Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|076420
Gene name
Locationscaffold_4:2610044..2611024
Strand-
Gene length (bp)980
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20520 Ac45-VOA1_TM V0 complex accessory subunit Ac45/VOA1 transmembrane domain 9.3E-07 222 259

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 230 252 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|076420
MMAAKRFLVALVSATFAFADTSLVAWSSSGSTALDALPPSLTTSKFTNHILNNDQLCDFDAIVLIDQPGDHRNGL
SSHVISRSISSAPSARSFKLSGSFNLPVTAESLSSRCNARFLSYTPGPSSSGDVSLEEGQKHVLCLKMPENADIE
KHEASLAAELSTISSIFPSHFIIYTGPGLSNLHIRQSPETPPRPTIETTTNTSQIPVNNPTASITDVNTTVYFTT
GLITALLLVFFILLPVLFIGVGALASIQTPIRMDAPKGYSAVERKNQ*
Coding >AgabiH97|076420
ATGATGGCTGCCAAACGATTCCTCGTCGCCCTCGTCTCTGCAACTTTTGCCTTTGCGGACACTTCTCTCGTTGCT
TGGTCTTCTTCAGGGTCGACTGCGCTCGATGCGCTTCCACCATCTCTCACGACGTCCAAGTTCACCAATCACATC
CTAAACAACGACCAATTATGTGATTTTGACGCTATCGTCCTCATTGACCAACCAGGAGACCACCGCAATGGGCTT
TCATCCCATGTCATCTCGCGCAGCATCTCTTCAGCACCCTCAGCACGCTCTTTCAAATTATCCGGTTCTTTCAAT
TTACCAGTTACAGCTGAAAGTCTTTCGTCCCGCTGTAACGCCCGTTTCTTGAGTTACACACCTGGACCGTCATCA
TCGGGTGACGTTTCACTCGAGGAAGGCCAGAAACACGTCTTGTGCTTGAAAATGCCCGAGAACGCTGATATTGAA
AAACACGAAGCTTCACTTGCAGCAGAGCTTTCGACCATTTCATCCATCTTCCCTTCCCACTTCATCATCTACACC
GGTCCTGGCCTCTCAAACCTCCACATCCGTCAATCTCCAGAAACACCCCCTCGTCCAACCATAGAAACCACCACC
AACACTTCTCAAATACCCGTCAACAACCCCACTGCCTCCATTACAGATGTCAACACCACTGTATACTTCACAACC
GGCTTGATTACCGCTCTCCTCCTCGTTTTCTTCATTCTCCTCCCTGTTCTATTCATCGGTGTTGGAGCTTTGGCT
AGTATCCAAACACCCATTCGTATGGACGCTCCAAAGGGTTATAGTGCAGTTGAGAGAAAGAACCAATAG
Transcript >AgabiH97|076420
ATGATGGCTGCCAAACGATTCCTCGTCGCCCTCGTCTCTGCAACTTTTGCCTTTGCGGACACTTCTCTCGTTGCT
TGGTCTTCTTCAGGGTCGACTGCGCTCGATGCGCTTCCACCATCTCTCACGACGTCCAAGTTCACCAATCACATC
CTAAACAACGACCAATTATGTGATTTTGACGCTATCGTCCTCATTGACCAACCAGGAGACCACCGCAATGGGCTT
TCATCCCATGTCATCTCGCGCAGCATCTCTTCAGCACCCTCAGCACGCTCTTTCAAATTATCCGGTTCTTTCAAT
TTACCAGTTACAGCTGAAAGTCTTTCGTCCCGCTGTAACGCCCGTTTCTTGAGTTACACACCTGGACCGTCATCA
TCGGGTGACGTTTCACTCGAGGAAGGCCAGAAACACGTCTTGTGCTTGAAAATGCCCGAGAACGCTGATATTGAA
AAACACGAAGCTTCACTTGCAGCAGAGCTTTCGACCATTTCATCCATCTTCCCTTCCCACTTCATCATCTACACC
GGTCCTGGCCTCTCAAACCTCCACATCCGTCAATCTCCAGAAACACCCCCTCGTCCAACCATAGAAACCACCACC
AACACTTCTCAAATACCCGTCAACAACCCCACTGCCTCCATTACAGATGTCAACACCACTGTATACTTCACAACC
GGCTTGATTACCGCTCTCCTCCTCGTTTTCTTCATTCTCCTCCCTGTTCTATTCATCGGTGTTGGAGCTTTGGCT
AGTATCCAAACACCCATTCGTATGGACGCTCCAAAGGGTTATAGTGCAGTTGAGAGAAAGAACCAATAG
Gene >AgabiH97|076420
ATGATGGCTGCCAAACGATTCCTCGTCGCCCTCGTCTCTGCAACTTTTGCCTTTGCGGACACTTCTCTCGTTGCT
TGGTCTTCTTCAGGGTAATATTCAGTTTGTAAGTTGGGTGATATGGCTAACGAAAAGTAGGTCGACTGCGCTCGA
TGCGCTTCCACCATCTCTCACGACGTCCAAGTTCACCAATCACATCCTAAACAACGACCAATTATGTGATTTTGA
CGCTATCGTCCTCATTGACCAACCAGGAGTACGTCTCCTCATTGTATCTTATCACAAGCATGTTTCCTAAGTTGA
ACTTTCGTCTTCTTCAGGACCACCGCAATGGGCTTTCATCCCATGTCATCTCGCGCAGCATCTCTTCAGCACCCT
CAGCACGCTCTTTCAAATTATCCGGTTCTTTCAATTTACCAGTTACAGCTGAAAGTCTTTCGTCCCGCTGTAACG
CCCGTTTCTTGAGTTACACACCTGGACCGTCATCATCGGGTGACGTTTCACTCGAGGAAGGCCAGAAACACGTCT
TGTGCTTGAAAATGCCCGAGAACGCTGATATTGAAAAACACGGTAGTTAATTTTTCACTGTTTGACTGAAACGAA
TTGAACCGGTTCCTTTAGAAGCTTCACTTGCAGCAGAGCTTTCGACCATTTCATCCATCTTCCCTTCCCACTTCA
TCATCTACACCGGTCCTGGCCTCTCAAACCTCCACATCCGTCAATCTCCAGAAACACCCCCTCGTCCAACCATAG
AAACCACCACCAACACTTCTCAAATACCCGTCAACAACCCCACTGCCTCCATTACAGATGTCAACACCACTGTAT
ACTTCACAACCGGCTTGATTACCGCTCTCCTCCTCGTTTTCTTCATTCTCCTCCCTGTTCTATTCATCGGTGTTG
GAGCTTTGGCTAGTATCCAAACACCCATTCGTATGGACGCTCCAAAGGGTTATAGTGCAGTTGAGAGAAAGAACC
AATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail