCCCACGCGATGACCCCGGTTACTGTTCCCAACAGAC
TTTGTACGACGACTTAGGAAAGGAACTCTTGGACCATGGCTTTTCTGGCTTCAATGCGTGTATCCTTGCCTGTGC
GTTACTCTTGTCCCTGTGTATCTTAGTTGTCTGACTGCGTCTCCGCAGATGGTCAAACAGGTGTGCCAGTCGTCT
CCTCGTTTCCTCCACTAAATTTAATCTCGCCATGTGCAACCAAGGTTCTGGCAAGTCCTACAGGTGTGCATCCTC
GCCTTTCCATCCTCATGCTGGTCACTCACCTTCCATTCATTTCATAGTATGATGGGCTGTACGTCGCCACAACCC
ACCGATATCTTTCACCAACTCACCATATCTCTACAGATGGTCAAGACAAGGGCATCATCCCACTCACCTGTTCCG
AACTTTTCCAACGTGTCGAGTCGAAGAAAGCACAAGATCCCAACATCAACTTTACCGTCGAAGTCTCCTACATCG
AGGTAACCATGTCCACCCTTTCCCACCCTCCTACATTCCAACTTATCCCGCTTGATTTCATAAGATCTACAATGA
AAAAGTCCGTGACCTTCTCAACCCAAAGAACACCGGCAACCTTCGCGTTCGTGAACATCCAAGTCTAGGTCCCTA
CGTCGAAGATCTATCCAAGCTCGTGGTAACGAGCTACGAGGGTATGATGACACTCATGGATGAGGGGAACAAAGC
GCGTACTGTGGCTGCTACCAATATGAATGAAACGTACGTACTCTTTCCTTCAAGCTCGTCCCGCGCTCCCGAAAT
CTACTCTTCCCCCCTCTTGCTCAAAAGATCGCGGTTCTCGCGGAAACGCGACGCTTCTCATCCAGAATGAAATTC
GTTGACCTTTCTTTGCTTCTCCTTCAGCTCTTCACGTTCACATGCTGTCTTTACTCTCCTTCTCACAATGAAACG
GCACGATAACGACACGAACCTCGACACCGAAAAGGTTTCGCGTATCAGGTCCGTCTTTACTCCCCCTTCCTCAAC
CCTTCCATCGAATCTGATTTTTACATCCTCCAACCTTAGTCTCGTCGATTTGGCAGGTTCCGAACGCGCCAATTC
AACGGGTGCGACAGGTCAACGTCTCAAGGAAGGTGCCAACATCAACAAATCCCTAACCACCCTTGGTAAAGTCAT
TTCTGCTCTCGCTGTGCAAAGTTCATCAGAGGGTAAGAAGGGAAAGAAGGGGAAGGCTGAAGAGTTCATACCCTA
CCGTGATTCTGTACGTTTTCAATATACAAACAACACTTTTTTCCTCAATGTTTCTTCTTTCAGGTCCTTACATGG
CTCCTTAAAGACAGTCTTGGTGGTAATTCCAAAACTGCCATGATAGCTGCAATCTCGCCCGCCGATTATGAAGAA
ACACTGAGCACGTTGCGCTATGCCGATCAAGCGAAGAAGATCAAGAACAAAGCTGTAGTGAACGAGGATCCCAAT
GCGAAGTTGGTCAGAGAGCTCAAGGAGGAATTGGAAACGCTCAGAGGTACGTTGCAATCCCTTTATTTTTTTCAA
AAACACTCTTTCTCACCTTTGTTTTCACATTGCAGCCCGCGTTGCGGGATCAAGCGGCGAAGAACATTTTGATCC
CAAAATTCCCGCTGAAAAGCAAATTGTGACTTATCAGACCAAGGAAGGTGTCATCAAAAAGGTCACCAAAGCAGA
GTTGCAGGAACAGATGGAAACGCGAGAAAAGTTGATGAATGAGTTGAATGAGACTTGGGAACAGAAGTTGGTGAG
AACTCAGGAGGTACAGAAGGAGCGGGAGAAGGCGTTGGAGGAGTTGGGTATTACGGTCGAGAAGAACTTGGTCGG
TGTGCATACACCCAAGAAGGTATTTAGAGCCAACATGACCATCCTATCTCAAATCAGAAAAAGCTGATGGATTTT
GCAGATGCCTCATCTCGTGAATTTGGTACGTGTCCATCCTAAATGAAACCAAGTATGTAAATAGTTCATTGATGA
ACTGCTTGGGTTTCGTAGAACGAAGGTCCGTTTATCTGGTGCGCTGCTTTAGGTACCGATTCATTTATTAATCCC
TTCTTACAGATCCTCTGATGAGCGAGTGTCTGATATATCAAATCAAACCCGGAAAGACACTCGTAAGTATCTAAA
TCCTTACCTTACCTTTTTTAATAAGGGTAGAATCTTAACTTATATGCTCATATCCTTTACGCGTTAGGTTGGGAG
GTTAGACAACGAGAAACCCGCCGCGATTCGCTTAAGTGGAGACAAAATCCTAGAAGAACACTGCTATTTCGATAA
TATAGATGGTAAAGTCACGCTAGAGTGTATGCCTGACAGTATTACGGTATGTTTGCTTGCTACGATCCCGAGATC
CCTTGAGCATCTGATGATCATACTACTAGTTTCTAAATGGGAAGCAAATCGCGGCCGGGCAGGTGGGGATTTGAA
TTATCTCGGCCCTTGTGAAGTCTAATGTTTATGTATCTTTTTGTTGTTGACAGCCTCATAAACTTCGATCTGGGT
TTCGTATCATCATGGGTACGTACAATTCTCTTCCATTATCAACCACCAGCGACTTCATACTCAAAATACCATTTC
CACAAACTTTTAGGTGATAACCATGTATTTCGATTTAACAACCCGGAGGAAGTGCGAAAGAAACGAGATCGCGCA
ACTGCCAAATCCAATCTTCACATGAGCATCTCCGCTGCTGATCTGGAGGGAGCAGAAGGTTCCCCTCGTCCCGAA
TCTCCGACAACCTCAGAAGACGACCGAGGTGACGTTGATTGGACTTTTGCGCAACGTGAAGCAGCTTTTGCACGA
TTGGGTTTGGACCCGACTTTGGATAACCTGCCGGATGATGACTTGAACAAGTTGTTTGAGAAGATTACTAGAGTC
AAGACGTTGAGGGATATTAATTCTAAACCTCGCCCGGAAAGTAGTCTTTCACAAGCGGATGATATTTGGAGTGAA
GCTGGTGGAAGGCCGTTACCAAGTGAAGCTCCTACGGATGATACGAGTTTACATGGAAGTCCCGCCGTAGATGAT
TCCCTCAAAGACGCTCAACACCATCTCGAGAATAGATTAAACGAAATCCAGGAGAATGGTGTAATGTCGAATGTA
GAGGCAGAAGATTTGAAAGCGGAGAAGGAGCATATGGAACTTCAATTGAACCGCGTTCGTACTCAGATGAAGAGG
CTAATTGATGCACGGGCTAGAGGGGAAACGGAATTCGAAGGGATGGATTTTGAACCTGTCATTTACTCTGCGAGA
CAGTTACGGCTTATACGCAAGGTTTTGGACAAGTGGAGGGCTCATAGATCATTTTCAATGGCGGAAATGATCTTG
ACCAATGCGGTCGCTGTGAAGGAAACAAATATCATCAGGTGAGCTCGTGAACGTTTTTTACGCTTGGATGTTGTT
TTCCCCTAATGATTGCTTGTGGGATTATCATAGTAAAGAATTGGGGAAATCTGTTTCCTATAATTTTGCGATCGC
ATCTGGGGGATCGCTGGCCGCTCCAGTATCTGCGATCGATAGCATCGCAGGTTTAGACCAATTCGGTGACGTTGC
AGATCCAATTCTGCGTTCGAATACCCAGCCTTCTGTGGCAGTTAAAGTCATCGATCGCAAACACAATGCGATTTA
TGTATGGTCCCTGGATAGGCTACAGCAACAACTACAACGCATGCGTAATCTCACAACCTATATCGATCGGCCTTC
GTATACCCAACATTTCTCTTCTGACGAACCCTTCTATGATTCCCCGCCTCCTGAATACTCCTTTATTGGCAATGC
ATTAATCTCACTTGCACCACTTTCTCGTCGATTATCGTCTTCTTCGACTGTTGCGATTTTCTGCAGATATACTGC
AGAAGCTATCGGTTCCTGTCGTGTTGATATCAAACTTGTCAGCGCGATATCGCCGTCGAAGTATGCTAGTGCTTC
GTCTGCGTCTACGCGCGCTTCATCCCCTGTCCCCGGAACTATTCATCCAGGCACTAAGCTCAATTTCTTCTTGAC
GGTGGATTCTGTCAAGGGACTTTCACCACATGATTTCTCTGCCATTCACCTCCAAATTCGGTTATCGTCATTCGT
AGGGGCCGCCGTGACATCTGAAGAAGTGTTTCCTTCGTCAGCGATTGATATTGACCACGCGTCGTTATCAGAACT
CAAGTTCCGGCGAAGTTTTACGATAGTCGCATCGTCCAAGGTTTTGAACCACTTACGGCAAGGATATGCGCCTAT
AGAATTCTTTGCGACTTTGAAGCCTACCTATTTGGAACGGATGGAAAGATGGGATGAGATGCGTGACCAGAAGCA
AAATTATACCCCTCGAGTACCTTCGCCCCCGAATCCAAATTTGCCTCTGCCGCCGTCTCCGTCTCGACCTGCTTC
CTCATTGAGTCCGATGCGCCGGTCAGAGAATGAATTTATGGTTGAGCAAATGCATGATGTTATTGCTTGGGTTCA
GATATGCGAGTTGGGGCTTAATGGGTCCTATGTCCCTGTACCAGTGATCTCCCAAGGAAGCATCGACCCCGGAGC
GTTCTCTCTTCATCAAGGACTTCAACGTAGGATCGTGGTCAATCTCTCATCGAATTCTGGGCAGCAACTTCCTTG
GTCGGAGTTTACCAAGATACGAATTGGGAACGTGAGGCTTCTGGATGCGAAAGGACGCATGCATGACTCGACTTC
AAGAGCACTCGTGACTTTGGCTTTGCAGAAGGAACAGAATTTAGAGTTTAAACGAGACGGGACGGGTACTCTGTC
TGCAGAAGCACTTTGGGATTCGAGTATGCATGATTCGGTGTTGCTTAATCGCGTCACTGCGGCAAACCAAAGGAT
CATTTTGAAACTGACGTGGGGAGTGGCGGTGGATATATGTCAGGAACCCGTGCAGTTTAGTATGGATGTGGCGAT
TGCCATGCATGCAAGGGATGCGAGTCCACCGTCGAAGTTTCTGACATTCTTCGCCTCGAACAAGGTCCTTGCAAA
GTCGAGTACCTTGTTTAGTGTCAAGTTATCGCCGCCTTTGACAAGATCGGCGAAGGATTTGTGGAGGTTGGATAC
GTCGGAGAAATATGTGAGGGGTGAAGAGACGCTTGGTGCTTGGAAACCCCGAGGTATAACGGTTGTGGAAGATTA
TGGTCGCTTGATCACGACCGAGCGGCGAGCTGCTGATGTACAAGCTATCAGAGTTATTGTGGCTACAAATCCACC
CCGTCAAATTCAGGCTGATGCTTTGGTCTGGAAAGGAGAAGATATCCTGAGACGCTCTGTCCAACTCTGGCAGAA
GCAATTTGGTCATCGTGGGAAGGTGAGTACATGACGATCTTTTTTGATCATGAGTCTTTGGAATCTAAAGTCTGT
TTAGATCACTCTCAGCCAAGAACCTGATCCTGAGGAGACTATACCGAACGGAAAGACAGAGAGGATGGAGAATGC
AGAAGCATTCAAATATATTTCCGAAACGAGAGTGATACCCCGGAGGTAATTTACCGGTTGGCCCATAATGCGGAC
CGATGGGTTACTAATCGATTGCATCAGTGACAGCACGACGAAGAAAGGACACCTCCTGATCCTCAGTGACGCAAG
TCAGAACACTTGGGAGCGACGATGGTTTGTGTTAAGAAGGTATGACGATGAACCTCTGTTTACCCATCTTTACTT
ACCACCACGTCATGTAGACCATACTTACATATGTATGCACACTCCAACGAACTGGAAGAACTTGGCATAATTAGT
CTTTCCGGTGTCAATGTGGAAAGCGATCCTCGCAAAGAATCTCTCCTTGGCGTGAGTCTCTGATCTACCTGTCCG
CCTGAACCCGACTCTGAGTAGTTTTTACCCAGAAACCATATTCTTTTACTCTCTTTACCGCTTCCAACTCGCATG
CCCTAGCTGCACCTAGTCTCAAAGAACTCCAGTCATGGACAACAAAACTAGACCCCACCCGGTTACCCGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail