Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|076370
Gene name
Locationscaffold_4:2593898..2594998
Strand-
Gene length (bp)1100
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00227 Proteasome Proteasome subunit 5.9E-45 33 230
PF10584 Proteasome_A_N Proteasome subunit A N-terminal signature 5.4E-14 6 28

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9QUM9|PSA6_MOUSE Proteasome subunit alpha type-6 OS=Mus musculus GN=Psma6 PE=1 SV=1 1 263 4.0E-99
sp|P60901|PSA6_RAT Proteasome subunit alpha type-6 OS=Rattus norvegicus GN=Psma6 PE=1 SV=1 1 263 8.0E-99
sp|P60900|PSA6_HUMAN Proteasome subunit alpha type-6 OS=Homo sapiens GN=PSMA6 PE=1 SV=1 1 263 8.0E-99
sp|Q2YDE4|PSA6_BOVIN Proteasome subunit alpha type-6 OS=Bos taurus GN=PSMA6 PE=1 SV=1 1 263 8.0E-99
sp|O94517|PSA1_SCHPO Probable proteasome subunit alpha type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC646.16 PE=3 SV=1 6 263 1.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9QUM9|PSA6_MOUSE Proteasome subunit alpha type-6 OS=Mus musculus GN=Psma6 PE=1 SV=1 1 263 4.0E-99
sp|P60901|PSA6_RAT Proteasome subunit alpha type-6 OS=Rattus norvegicus GN=Psma6 PE=1 SV=1 1 263 8.0E-99
sp|P60900|PSA6_HUMAN Proteasome subunit alpha type-6 OS=Homo sapiens GN=PSMA6 PE=1 SV=1 1 263 8.0E-99
sp|Q2YDE4|PSA6_BOVIN Proteasome subunit alpha type-6 OS=Bos taurus GN=PSMA6 PE=1 SV=1 1 263 8.0E-99
sp|O94517|PSA1_SCHPO Probable proteasome subunit alpha type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC646.16 PE=3 SV=1 6 263 1.0E-90
sp|Q9XZJ4|PSA6_DROME Proteasome subunit alpha type-6 OS=Drosophila melanogaster GN=Prosalpha1 PE=1 SV=2 1 263 8.0E-87
sp|Q9XG77|PSA6_TOBAC Proteasome subunit alpha type-6 OS=Nicotiana tabacum GN=PAA1 PE=2 SV=1 1 263 8.0E-84
sp|O81146|PSA6A_ARATH Proteasome subunit alpha type-6-A OS=Arabidopsis thaliana GN=PAA1 PE=1 SV=2 1 263 6.0E-82
sp|O48551|PSA6_SOYBN Proteasome subunit alpha type-6 OS=Glycine max GN=PAA1 PE=2 SV=2 1 263 5.0E-81
sp|Q9LSU3|PSA6_ORYSJ Proteasome subunit alpha type-6 OS=Oryza sativa subsp. japonica GN=PAA1 PE=2 SV=1 1 263 6.0E-81
sp|O81147|PSA6B_ARATH Proteasome subunit alpha type-6-B OS=Arabidopsis thaliana GN=PAA2 PE=1 SV=1 1 263 7.0E-80
sp|Q54XM7|PSA6_DICDI Proteasome subunit alpha type-6 OS=Dictyostelium discoideum GN=psmA6 PE=3 SV=1 1 263 3.0E-78
sp|P21243|PSA1_YEAST Proteasome subunit alpha type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCL1 PE=1 SV=1 6 263 2.0E-73
sp|O17586|PSA6_CAEEL Proteasome subunit alpha type-6 OS=Caenorhabditis elegans GN=pas-1 PE=1 SV=1 1 263 5.0E-66
sp|Q9GU37|PSA1_TRYBB Proteasome subunit alpha type-1 OS=Trypanosoma brucei brucei PE=2 SV=1 1 240 3.0E-46
sp|A6URN9|PSA_METVS Proteasome subunit alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmA PE=3 SV=1 4 230 3.0E-42
sp|Q6M0L9|PSA_METMP Proteasome subunit alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=psmA PE=3 SV=1 4 230 1.0E-41
sp|A6VIP0|PSA_METM7 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmA PE=3 SV=1 4 230 1.0E-41
sp|A4FZT6|PSA_METM5 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmA PE=3 SV=1 4 230 2.0E-41
sp|Q60177|PSA_METJA Proteasome subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmA PE=1 SV=1 4 231 4.0E-41
sp|A9A846|PSA_METM6 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmA PE=3 SV=1 4 230 1.0E-40
sp|Q8TYB7|PSA_METKA Proteasome subunit alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmA PE=3 SV=1 2 231 2.0E-40
sp|O26782|PSA_METTH Proteasome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmA PE=3 SV=1 1 263 9.0E-38
sp|Q27563|PSA3_DICDI Proteasome subunit alpha type-3 OS=Dictyostelium discoideum GN=psmA3 PE=2 SV=2 4 178 1.0E-37
sp|Q9N599|PSA4_CAEEL Proteasome subunit alpha type-4 OS=Caenorhabditis elegans GN=pas-3 PE=3 SV=2 6 181 2.0E-37
sp|O82530|PSA4_PETHY Proteasome subunit alpha type-4 OS=Petunia hybrida GN=PAC1 PE=2 SV=1 1 230 2.0E-36
sp|Q9UXC6|PSA_SULSO Proteasome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmA PE=3 SV=1 6 231 3.0E-36
sp|Q8TPX5|PSA_METAC Proteasome subunit alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmA PE=3 SV=1 6 262 3.0E-36
sp|O29760|PSA_ARCFU Proteasome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmA PE=1 SV=1 1 234 4.0E-36
sp|Q8PTU1|PSA_METMA Proteasome subunit alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmA PE=3 SV=1 6 262 9.0E-36
sp|P52427|PSA4_SPIOL Proteasome subunit alpha type-4 OS=Spinacia oleracea GN=PAC1 PE=2 SV=1 1 230 1.0E-35
sp|A4YCU9|PSA_METS5 Proteasome subunit alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmA PE=3 SV=1 6 256 2.0E-35
sp|A5UJS2|PSA_METS3 Proteasome subunit alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmA PE=3 SV=1 1 235 5.0E-35
sp|Q9V5C6|PSA3_DROME Proteasome subunit alpha type-3 OS=Drosophila melanogaster GN=Prosalpha7 PE=1 SV=1 4 216 6.0E-35
sp|Q469M6|PSA_METBF Proteasome subunit alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmA PE=3 SV=1 6 262 6.0E-35
sp|Q9LSU1|PSA5_ORYSJ Proteasome subunit alpha type-5 OS=Oryza sativa subsp. japonica GN=PAE1 PE=2 SV=1 1 231 8.0E-35
sp|C6A459|PSA_THESM Proteasome subunit alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmA PE=3 SV=1 6 236 1.0E-34
sp|C3NEC6|PSA_SULIY Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmA PE=3 SV=1 6 231 1.0E-34
sp|C3NHC6|PSA_SULIN Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmA PE=3 SV=1 6 231 1.0E-34
sp|C3MVG1|PSA_SULIM Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmA PE=3 SV=1 6 231 1.0E-34
sp|C3MQ43|PSA_SULIL Proteasome subunit alpha OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmA PE=3 SV=1 6 231 1.0E-34
sp|C4KHD9|PSA_SULIK Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmA PE=3 SV=1 6 231 1.0E-34
sp|C3N5R0|PSA_SULIA Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.27) GN=psmA PE=3 SV=1 6 231 1.0E-34
sp|Q59565|PSA_METTE Proteasome subunit alpha OS=Methanosarcina thermophila GN=psmA PE=3 SV=1 6 231 1.0E-34
sp|Q9VA12|PSA4L_DROME Proteasome subunit alpha type-4-like OS=Drosophila melanogaster GN=Prosalpha3T PE=2 SV=1 6 230 2.0E-34
sp|O24030|PSA7_SOLLC Proteasome subunit alpha type-7 OS=Solanum lycopersicum GN=PAD1 PE=2 SV=1 6 182 3.0E-34
sp|P23638|PSA3_YEAST Proteasome subunit alpha type-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE9 PE=1 SV=1 1 202 3.0E-34
sp|O70435|PSA3_MOUSE Proteasome subunit alpha type-3 OS=Mus musculus GN=Psma3 PE=1 SV=3 4 178 9.0E-34
sp|O81148|PSA4A_ARATH Proteasome subunit alpha type-4-A OS=Arabidopsis thaliana GN=PAC1 PE=1 SV=1 1 230 1.0E-33
sp|Q10329|PSA4_SCHPO Probable proteasome subunit alpha type-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre6 PE=3 SV=1 4 235 1.0E-33
sp|Q10KF0|PSA2_ORYSJ Proteasome subunit alpha type-2 OS=Oryza sativa subsp. japonica GN=PAB1 PE=2 SV=1 1 256 1.0E-33
sp|A2YVR7|PSA2_ORYSI Proteasome subunit alpha type-2 OS=Oryza sativa subsp. indica GN=PAB1 PE=2 SV=2 1 256 1.0E-33
sp|Q4JB24|PSA_SULAC Proteasome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmA PE=3 SV=1 6 182 1.0E-33
sp|Q6L0W3|PSA_PICTO Proteasome subunit alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmA PE=3 SV=1 3 234 1.0E-33
sp|P18422|PSA3_RAT Proteasome subunit alpha type-3 OS=Rattus norvegicus GN=Psma3 PE=1 SV=3 4 178 2.0E-33
sp|Q0J006|PSA7B_ORYSJ Proteasome subunit alpha type-7-B OS=Oryza sativa subsp. japonica GN=PAD1 PE=2 SV=1 6 182 2.0E-33
sp|A2Z3I9|PSA7B_ORYSI Proteasome subunit alpha type-7-B OS=Oryza sativa subsp. indica GN=PAD1 PE=2 SV=1 6 182 2.0E-33
sp|Q97BZ8|PSA_THEVO Proteasome subunit alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmA PE=3 SV=2 3 182 2.0E-33
sp|Q58DU5|PSA3_BOVIN Proteasome subunit alpha type-3 OS=Bos taurus GN=PSMA3 PE=1 SV=3 4 178 2.0E-33
sp|P25788|PSA3_HUMAN Proteasome subunit alpha type-3 OS=Homo sapiens GN=PSMA3 PE=1 SV=2 4 178 2.0E-33
sp|O81149|PSA5A_ARATH Proteasome subunit alpha type-5-A OS=Arabidopsis thaliana GN=PAE1 PE=1 SV=1 1 231 2.0E-33
sp|Q9SXU1|PSA7_CICAR Proteasome subunit alpha type-7 OS=Cicer arietinum GN=PAD1 PE=2 SV=1 6 182 2.0E-33
sp|Q975G5|PSA_SULTO Proteasome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmA PE=3 SV=2 6 229 2.0E-33
sp|P30186|PSA7A_ARATH Proteasome subunit alpha type-7-A OS=Arabidopsis thaliana GN=PAD1 PE=1 SV=1 6 238 3.0E-33
sp|A7I9C7|PSA_METB6 Proteasome subunit alpha OS=Methanoregula boonei (strain 6A8) GN=psmA PE=3 SV=1 6 180 4.0E-33
sp|Q42134|PSA5B_ARATH Proteasome subunit alpha type-5-B OS=Arabidopsis thaliana GN=PAE2 PE=1 SV=2 1 231 5.0E-33
sp|O24616|PSA7B_ARATH Proteasome subunit alpha type-7-B OS=Arabidopsis thaliana GN=PAD2 PE=1 SV=2 6 253 5.0E-33
sp|Q9Z2U1|PSA5_MOUSE Proteasome subunit alpha type-5 OS=Mus musculus GN=Psma5 PE=1 SV=1 1 241 7.0E-33
sp|P28066|PSA5_HUMAN Proteasome subunit alpha type-5 OS=Homo sapiens GN=PSMA5 PE=1 SV=3 1 241 7.0E-33
sp|Q5E987|PSA5_BOVIN Proteasome subunit alpha type-5 OS=Bos taurus GN=PSMA5 PE=1 SV=1 1 241 7.0E-33
sp|P25156|PSA_THEAC Proteasome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmA PE=1 SV=2 3 182 7.0E-33
sp|Q6YT00|PSA7A_ORYSJ Proteasome subunit alpha type-7-A OS=Oryza sativa subsp. japonica GN=Os08g0548900 PE=2 SV=1 6 181 7.0E-33
sp|A2YXU2|PSA7A_ORYSI Proteasome subunit alpha type-7-A OS=Oryza sativa subsp. indica GN=OsI_029135 PE=2 SV=2 6 181 7.0E-33
sp|P90513|PSA3_ACACA Proteasome subunit alpha type-3 (Fragment) OS=Acanthamoeba castellanii PE=2 SV=1 4 178 1.0E-32
sp|O24733|PSA_THEK1 Proteasome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=psmA PE=3 SV=1 3 256 2.0E-32
sp|Q9M4T8|PSA5_SOYBN Proteasome subunit alpha type-5 OS=Glycine max GN=PAE1 PE=2 SV=1 1 231 2.0E-32
sp|O23708|PSA2A_ARATH Proteasome subunit alpha type-2-A OS=Arabidopsis thaliana GN=PAB1 PE=1 SV=1 1 256 5.0E-32
sp|Q5JIU9|PSA_THEKO Proteasome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmA PE=3 SV=1 3 256 5.0E-32
sp|Q5RDH8|PSA7_PONAB Proteasome subunit alpha type-7 OS=Pongo abelii GN=PSMA7 PE=2 SV=2 5 180 6.0E-32
sp|Q8L4A7|PSA2B_ARATH Proteasome subunit alpha type-2-B OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 1 180 7.0E-32
sp|Q3ZBG0|PSA7_BOVIN Proteasome subunit alpha type-7 OS=Bos taurus GN=PSMA7 PE=1 SV=1 5 180 8.0E-32
sp|Q9Z2U0|PSA7_MOUSE Proteasome subunit alpha type-7 OS=Mus musculus GN=Psma7 PE=1 SV=1 5 180 9.0E-32
sp|B8GEZ3|PSA_METPE Proteasome subunit alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmA PE=3 SV=1 6 189 9.0E-32
sp|Q9UT97|PSA5_SCHPO Probable proteasome subunit alpha type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup2 PE=1 SV=1 1 182 1.0E-31
sp|P34120|PSA7_DICDI Proteasome subunit alpha type-7 OS=Dictyostelium discoideum GN=psmA7 PE=3 SV=1 1 180 1.0E-31
sp|O13268|PSA7_CHICK Proteasome subunit alpha type-7 OS=Gallus gallus GN=PSMA7 PE=2 SV=1 5 180 2.0E-31
sp|O14818|PSA7_HUMAN Proteasome subunit alpha type-7 OS=Homo sapiens GN=PSMA7 PE=1 SV=1 5 180 2.0E-31
sp|Q5VRG3|PSA4B_ORYSJ Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. japonica GN=Os06g0167600 PE=2 SV=1 1 230 2.0E-31
sp|P0C8Y9|PSA4B_ORYSI Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. indica GN=OsI_021067 PE=1 SV=1 1 230 2.0E-31
sp|Q9XZG5|PSA5_TRYBB Proteasome subunit alpha type-5 OS=Trypanosoma brucei brucei PE=3 SV=1 2 263 4.0E-31
sp|P0C1G8|PSA4A_ORYSJ Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. japonica GN=PAC1 PE=2 SV=1 1 230 4.0E-31
sp|A2Y9X7|PSA4A_ORYSI Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. indica GN=OsI_021120 PE=1 SV=2 1 230 4.0E-31
sp|O59219|PSA_PYRHO Proteasome subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmA PE=3 SV=1 6 256 5.0E-31
sp|Q9V122|PSA_PYRAB Proteasome subunit alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmA PE=3 SV=1 6 256 6.0E-31
sp|P18053|PSA4_DROME Proteasome subunit alpha type-4 OS=Drosophila melanogaster GN=Prosalpha3 PE=1 SV=2 6 261 7.0E-31
sp|Q9PVQ1|PSA7B_XENLA Proteasome subunit alpha type-7-B OS=Xenopus laevis GN=psma7-b PE=2 SV=1 5 180 7.0E-31
sp|P34064|PSA5_RAT Proteasome subunit alpha type-5 OS=Rattus norvegicus GN=Psma5 PE=1 SV=1 1 241 7.0E-31
sp|Q9PVY6|PSA7A_XENLA Proteasome subunit alpha type-7-A OS=Xenopus laevis GN=psma7-a PE=2 SV=1 5 180 8.0E-31
sp|P48004|PSA7_RAT Proteasome subunit alpha type-7 OS=Rattus norvegicus GN=Psma7 PE=1 SV=1 5 180 8.0E-31
sp|P34119|PSA4_DICDI Proteasome subunit alpha type-4 OS=Dictyostelium discoideum GN=psmA4 PE=2 SV=1 6 181 9.0E-31
sp|B6YSH9|PSA_THEON Proteasome subunit alpha OS=Thermococcus onnurineus (strain NA1) GN=psmA PE=3 SV=1 3 256 1.0E-30
sp|Q9PTW9|PSA7_CARAU Proteasome subunit alpha type-7 OS=Carassius auratus GN=psma7 PE=2 SV=1 6 180 1.0E-30
sp|A3CW55|PSA_METMJ Proteasome subunit alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmA PE=3 SV=1 6 261 2.0E-30
sp|Q95005|PSA7_CAEEL Proteasome subunit alpha type-7 OS=Caenorhabditis elegans GN=pas-4 PE=1 SV=1 6 253 2.0E-30
sp|Q09682|PSA3_SCHPO Probable proteasome subunit alpha type-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.01c PE=3 SV=1 1 181 3.0E-30
sp|Q54DM7|PSA2_DICDI Proteasome subunit alpha type-2 OS=Dictyostelium discoideum GN=psmA2 PE=3 SV=1 4 180 4.0E-30
sp|Q9CWH6|PSA7L_MOUSE Proteasome subunit alpha type-7-like OS=Mus musculus GN=Psma8 PE=1 SV=1 4 180 5.0E-30
sp|C5A2C2|PSA_THEGJ Proteasome subunit alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmA PE=3 SV=1 3 256 6.0E-30
sp|P32379|PSA5_YEAST Proteasome subunit alpha type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP2 PE=1 SV=2 1 180 7.0E-30
sp|O59770|PSA7_SCHPO Probable proteasome subunit alpha type-7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre10 PE=1 SV=1 4 178 2.0E-29
sp|P21242|PSA7_YEAST Probable proteasome subunit alpha type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE10 PE=1 SV=2 4 250 2.0E-29
sp|Q4R7D9|PSA7L_MACFA Proteasome subunit alpha type-7-like OS=Macaca fascicularis GN=PSMA7L PE=2 SV=1 4 180 3.0E-29
sp|Q8U0L6|PSA_PYRFU Proteasome subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmA PE=3 SV=1 6 181 6.0E-29
sp|Q8ZVM1|PSA_PYRAE Proteasome subunit alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmA PE=3 SV=1 6 246 6.0E-29
sp|Q9YC01|PSA_AERPE Proteasome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmA PE=3 SV=1 3 181 1.0E-28
sp|Q9NDA2|PSA7_TRYBB Proteasome subunit alpha type-7 OS=Trypanosoma brucei brucei GN=PSA4 PE=2 SV=1 5 181 2.0E-28
sp|P21670|PSA4_RAT Proteasome subunit alpha type-4 OS=Rattus norvegicus GN=Psma4 PE=1 SV=1 1 182 3.0E-28
sp|Q9R1P0|PSA4_MOUSE Proteasome subunit alpha type-4 OS=Mus musculus GN=Psma4 PE=1 SV=1 1 182 3.0E-28
sp|P25789|PSA4_HUMAN Proteasome subunit alpha type-4 OS=Homo sapiens GN=PSMA4 PE=1 SV=1 1 182 3.0E-28
sp|Q3ZCK9|PSA4_BOVIN Proteasome subunit alpha type-4 OS=Bos taurus GN=PSMA4 PE=1 SV=1 1 182 3.0E-28
sp|Q95008|PSA5_CAEEL Proteasome subunit alpha type-5 OS=Caenorhabditis elegans GN=pas-5 PE=1 SV=1 1 230 4.0E-28
sp|Q94561|PSA5_ENTHI Proteasome subunit alpha type-5 OS=Entamoeba histolytica PE=3 SV=2 1 254 4.0E-28
sp|Q9LSU0|PSA3_ORYSJ Proteasome subunit alpha type-3 OS=Oryza sativa subsp. japonica GN=PAG1 PE=2 SV=1 4 194 6.0E-28
sp|Q4R932|PSA4_MACFA Proteasome subunit alpha type-4 OS=Macaca fascicularis GN=PSMA4 PE=2 SV=1 1 182 7.0E-28
sp|Q27562|PSA1_DICDI Proteasome subunit alpha type-1 OS=Dictyostelium discoideum GN=psmA1 PE=3 SV=1 1 184 3.0E-27
sp|O24362|PSA3_SPIOL Proteasome subunit alpha type-3 OS=Spinacia oleracea GN=PAG1 PE=2 SV=1 4 194 4.0E-27
sp|Q55G04|PSA5_DICDI Proteasome subunit alpha type-5 OS=Dictyostelium discoideum GN=psmA5 PE=3 SV=1 1 236 4.0E-27
sp|Q8X077|PSA2_NEUCR Probable proteasome subunit alpha type-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pca-2 PE=3 SV=1 6 256 7.0E-27
sp|Q9U793|PSA2_TRYBB Proteasome subunit alpha type-2 OS=Trypanosoma brucei brucei PE=2 SV=1 1 180 2.0E-26
sp|Q8TAA3|PSA7L_HUMAN Proteasome subunit alpha type-7-like OS=Homo sapiens GN=PSMA8 PE=2 SV=3 6 230 2.0E-26
sp|O94579|PSA2_SCHPO Probable proteasome subunit alpha type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre8 PE=3 SV=1 6 181 3.0E-26
sp|O23715|PSA3_ARATH Proteasome subunit alpha type-3 OS=Arabidopsis thaliana GN=PAG1 PE=1 SV=2 4 178 7.0E-26
sp|P25787|PSA2_HUMAN Proteasome subunit alpha type-2 OS=Homo sapiens GN=PSMA2 PE=1 SV=2 1 182 1.0E-25
sp|Q3T0Y5|PSA2_BOVIN Proteasome subunit alpha type-2 OS=Bos taurus GN=PSMA2 PE=1 SV=3 1 182 1.0E-25
sp|P17220|PSA2_RAT Proteasome subunit alpha type-2 OS=Rattus norvegicus GN=Psma2 PE=1 SV=3 1 182 1.0E-25
sp|P49722|PSA2_MOUSE Proteasome subunit alpha type-2 OS=Mus musculus GN=Psma2 PE=1 SV=3 1 182 1.0E-25
sp|P40303|PSA4_YEAST Proteasome subunit alpha type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE6 PE=1 SV=1 4 194 1.0E-25
sp|Q95083|PSA5_DROME Proteasome subunit alpha type-5 OS=Drosophila melanogaster GN=Prosalpha5 PE=2 SV=2 1 181 2.0E-25
sp|P22769|PSA71_DROME Proteasome subunit alpha type-7-1 OS=Drosophila melanogaster GN=Prosalpha4 PE=1 SV=2 4 220 6.0E-25
sp|Q24178|PSA72_DROME Proteasome subunit alpha type-7-1A OS=Drosophila melanogaster GN=Prosalpha4T1 PE=2 SV=2 4 167 7.0E-25
sp|O16811|PSA71_DROVI Proteasome subunit alpha type-7-1 OS=Drosophila virilis GN=Pros28.1 PE=3 SV=1 4 189 1.0E-24
sp|Q27575|PSA73_DROME Proteasome subunit alpha type-7-1B OS=Drosophila melanogaster GN=Prosalpha4T2 PE=2 SV=2 6 178 1.0E-24
sp|Q5V2X8|PSA1_HALMA Proteasome subunit alpha 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA1 PE=3 SV=1 5 256 2.0E-24
sp|Q3IPJ1|PSA_NATPD Proteasome subunit alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=psmA PE=3 SV=1 5 256 2.0E-24
sp|Q27488|PSA2_CAEEL Proteasome subunit alpha type-2 OS=Caenorhabditis elegans GN=pas-2 PE=1 SV=1 6 186 3.0E-24
sp|Q9V2V6|PSA1_HALVD Proteasome subunit alpha 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmA1 PE=1 SV=2 5 232 5.0E-24
sp|Q5V1D4|PSA2_HALMA Proteasome subunit alpha 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA2 PE=3 SV=1 5 182 9.0E-24
sp|P57697|PSA_HALSA Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmA PE=3 SV=1 5 232 1.0E-23
sp|B0R2T2|PSA_HALS3 Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmA PE=3 SV=1 5 232 1.0E-23
sp|P12881|PSA1_DROME Proteasome subunit alpha type-1 OS=Drosophila melanogaster GN=Prosalpha6 PE=1 SV=1 1 187 1.0E-23
sp|Q18K08|PSA_HALWD Proteasome subunit alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmA PE=3 SV=1 5 188 2.0E-23
sp|P23639|PSA2_YEAST Proteasome subunit alpha type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE8 PE=1 SV=1 6 181 9.0E-23
sp|P40301|PSA2_DROME Proteasome subunit alpha type-2 OS=Drosophila melanogaster GN=Prosalpha2 PE=1 SV=1 1 182 2.0E-22
sp|O73672|PSA2_CARAU Proteasome subunit alpha type-2 OS=Carassius auratus GN=psma2 PE=2 SV=3 1 260 4.0E-22
sp|Q9V2V5|PSA2_HALVD Proteasome subunit alpha 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmA2 PE=1 SV=1 3 180 7.0E-22
sp|P24495|PSA2_XENLA Proteasome subunit alpha type-2 OS=Xenopus laevis GN=psma2 PE=2 SV=2 1 182 1.0E-21
sp|O23712|PSA1B_ARATH Proteasome subunit alpha type-1-B OS=Arabidopsis thaliana GN=PAF2 PE=1 SV=2 1 190 2.0E-21
sp|P34066|PSA1A_ARATH Proteasome subunit alpha type-1-A OS=Arabidopsis thaliana GN=PAF1 PE=1 SV=3 1 187 2.0E-21
sp|O96788|PSA1_TRYBR Proteasome subunit alpha type-1 OS=Trypanosoma brucei rhodesiense PE=2 SV=1 1 181 4.0E-21
sp|Q5REN2|PSA1_PONAB Proteasome subunit alpha type-1 OS=Pongo abelii GN=PSMA1 PE=2 SV=1 1 183 6.0E-21
sp|P25786|PSA1_HUMAN Proteasome subunit alpha type-1 OS=Homo sapiens GN=PSMA1 PE=1 SV=1 1 183 6.0E-21
sp|P18420|PSA1_RAT Proteasome subunit alpha type-1 OS=Rattus norvegicus GN=Psma1 PE=1 SV=2 1 183 6.0E-21
sp|Q9R1P4|PSA1_MOUSE Proteasome subunit alpha type-1 OS=Mus musculus GN=Psma1 PE=1 SV=1 1 183 6.0E-21
sp|Q3T0X5|PSA1_BOVIN Proteasome subunit alpha type-1 OS=Bos taurus GN=PSMA1 PE=1 SV=1 1 183 6.0E-21
sp|Q4R3H2|PSA1_MACFA Proteasome subunit alpha type-1 OS=Macaca fascicularis GN=PSMA1 PE=2 SV=1 1 183 6.0E-21
sp|Q09583|PSA3_CAEEL Proteasome subunit alpha type-3 OS=Caenorhabditis elegans GN=pas-7 PE=1 SV=3 4 235 1.0E-20
sp|O14250|PSA6_SCHPO Probable proteasome subunit alpha type-6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.04c PE=3 SV=1 1 236 2.0E-20
sp|O16812|PSA73_DROVI Proteasome subunit alpha type-7-1B OS=Drosophila virilis GN=Pros28.1B PE=2 SV=1 1 179 7.0E-20
sp|F4JJE5|PSA4B_ARATH Putative proteasome subunit alpha type-4-B OS=Arabidopsis thaliana GN=PAC2 PE=5 SV=1 1 228 8.0E-20
sp|P92188|PSA1_TRYCR Proteasome subunit alpha type-1 OS=Trypanosoma cruzi PE=2 SV=1 1 183 1.0E-19
sp|O42265|PSA1_CHICK Proteasome subunit alpha type-1 OS=Gallus gallus GN=PSMA1 PE=2 SV=2 10 178 5.0E-19
sp|P52428|PSA1_ORYSJ Proteasome subunit alpha type-1 OS=Oryza sativa subsp. japonica GN=PAF1 PE=2 SV=1 1 181 1.0E-18
sp|O44156|PSA1_CAEEL Proteasome subunit alpha type-1 OS=Caenorhabditis elegans GN=pas-6 PE=1 SV=1 1 179 2.0E-18
sp|Q8SRU3|PSA5_ENCCU Probable proteasome subunit alpha type-5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PUP2 PE=1 SV=1 6 182 4.0E-16
sp|P40302|PSA6_YEAST Proteasome subunit alpha type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE5 PE=1 SV=1 1 196 2.0E-15
sp|Q8SRU7|PSA3_ENCCU Probable proteasome subunit alpha type-3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE9 PE=1 SV=1 11 175 2.0E-13
sp|Q8TW10|PSB_METKA Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 33 256 6.0E-09
sp|Q8SQP9|PSA7_ENCCU Probable proteasome subunit alpha type-7 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE10 PE=1 SV=1 9 252 1.0E-08
sp|A8AA46|PSB1_IGNH4 Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 29 240 2.0E-06
sp|Q2NI68|PSB_METST Proteasome subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=psmB PE=3 SV=1 33 182 5.0E-06
sp|A2BN24|PSB1_HYPBU Proteasome subunit beta 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB1 PE=3 SV=1 31 182 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005839 proteasome core complex Yes
GO:0051603 proteolysis involved in protein catabolic process Yes
GO:0019773 proteasome core complex, alpha-subunit complex Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0008152 metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0005575 cellular_component No
GO:0044248 cellular catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0009056 catabolic process No
GO:0019538 protein metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006508 proteolysis No
GO:1901575 organic substance catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044265 cellular macromolecule catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|076370
MSRTSYDRFLTVFSPEGRLYQVEYAFKAISGSGHTAIAIRGKDTAVVITQRKVPDKLLDASTVTHLFSITPTIGC
VMTGLIADAHAQVARARSEAADFRYKFGYEITPDALARRIANINQVYTQRAAMRPLGISMILIGVDPEFGPQCFR
LDPAGYFVGYHATAAGQKQQEAMNQLEKKWKKLDSGRGADEPAKAGQTLSRSEVIEMAIEIMSTVHATDYKPGEI
EVGIVSAGEEEDLKTRGQWRVMGEAEIERHLLAYAEKD*
Coding >AgabiH97|076370
ATGTCCAGGACATCCTACGACAGATTTCTAACAGTCTTCTCTCCAGAGGGCCGTCTGTACCAAGTCGAATATGCA
TTCAAGGCCATCTCTGGCTCTGGCCATACCGCAATAGCAATACGAGGCAAGGATACAGCAGTAGTCATCACCCAG
CGCAAAGTTCCAGACAAACTATTAGACGCGTCCACTGTGACCCATCTTTTCAGCATCACTCCAACTATTGGCTGT
GTAATGACCGGCCTCATCGCCGATGCGCATGCACAGGTCGCTCGTGCCCGTTCCGAAGCTGCAGACTTCCGGTAT
AAATTCGGTTACGAAATTACGCCAGATGCCCTTGCCCGTAGAATTGCCAATATCAATCAAGTTTACACTCAAAGA
GCAGCGATGCGGCCATTAGGAATTTCCATGATCCTCATCGGAGTTGATCCCGAATTTGGCCCACAATGTTTTAGA
CTCGATCCCGCTGGCTACTTTGTTGGATACCATGCGACTGCTGCTGGACAAAAACAGCAAGAAGCCATGAACCAG
CTAGAAAAGAAGTGGAAGAAATTGGACTCGGGTAGAGGCGCCGATGAACCTGCAAAAGCGGGTCAGACGTTGAGC
CGCAGTGAAGTAATAGAGATGGCCATTGAAATCATGTCAACCGTTCATGCCACGGACTATAAACCGGGCGAGATT
GAAGTCGGTATTGTGTCAGCAGGCGAGGAGGAGGACCTGAAGACTAGGGGACAATGGCGGGTTATGGGTGAAGCC
GAAATAGAGCGGCACCTCCTCGCGTATGCAGAGAAAGACTGA
Transcript >AgabiH97|076370
ATGTCCAGGACATCCTACGACAGATTTCTAACAGTCTTCTCTCCAGAGGGCCGTCTGTACCAAGTCGAATATGCA
TTCAAGGCCATCTCTGGCTCTGGCCATACCGCAATAGCAATACGAGGCAAGGATACAGCAGTAGTCATCACCCAG
CGCAAAGTTCCAGACAAACTATTAGACGCGTCCACTGTGACCCATCTTTTCAGCATCACTCCAACTATTGGCTGT
GTAATGACCGGCCTCATCGCCGATGCGCATGCACAGGTCGCTCGTGCCCGTTCCGAAGCTGCAGACTTCCGGTAT
AAATTCGGTTACGAAATTACGCCAGATGCCCTTGCCCGTAGAATTGCCAATATCAATCAAGTTTACACTCAAAGA
GCAGCGATGCGGCCATTAGGAATTTCCATGATCCTCATCGGAGTTGATCCCGAATTTGGCCCACAATGTTTTAGA
CTCGATCCCGCTGGCTACTTTGTTGGATACCATGCGACTGCTGCTGGACAAAAACAGCAAGAAGCCATGAACCAG
CTAGAAAAGAAGTGGAAGAAATTGGACTCGGGTAGAGGCGCCGATGAACCTGCAAAAGCGGGTCAGACGTTGAGC
CGCAGTGAAGTAATAGAGATGGCCATTGAAATCATGTCAACCGTTCATGCCACGGACTATAAACCGGGCGAGATT
GAAGTCGGTATTGTGTCAGCAGGCGAGGAGGAGGACCTGAAGACTAGGGGACAATGGCGGGTTATGGGTGAAGCC
GAAATAGAGCGGCACCTCCTCGCGTATGCAGAGAAAGACTGA
Gene >AgabiH97|076370
ATGTCCAGGACATCCTACGACAGGCATGCGCTTTTTTTTCTCCATCTTGCCTTTTTAAACTTACACCATCCCCCA
GATTTCTAACAGTCTTCTCTCCAGAGGGCCGTCTGTACCAAGTCGGCAAGTGGATCCGTCTCTACCAGACCAGAC
ACCTGATCCCACTATCATTCGACAGAATATGCATTCAAGGCCATCTCTGGCTCTGGCCATACCGCAATAGCAATA
CGAGGCAAGGATACAGCAGTAGTCATCACCCAGCGCAAAGTTCCAGTGCGTATCGTGTTTCCGATACTGTATCTA
CTGTGCTCTTATTTCCTTCGAGGACAAACTATTAGACGCGTCCACTGTGACCCATCTTTTCAGCATCACTCCAAC
TATTGGCTGTGTAATGACCGGCCTCATCGGTTTGTAGACTTCCTGATTTCTCTTTCTGAGGATTAACTATGGTAT
GTAGCCGATGCGCATGCACAGGTCGCTCGTGCCCGTTCCGAAGCTGCAGACTTCCGGTATAAATTCGGTTACGAA
ATTACGCCAGATGCCCTTGCCCGTAGAATTGCCAATATCAATCAAGTTTACACTCAAAGAGCAGCGATGCGGCCA
TTAGGAATTTGTACGGCCTCCTTAGATTTCTGTTGTATCTCCACTAATGGGTTCTTGTAGCCATGATCCTCATCG
GAGTTGATCCCGAATTTGGCCCACAATGTTTTAGACTCGATCCCGCTGGCTACTTTGTTGGATACCATGCGACTG
CTGCTGGACAAAAACAGCAAGAAGCCATGAACCAGCTAGAAAAGAAGTGGAAGAAATTGGACTCGGGTAGAGGCG
CCGATGAACCTGCAAAAGCGGGTCAGACGTTGAGCCGCAGTGAAGTAATAGAGGTGAGTGGAATGTGCTCTTCTG
TAGCTATCGTTCTCAAGAGGATGCAGATGGCCATTGAAATCATGTCAACCGTTCATGCCACGGACTATAAACCGG
GCGAGATTGAAGTCGGTATTGTGTCAGCAGGCGAGGAGGAGGACCTGAAGACTAGGGGACAATGGCGGGTTATGG
GTGAAGCCGAAATAGAGCGGCACCTCCTCGCGTATGCAGAGAAAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail