Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|076420
Gene name
Locationscaffold_4:2610044..2611024
Strand-
Gene length (bp)980
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20520 Ac45-VOA1_TM V0 complex accessory subunit Ac45/VOA1 transmembrane domain 9.3E-07 222 259

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 230 252 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 153.26 90.31 216.21
Initials Initials knots 122.15 73.08 171.22
Pileal_Stipeal_center Stage I stipe center 231.82 138.31 325.33
Pileal_Stipeal_shell Stage I stipe shell 271.36 160.70 382.03
DIF_stipe_center Stage II stipe center 225.02 134.99 315.06
DIF_stipe_shell Stage II stipe shell 227.15 136.18 318.12
DIF_stipe_skin Stage II stipe skin 220.70 132.37 309.04
DIF_cap_skin Stage II cap skin 314.73 185.94 443.53
DIF_cap_tissue Stage II cap tissue 294.52 174.99 414.04
DIF_gill_tissue Stage II gill tissue 294.24 174.71 413.76
YFB_stipe_center Young fruiting body stipe center 230.30 137.92 322.67
YFB_stipe_shell Young fruiting body stipe shell 218.74 131.43 306.06
YFB_stipe_skin Young fruiting body stipe skin 223.28 133.51 313.05
YFB_cap_skin Young fruiting body cap skin 318.41 187.58 449.24
YFB_cap_tissue Young fruiting body cap tissue 270.50 161.53 379.47
YFB_gill_tissue Young fruiting body gill tissue 300.30 178.00 422.59
YFB_veil Young fruiting body veil 314.52 184.84 444.20

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.012577 yes
Casing YFB_stipe_center 0.167754 no
Casing YFB_stipe_shell 0.239956 no
Casing YFB_stipe_skin 0.207757 no
Casing YFB_cap_skin 0.003365 yes
Casing YFB_cap_tissue 0.032978 yes
Casing YFB_gill_tissue 0.009123 yes
Casing YFB_veil 0.004160 yes
Casing Initials 0.527706 no
Casing Pileal_Stipeal_center 0.161568 no
Casing Pileal_Stipeal_shell 0.036455 yes
Casing DIF_stipe_center 0.196516 no
Casing DIF_stipe_shell 0.179329 no
Casing DIF_stipe_skin 0.217538 no
Casing DIF_cap_skin 0.004160 yes
Casing DIF_cap_tissue 0.014956 yes
DIF_gill_tissue YFB_stipe_center 0.480687 no
DIF_gill_tissue YFB_stipe_shell 0.350907 no
DIF_gill_tissue YFB_stipe_skin 0.405670 no
DIF_gill_tissue YFB_cap_skin 0.874152 no
DIF_gill_tissue YFB_cap_tissue 0.863128 no
DIF_gill_tissue YFB_gill_tissue 0.969357 no
DIF_gill_tissue YFB_veil 0.895720 no
YFB_stipe_center YFB_stipe_shell 0.922276 no
YFB_stipe_center YFB_stipe_skin 0.954708 no
YFB_stipe_center YFB_cap_skin 0.311274 no
YFB_stipe_center YFB_cap_tissue 0.689779 no
YFB_stipe_center YFB_gill_tissue 0.425977 no
YFB_stipe_center YFB_veil 0.337682 no
YFB_stipe_shell YFB_stipe_skin 0.970431 no
YFB_stipe_shell YFB_cap_skin 0.202921 no
YFB_stipe_shell YFB_cap_tissue 0.558044 no
YFB_stipe_shell YFB_gill_tissue 0.303559 no
YFB_stipe_shell YFB_veil 0.231439 no
YFB_stipe_skin YFB_cap_skin 0.248019 no
YFB_stipe_skin YFB_cap_tissue 0.616542 no
YFB_stipe_skin YFB_gill_tissue 0.356206 no
YFB_stipe_skin YFB_veil 0.276817 no
YFB_cap_skin YFB_cap_tissue 0.692364 no
YFB_cap_skin YFB_gill_tissue 0.910762 no
YFB_cap_skin YFB_veil 0.982660 no
YFB_cap_tissue YFB_gill_tissue 0.817443 no
YFB_cap_tissue YFB_veil 0.716416 no
YFB_gill_tissue YFB_veil 0.929074 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.014374 yes
Initials YFB_stipe_shell 0.022631 yes
Initials YFB_stipe_skin 0.018896 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.001625 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.013485 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.015529 yes
Initials DIF_stipe_shell 0.013782 yes
Initials DIF_stipe_skin 0.017507 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.500912 no
Pileal_Stipeal_center YFB_stipe_center 0.989426 no
Pileal_Stipeal_center YFB_stipe_shell 0.911334 no
Pileal_Stipeal_center YFB_stipe_skin 0.943952 no
Pileal_Stipeal_center YFB_cap_skin 0.326760 no
Pileal_Stipeal_center YFB_cap_tissue 0.708733 no
Pileal_Stipeal_center YFB_gill_tissue 0.444068 no
Pileal_Stipeal_center YFB_veil 0.357287 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.701474 no
Pileal_Stipeal_center DIF_stipe_center 0.955762 no
Pileal_Stipeal_center DIF_stipe_shell 0.969549 no
Pileal_Stipeal_center DIF_stipe_skin 0.924330 no
Pileal_Stipeal_center DIF_cap_skin 0.353184 no
Pileal_Stipeal_center DIF_cap_tissue 0.498420 no
Pileal_Stipeal_shell DIF_gill_tissue 0.869723 no
Pileal_Stipeal_shell YFB_stipe_center 0.684836 no
Pileal_Stipeal_shell YFB_stipe_shell 0.551514 no
Pileal_Stipeal_shell YFB_stipe_skin 0.608341 no
Pileal_Stipeal_shell YFB_cap_skin 0.703737 no
Pileal_Stipeal_shell YFB_cap_tissue 0.994560 no
Pileal_Stipeal_shell YFB_gill_tissue 0.827940 no
Pileal_Stipeal_shell YFB_veil 0.731058 no
Pileal_Stipeal_shell DIF_stipe_center 0.622172 no
Pileal_Stipeal_shell DIF_stipe_shell 0.647894 no
Pileal_Stipeal_shell DIF_stipe_skin 0.571826 no
Pileal_Stipeal_shell DIF_cap_skin 0.729853 no
Pileal_Stipeal_shell DIF_cap_tissue 0.869070 no
DIF_stipe_center DIF_gill_tissue 0.416662 no
DIF_stipe_center YFB_stipe_center 0.964692 no
DIF_stipe_center YFB_stipe_shell 0.958901 no
DIF_stipe_center YFB_stipe_skin 0.988198 no
DIF_stipe_center YFB_cap_skin 0.255586 no
DIF_stipe_center YFB_cap_tissue 0.629415 no
DIF_stipe_center YFB_gill_tissue 0.363938 no
DIF_stipe_center YFB_veil 0.284650 no
DIF_stipe_center DIF_stipe_shell 0.985394 no
DIF_stipe_center DIF_stipe_skin 0.970544 no
DIF_stipe_center DIF_cap_skin 0.280162 no
DIF_stipe_center DIF_cap_tissue 0.412372 no
DIF_stipe_shell DIF_gill_tissue 0.436337 no
DIF_stipe_shell YFB_stipe_center 0.978944 no
DIF_stipe_shell YFB_stipe_shell 0.943432 no
DIF_stipe_shell YFB_stipe_skin 0.974704 no
DIF_stipe_shell YFB_cap_skin 0.271262 no
DIF_stipe_shell YFB_cap_tissue 0.650717 no
DIF_stipe_shell YFB_gill_tissue 0.381253 no
DIF_stipe_shell YFB_veil 0.298507 no
DIF_stipe_shell DIF_stipe_skin 0.956593 no
DIF_stipe_shell DIF_cap_skin 0.294650 no
DIF_stipe_shell DIF_cap_tissue 0.431188 no
DIF_stipe_skin DIF_gill_tissue 0.373826 no
DIF_stipe_skin YFB_stipe_center 0.935269 no
DIF_stipe_skin YFB_stipe_shell 0.986715 no
DIF_stipe_skin YFB_stipe_skin 0.982343 no
DIF_stipe_skin YFB_cap_skin 0.217865 no
DIF_stipe_skin YFB_cap_tissue 0.581008 no
DIF_stipe_skin YFB_gill_tissue 0.319685 no
DIF_stipe_skin YFB_veil 0.246388 no
DIF_stipe_skin DIF_cap_skin 0.241143 no
DIF_stipe_skin DIF_cap_tissue 0.368152 no
DIF_cap_skin DIF_gill_tissue 0.895298 no
DIF_cap_skin YFB_stipe_center 0.332623 no
DIF_cap_skin YFB_stipe_shell 0.229801 no
DIF_cap_skin YFB_stipe_skin 0.268064 no
DIF_cap_skin YFB_cap_skin 0.983274 no
DIF_cap_skin YFB_cap_tissue 0.718717 no
DIF_cap_skin YFB_gill_tissue 0.929458 no
DIF_cap_skin YFB_veil 0.998811 no
DIF_cap_skin DIF_cap_tissue 0.897873 no
DIF_cap_tissue DIF_gill_tissue 0.998252 no
DIF_cap_tissue YFB_stipe_center 0.478659 no
DIF_cap_tissue YFB_stipe_shell 0.353791 no
DIF_cap_tissue YFB_stipe_skin 0.402994 no
DIF_cap_tissue YFB_cap_skin 0.876301 no
DIF_cap_tissue YFB_cap_tissue 0.860405 no
DIF_cap_tissue YFB_gill_tissue 0.970308 no
DIF_cap_tissue YFB_veil 0.896801 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|076420
MMAAKRFLVALVSATFAFADTSLVAWSSSGSTALDALPPSLTTSKFTNHILNNDQLCDFDAIVLIDQPGDHRNGL
SSHVISRSISSAPSARSFKLSGSFNLPVTAESLSSRCNARFLSYTPGPSSSGDVSLEEGQKHVLCLKMPENADIE
KHEASLAAELSTISSIFPSHFIIYTGPGLSNLHIRQSPETPPRPTIETTTNTSQIPVNNPTASITDVNTTVYFTT
GLITALLLVFFILLPVLFIGVGALASIQTPIRMDAPKGYSAVERKNQ*
Coding >AgabiH97|076420
ATGATGGCTGCCAAACGATTCCTCGTCGCCCTCGTCTCTGCAACTTTTGCCTTTGCGGACACTTCTCTCGTTGCT
TGGTCTTCTTCAGGGTCGACTGCGCTCGATGCGCTTCCACCATCTCTCACGACGTCCAAGTTCACCAATCACATC
CTAAACAACGACCAATTATGTGATTTTGACGCTATCGTCCTCATTGACCAACCAGGAGACCACCGCAATGGGCTT
TCATCCCATGTCATCTCGCGCAGCATCTCTTCAGCACCCTCAGCACGCTCTTTCAAATTATCCGGTTCTTTCAAT
TTACCAGTTACAGCTGAAAGTCTTTCGTCCCGCTGTAACGCCCGTTTCTTGAGTTACACACCTGGACCGTCATCA
TCGGGTGACGTTTCACTCGAGGAAGGCCAGAAACACGTCTTGTGCTTGAAAATGCCCGAGAACGCTGATATTGAA
AAACACGAAGCTTCACTTGCAGCAGAGCTTTCGACCATTTCATCCATCTTCCCTTCCCACTTCATCATCTACACC
GGTCCTGGCCTCTCAAACCTCCACATCCGTCAATCTCCAGAAACACCCCCTCGTCCAACCATAGAAACCACCACC
AACACTTCTCAAATACCCGTCAACAACCCCACTGCCTCCATTACAGATGTCAACACCACTGTATACTTCACAACC
GGCTTGATTACCGCTCTCCTCCTCGTTTTCTTCATTCTCCTCCCTGTTCTATTCATCGGTGTTGGAGCTTTGGCT
AGTATCCAAACACCCATTCGTATGGACGCTCCAAAGGGTTATAGTGCAGTTGAGAGAAAGAACCAATAG
Transcript >AgabiH97|076420
ATGATGGCTGCCAAACGATTCCTCGTCGCCCTCGTCTCTGCAACTTTTGCCTTTGCGGACACTTCTCTCGTTGCT
TGGTCTTCTTCAGGGTCGACTGCGCTCGATGCGCTTCCACCATCTCTCACGACGTCCAAGTTCACCAATCACATC
CTAAACAACGACCAATTATGTGATTTTGACGCTATCGTCCTCATTGACCAACCAGGAGACCACCGCAATGGGCTT
TCATCCCATGTCATCTCGCGCAGCATCTCTTCAGCACCCTCAGCACGCTCTTTCAAATTATCCGGTTCTTTCAAT
TTACCAGTTACAGCTGAAAGTCTTTCGTCCCGCTGTAACGCCCGTTTCTTGAGTTACACACCTGGACCGTCATCA
TCGGGTGACGTTTCACTCGAGGAAGGCCAGAAACACGTCTTGTGCTTGAAAATGCCCGAGAACGCTGATATTGAA
AAACACGAAGCTTCACTTGCAGCAGAGCTTTCGACCATTTCATCCATCTTCCCTTCCCACTTCATCATCTACACC
GGTCCTGGCCTCTCAAACCTCCACATCCGTCAATCTCCAGAAACACCCCCTCGTCCAACCATAGAAACCACCACC
AACACTTCTCAAATACCCGTCAACAACCCCACTGCCTCCATTACAGATGTCAACACCACTGTATACTTCACAACC
GGCTTGATTACCGCTCTCCTCCTCGTTTTCTTCATTCTCCTCCCTGTTCTATTCATCGGTGTTGGAGCTTTGGCT
AGTATCCAAACACCCATTCGTATGGACGCTCCAAAGGGTTATAGTGCAGTTGAGAGAAAGAACCAATAG
Gene >AgabiH97|076420
ATGATGGCTGCCAAACGATTCCTCGTCGCCCTCGTCTCTGCAACTTTTGCCTTTGCGGACACTTCTCTCGTTGCT
TGGTCTTCTTCAGGGTAATATTCAGTTTGTAAGTTGGGTGATATGGCTAACGAAAAGTAGGTCGACTGCGCTCGA
TGCGCTTCCACCATCTCTCACGACGTCCAAGTTCACCAATCACATCCTAAACAACGACCAATTATGTGATTTTGA
CGCTATCGTCCTCATTGACCAACCAGGAGTACGTCTCCTCATTGTATCTTATCACAAGCATGTTTCCTAAGTTGA
ACTTTCGTCTTCTTCAGGACCACCGCAATGGGCTTTCATCCCATGTCATCTCGCGCAGCATCTCTTCAGCACCCT
CAGCACGCTCTTTCAAATTATCCGGTTCTTTCAATTTACCAGTTACAGCTGAAAGTCTTTCGTCCCGCTGTAACG
CCCGTTTCTTGAGTTACACACCTGGACCGTCATCATCGGGTGACGTTTCACTCGAGGAAGGCCAGAAACACGTCT
TGTGCTTGAAAATGCCCGAGAACGCTGATATTGAAAAACACGGTAGTTAATTTTTCACTGTTTGACTGAAACGAA
TTGAACCGGTTCCTTTAGAAGCTTCACTTGCAGCAGAGCTTTCGACCATTTCATCCATCTTCCCTTCCCACTTCA
TCATCTACACCGGTCCTGGCCTCTCAAACCTCCACATCCGTCAATCTCCAGAAACACCCCCTCGTCCAACCATAG
AAACCACCACCAACACTTCTCAAATACCCGTCAACAACCCCACTGCCTCCATTACAGATGTCAACACCACTGTAT
ACTTCACAACCGGCTTGATTACCGCTCTCCTCCTCGTTTTCTTCATTCTCCTCCCTGTTCTATTCATCGGTGTTG
GAGCTTTGGCTAGTATCCAAACACCCATTCGTATGGACGCTCCAAAGGGTTATAGTGCAGTTGAGAGAAAGAACC
AATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail