Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|076220
Gene name
Locationscaffold_4:2568036..2569117
Strand-
Gene length (bp)1081
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 3.6E-09 55 125
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 3.8E-27 148 234

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8TFH3|OST3_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ost3 PE=3 SV=1 148 237 7.0E-09
sp|P34669|OST3_CAEEL Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Caenorhabditis elegans GN=ZK686.3 PE=3 SV=2 55 235 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 173 195 22
2 208 227 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|076220
MLLRALVLPFLALAALAADPVEQLSQLASRGNGNIKLDTCESASSYITLSYATPQLGLVAAPVVFTWAPAEGDRK
SANTLPDKYDFNEGFGAGPFADSVSRHTPVKIPYREPIGWTRLILTCIFVPLDMGFGNHLHFSHYDLWLHVHKIR
NMPYVGTNGWIASGFQSQYGQEVHVVAFIYGLLPFSFLMLIFVVPNQKSPARQRAQVYLWSAVMVIIYSVLISLF
RLKNRGYPFSRMCHFPRSNVSDSPFGVVRRRSVV*
Coding >AgabiH97|076220
ATGCTCCTCCGCGCCCTTGTCCTCCCCTTCCTCGCCCTCGCCGCCCTCGCTGCTGACCCCGTCGAGCAGCTCTCC
CAGCTCGCCTCTCGCGGCAACGGCAACATCAAGCTCGACACCTGTGAGTCTGCTTCCTCCTACATCACACTATCT
TACGCCACCCCACAGCTCGGTCTCGTAGCTGCACCCGTTGTGTTTACCTGGGCACCCGCCGAAGGCGATCGCAAG
TCTGCCAATACCCTCCCTGACAAATATGATTTCAACGAAGGCTTCGGTGCAGGTCCCTTCGCTGATTCCGTTTCG
AGGCATACTCCTGTCAAAATTCCCTACCGCGAACCCATCGGCTGGACTCGTCTCATTCTCACCTGCATCTTTGTC
CCGCTGGACATGGGCTTTGGGAACCATCTCCACTTCTCTCATTATGACCTCTGGTTACATGTTCATAAGATTAGA
AACATGCCTTATGTTGGTACCAACGGTTGGATTGCTTCTGGTTTCCAGAGTCAATATGGTCAAGAAGTCCACGTC
GTCGCTTTCATCTACGGTCTACTTCCCTTCTCCTTCCTCATGCTCATCTTTGTCGTGCCAAACCAAAAATCCCCA
GCTCGCCAACGCGCTCAAGTCTATCTCTGGTCTGCAGTCATGGTCATCATTTATTCCGTTCTTATTTCCCTTTTC
CGTCTTAAGAACCGTGGTTACCCTTTTTCGAGGATGTGCCATTTTCCTCGCTCGAATGTCTCGGATTCGCCCTTT
GGAGTTGTGCGCCGGCGAAGTGTGGTCTGA
Transcript >AgabiH97|076220
ATGCTCCTCCGCGCCCTTGTCCTCCCCTTCCTCGCCCTCGCCGCCCTCGCTGCTGACCCCGTCGAGCAGCTCTCC
CAGCTCGCCTCTCGCGGCAACGGCAACATCAAGCTCGACACCTGTGAGTCTGCTTCCTCCTACATCACACTATCT
TACGCCACCCCACAGCTCGGTCTCGTAGCTGCACCCGTTGTGTTTACCTGGGCACCCGCCGAAGGCGATCGCAAG
TCTGCCAATACCCTCCCTGACAAATATGATTTCAACGAAGGCTTCGGTGCAGGTCCCTTCGCTGATTCCGTTTCG
AGGCATACTCCTGTCAAAATTCCCTACCGCGAACCCATCGGCTGGACTCGTCTCATTCTCACCTGCATCTTTGTC
CCGCTGGACATGGGCTTTGGGAACCATCTCCACTTCTCTCATTATGACCTCTGGTTACATGTTCATAAGATTAGA
AACATGCCTTATGTTGGTACCAACGGTTGGATTGCTTCTGGTTTCCAGAGTCAATATGGTCAAGAAGTCCACGTC
GTCGCTTTCATCTACGGTCTACTTCCCTTCTCCTTCCTCATGCTCATCTTTGTCGTGCCAAACCAAAAATCCCCA
GCTCGCCAACGCGCTCAAGTCTATCTCTGGTCTGCAGTCATGGTCATCATTTATTCCGTTCTTATTTCCCTTTTC
CGTCTTAAGAACCGTGGTTACCCTTTTTCGAGGATGTGCCATTTTCCTCGCTCGAATGTCTCGGATTCGCCCTTT
GGAGTTGTGCGCCGGCGAAGTGTGGTCTGA
Gene >AgabiH97|076220
ATGCTCCTCCGCGCCCTTGTCCTCCCCTTCCTCGCCCTCGCCGCCCTCGCTGCTGACCCCGTCGAGCAGCTCTCC
CAGCTCGCCTCTCGCGGCAACGGCAACATCAAGCTCGACACCTGTGGACCTCGGTGCCCCAACCCGAGCGTGACA
ATCACTTCTTTGCCACTCTCGACTTTGATGACGCTCCTGGCGTGTTTCAAAAGGTGAGTCTGCTTCCTCCTACAT
CACACTATCTTACGCCACCCCACAGCTCGGTCTCGTAGCTGCACCCGTTGTGTTTACCTGGGCACCCGCCGAAGG
CGATCGCAAGTCTGCCAATACCCTCCCTGACAAATATGATTTCAACGAGTATGTTTCTGTACTGCTTTGCAATTA
CCTCAGCTCATTCTCTTCCCTTTTGCTAGAGGCTTCGGTGCAGGTCCCTTCGCTGATTCCGTTTCGAGGCATACT
CCTGTCAAAATTCCCTACCGCGAACCCATCGGCTGGACTCGTCTCATTCTCACCTGCATCTTTGGTCTTTCCCTT
TTACTCGCCCTCCGTTTCGCTTCTCCCCTTTTCCAGTCCCGCTGGACATGGGCTTTGGGAACCATCTCCACTTCT
CTCATTATGACCTCTGGTTACATGTTCATAAGATTAGAAACATGCCTTATGTTGGTACCAACGGTTGGATTGCTT
CTGGTTTCCAGAGTCAATATGGTCAAGAAGTCCACGTCGTCGCTTTCATCTGTACGTGTTCTCTCACTCGCTTTT
TAATTTGCCCGTTCACATCTCTTGCAGACGGTCTACTTCCCTTCTCCTTCCTCATGCTCATCTTTGTCGTGCCAA
ACCAAAAATCCCCAGCTCGCCAACGCGCTCAAGTCTATCTCTGGTCTGCAGTCATGGTCATCATTTATTCCGTTC
TTATTTCCCTTTTCCGTCTTAAGAACCGTGGTTACCCTTTTTCGAGGATGTGCCATTTTCCTCGCTCGAATGTCT
CGGTGCGTCGTTTCTGCTTCCTCGTCAGTCTGAAGATGGTTCCTCATCCTTCTCACTTTTTTAGGATTCGCCCTT
TGGAGTTGTGCGCCGGCGAAGTGTGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail