Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|076160
Gene name
Locationscaffold_4:2548291..2550784
Strand+
Gene length (bp)2493
Transcript length (bp)2493
Coding sequence length (bp)2493
Protein length (aa) 831

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00665 rve Integrase core domain 6.1E-11 731 824
PF13976 gag_pre-integrs GAG-pre-integrase domain 7.9E-09 672 715
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 4.3E-08 2 113

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 521 822 8.0E-16

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|076160
MLSQAAAQTDARALWNWLEGQYGQKGPTFAYERFITAQNFKINDSADPSSAIADLYALFAAVESTGALIHESIRT
MMLLNALPNWFEHVAANILAEKRSVADLKWEETCARIIAVWRNPHTVANAACFRQQNQPKPRWDNKKPNQGQGKS
QGSGSGSGSGQNQNKQQQPQQKKEGEEQSNDKKKKRTRSRKKKQGNEASTTSIEEVKDTTPDYSASSAIASMAQL
ASTSTCTKVNEMKSRFVPLPSRSDPNLTRNRSPKLGNHTISGEEFFFFPDGNMIDLSPLDTDIDSSTLPRLCPAT
RNLLLDESDVDLDPSDSGLIPRDPRKRLSPRHSPMPYERAKSKVLSLWDQRLNAVTVTAPPIEDGAGQVGGNAPA
VKMPATKGKLVEKMDVDKADEISLSDEDGEFEYEYDVECEPDSFAQVPRFSPISQINSWILQGSIVSRDKGLVEP
AYLRERSGRSLWLQLGSSSTATPVLYNMIANETTSLSSLLDRMNPICEVLHACHSNCEGCKTRKNLEKHSWLLDS
GASCHFTPNLEDFAHLQCGNFGIVHTANKDSVLKIQGRGHVLIEHTVKDISTGKEFKSVSKIWPVFYVNGMNHRL
LSTAQLLKSGLKLESTKDGSVFKNEAGQAILSARPEGLFGGMHIVECTFLKHSKTEPYLLNASGILQLPDYTIWH
CRLGHPSDNVLKKFFEETLGVPKINIPQQKPVCDGCVRGKLTQQSFPQSEKCATSVLELVHLDLFELPVPSYHKY
KWVMTLLDDYSGLAQIVMITKKSDAALQLINILKQLATQSDQKIKRLRTDQGGEYVNDTLSTYLKSQGIVHELSH
QEKVK*
Coding >AgabiH97|076160
ATGCTCAGTCAAGCGGCCGCTCAAACGGATGCTAGAGCTCTTTGGAATTGGTTGGAAGGCCAATATGGCCAAAAA
GGACCAACGTTCGCCTATGAACGTTTTATTACAGCTCAAAATTTCAAGATAAATGACTCCGCCGATCCATCATCT
GCGATTGCAGATCTCTACGCATTATTTGCCGCTGTCGAAAGCACTGGTGCGTTGATACATGAGTCGATCCGCACT
ATGATGCTCCTCAACGCTCTCCCCAACTGGTTCGAGCATGTTGCTGCAAACATTCTTGCTGAGAAAAGGTCGGTT
GCCGATCTTAAATGGGAGGAAACTTGTGCCCGCATTATTGCTGTGTGGCGCAACCCCCATACAGTTGCCAATGCT
GCGTGCTTCCGCCAGCAGAACCAGCCTAAACCCAGATGGGACAATAAAAAGCCCAATCAAGGGCAAGGCAAGTCC
CAAGGCTCTGGTTCCGGTTCTGGCTCCGGCCAGAACCAAAACAAGCAACAACAACCTCAGCAGAAGAAGGAAGGT
GAAGAGCAGAGTAACGACAAAAAGAAGAAGAGAACCCGCTCCCGTAAAAAGAAGCAGGGTAACGAGGCTTCTACC
ACCTCTATCGAAGAAGTCAAGGATACGACTCCTGACTACTCCGCTTCTTCTGCCATTGCTTCAATGGCGCAGCTC
GCATCCACCTCTACATGCACAAAAGTCAATGAGATGAAGAGCAGGTTCGTCCCGCTTCCATCTAGATCAGATCCT
AATCTAACAAGGAATAGATCGCCCAAGTTGGGCAACCATACCATTTCGGGTGAGGAATTCTTTTTCTTCCCTGAT
GGAAATATGATTGATCTTTCCCCACTGGATACTGACATTGACTCCTCGACTTTGCCTCGACTTTGTCCTGCGACG
CGAAATCTCCTTCTGGACGAATCTGATGTTGATCTTGATCCATCAGACTCCGGGTTGATCCCTCGGGACCCTCGG
AAACGTCTTTCCCCTCGCCATTCCCCCATGCCCTACGAAAGGGCCAAATCGAAAGTGTTATCCCTCTGGGATCAA
CGTCTTAACGCAGTGACTGTTACAGCCCCTCCAATTGAGGATGGGGCCGGTCAAGTGGGTGGTAATGCTCCGGCT
GTAAAAATGCCGGCTACGAAGGGAAAACTAGTTGAGAAGATGGATGTTGACAAAGCAGATGAGATTTCTCTCAGC
GATGAAGATGGAGAATTTGAATATGAGTATGATGTGGAATGCGAACCGGATAGCTTTGCGCAAGTCCCTCGCTTC
TCTCCCATATCTCAGATTAACTCATGGATTCTACAGGGCAGTATTGTCTCCAGAGACAAAGGCTTGGTTGAACCA
GCCTATCTCCGAGAAAGATCGGGCCGCTCTTTGTGGCTTCAATTAGGATCGTCGAGTACTGCTACACCTGTATTA
TATAATATGATCGCAAATGAGACTACTTCTTTATCCTCTTTGCTTGATCGAATGAATCCAATATGTGAAGTTCTC
CATGCCTGTCATTCAAATTGTGAGGGTTGCAAAACCCGAAAGAATCTAGAAAAACATAGTTGGTTGCTCGATAGT
GGTGCTTCATGCCACTTCACACCGAACCTTGAGGATTTTGCACATTTACAATGTGGAAACTTCGGTATCGTGCAT
ACTGCAAATAAAGACTCTGTACTCAAAATCCAGGGACGCGGACATGTCTTAATCGAGCATACCGTAAAAGATATC
TCCACGGGAAAAGAATTTAAATCAGTATCAAAGATCTGGCCCGTGTTCTATGTCAACGGCATGAATCATAGACTT
CTTTCAACTGCTCAGTTGTTGAAGTCTGGACTTAAACTAGAGTCTACAAAAGATGGATCTGTATTCAAAAACGAA
GCAGGTCAAGCGATTCTTAGTGCCCGTCCGGAAGGTCTTTTTGGCGGCATGCACATTGTTGAGTGTACCTTCTTA
AAACACTCCAAAACAGAACCATACTTGCTTAACGCAAGCGGAATACTCCAGCTCCCTGACTACACCATTTGGCAT
TGTAGATTAGGTCATCCTTCTGATAATGTGTTGAAGAAATTCTTCGAGGAAACCCTAGGAGTACCGAAGATTAAT
ATTCCACAACAGAAACCGGTTTGTGATGGTTGTGTTCGTGGCAAACTTACGCAACAATCATTTCCACAATCGGAA
AAATGTGCTACTTCAGTACTCGAACTGGTCCACTTGGATCTATTCGAACTCCCTGTCCCCTCTTATCACAAATAC
AAATGGGTGATGACTTTGCTTGACGACTATTCCGGTCTCGCTCAGATTGTCATGATAACCAAGAAAAGTGATGCC
GCGTTACAGTTGATTAATATCCTAAAACAGTTGGCTACTCAATCTGATCAAAAGATCAAAAGATTGCGTACAGAT
CAAGGAGGAGAGTATGTCAATGATACACTCTCGACATACCTGAAGTCACAAGGCATTGTGCATGAACTCTCACAT
CAGGAAAAGGTAAAGTGA
Transcript >AgabiH97|076160
ATGCTCAGTCAAGCGGCCGCTCAAACGGATGCTAGAGCTCTTTGGAATTGGTTGGAAGGCCAATATGGCCAAAAA
GGACCAACGTTCGCCTATGAACGTTTTATTACAGCTCAAAATTTCAAGATAAATGACTCCGCCGATCCATCATCT
GCGATTGCAGATCTCTACGCATTATTTGCCGCTGTCGAAAGCACTGGTGCGTTGATACATGAGTCGATCCGCACT
ATGATGCTCCTCAACGCTCTCCCCAACTGGTTCGAGCATGTTGCTGCAAACATTCTTGCTGAGAAAAGGTCGGTT
GCCGATCTTAAATGGGAGGAAACTTGTGCCCGCATTATTGCTGTGTGGCGCAACCCCCATACAGTTGCCAATGCT
GCGTGCTTCCGCCAGCAGAACCAGCCTAAACCCAGATGGGACAATAAAAAGCCCAATCAAGGGCAAGGCAAGTCC
CAAGGCTCTGGTTCCGGTTCTGGCTCCGGCCAGAACCAAAACAAGCAACAACAACCTCAGCAGAAGAAGGAAGGT
GAAGAGCAGAGTAACGACAAAAAGAAGAAGAGAACCCGCTCCCGTAAAAAGAAGCAGGGTAACGAGGCTTCTACC
ACCTCTATCGAAGAAGTCAAGGATACGACTCCTGACTACTCCGCTTCTTCTGCCATTGCTTCAATGGCGCAGCTC
GCATCCACCTCTACATGCACAAAAGTCAATGAGATGAAGAGCAGGTTCGTCCCGCTTCCATCTAGATCAGATCCT
AATCTAACAAGGAATAGATCGCCCAAGTTGGGCAACCATACCATTTCGGGTGAGGAATTCTTTTTCTTCCCTGAT
GGAAATATGATTGATCTTTCCCCACTGGATACTGACATTGACTCCTCGACTTTGCCTCGACTTTGTCCTGCGACG
CGAAATCTCCTTCTGGACGAATCTGATGTTGATCTTGATCCATCAGACTCCGGGTTGATCCCTCGGGACCCTCGG
AAACGTCTTTCCCCTCGCCATTCCCCCATGCCCTACGAAAGGGCCAAATCGAAAGTGTTATCCCTCTGGGATCAA
CGTCTTAACGCAGTGACTGTTACAGCCCCTCCAATTGAGGATGGGGCCGGTCAAGTGGGTGGTAATGCTCCGGCT
GTAAAAATGCCGGCTACGAAGGGAAAACTAGTTGAGAAGATGGATGTTGACAAAGCAGATGAGATTTCTCTCAGC
GATGAAGATGGAGAATTTGAATATGAGTATGATGTGGAATGCGAACCGGATAGCTTTGCGCAAGTCCCTCGCTTC
TCTCCCATATCTCAGATTAACTCATGGATTCTACAGGGCAGTATTGTCTCCAGAGACAAAGGCTTGGTTGAACCA
GCCTATCTCCGAGAAAGATCGGGCCGCTCTTTGTGGCTTCAATTAGGATCGTCGAGTACTGCTACACCTGTATTA
TATAATATGATCGCAAATGAGACTACTTCTTTATCCTCTTTGCTTGATCGAATGAATCCAATATGTGAAGTTCTC
CATGCCTGTCATTCAAATTGTGAGGGTTGCAAAACCCGAAAGAATCTAGAAAAACATAGTTGGTTGCTCGATAGT
GGTGCTTCATGCCACTTCACACCGAACCTTGAGGATTTTGCACATTTACAATGTGGAAACTTCGGTATCGTGCAT
ACTGCAAATAAAGACTCTGTACTCAAAATCCAGGGACGCGGACATGTCTTAATCGAGCATACCGTAAAAGATATC
TCCACGGGAAAAGAATTTAAATCAGTATCAAAGATCTGGCCCGTGTTCTATGTCAACGGCATGAATCATAGACTT
CTTTCAACTGCTCAGTTGTTGAAGTCTGGACTTAAACTAGAGTCTACAAAAGATGGATCTGTATTCAAAAACGAA
GCAGGTCAAGCGATTCTTAGTGCCCGTCCGGAAGGTCTTTTTGGCGGCATGCACATTGTTGAGTGTACCTTCTTA
AAACACTCCAAAACAGAACCATACTTGCTTAACGCAAGCGGAATACTCCAGCTCCCTGACTACACCATTTGGCAT
TGTAGATTAGGTCATCCTTCTGATAATGTGTTGAAGAAATTCTTCGAGGAAACCCTAGGAGTACCGAAGATTAAT
ATTCCACAACAGAAACCGGTTTGTGATGGTTGTGTTCGTGGCAAACTTACGCAACAATCATTTCCACAATCGGAA
AAATGTGCTACTTCAGTACTCGAACTGGTCCACTTGGATCTATTCGAACTCCCTGTCCCCTCTTATCACAAATAC
AAATGGGTGATGACTTTGCTTGACGACTATTCCGGTCTCGCTCAGATTGTCATGATAACCAAGAAAAGTGATGCC
GCGTTACAGTTGATTAATATCCTAAAACAGTTGGCTACTCAATCTGATCAAAAGATCAAAAGATTGCGTACAGAT
CAAGGAGGAGAGTATGTCAATGATACACTCTCGACATACCTGAAGTCACAAGGCATTGTGCATGAACTCTCACAT
CAGGAAAAGGTAAAGTGA
Gene >AgabiH97|076160
ATGCTCAGTCAAGCGGCCGCTCAAACGGATGCTAGAGCTCTTTGGAATTGGTTGGAAGGCCAATATGGCCAAAAA
GGACCAACGTTCGCCTATGAACGTTTTATTACAGCTCAAAATTTCAAGATAAATGACTCCGCCGATCCATCATCT
GCGATTGCAGATCTCTACGCATTATTTGCCGCTGTCGAAAGCACTGGTGCGTTGATACATGAGTCGATCCGCACT
ATGATGCTCCTCAACGCTCTCCCCAACTGGTTCGAGCATGTTGCTGCAAACATTCTTGCTGAGAAAAGGTCGGTT
GCCGATCTTAAATGGGAGGAAACTTGTGCCCGCATTATTGCTGTGTGGCGCAACCCCCATACAGTTGCCAATGCT
GCGTGCTTCCGCCAGCAGAACCAGCCTAAACCCAGATGGGACAATAAAAAGCCCAATCAAGGGCAAGGCAAGTCC
CAAGGCTCTGGTTCCGGTTCTGGCTCCGGCCAGAACCAAAACAAGCAACAACAACCTCAGCAGAAGAAGGAAGGT
GAAGAGCAGAGTAACGACAAAAAGAAGAAGAGAACCCGCTCCCGTAAAAAGAAGCAGGGTAACGAGGCTTCTACC
ACCTCTATCGAAGAAGTCAAGGATACGACTCCTGACTACTCCGCTTCTTCTGCCATTGCTTCAATGGCGCAGCTC
GCATCCACCTCTACATGCACAAAAGTCAATGAGATGAAGAGCAGGTTCGTCCCGCTTCCATCTAGATCAGATCCT
AATCTAACAAGGAATAGATCGCCCAAGTTGGGCAACCATACCATTTCGGGTGAGGAATTCTTTTTCTTCCCTGAT
GGAAATATGATTGATCTTTCCCCACTGGATACTGACATTGACTCCTCGACTTTGCCTCGACTTTGTCCTGCGACG
CGAAATCTCCTTCTGGACGAATCTGATGTTGATCTTGATCCATCAGACTCCGGGTTGATCCCTCGGGACCCTCGG
AAACGTCTTTCCCCTCGCCATTCCCCCATGCCCTACGAAAGGGCCAAATCGAAAGTGTTATCCCTCTGGGATCAA
CGTCTTAACGCAGTGACTGTTACAGCCCCTCCAATTGAGGATGGGGCCGGTCAAGTGGGTGGTAATGCTCCGGCT
GTAAAAATGCCGGCTACGAAGGGAAAACTAGTTGAGAAGATGGATGTTGACAAAGCAGATGAGATTTCTCTCAGC
GATGAAGATGGAGAATTTGAATATGAGTATGATGTGGAATGCGAACCGGATAGCTTTGCGCAAGTCCCTCGCTTC
TCTCCCATATCTCAGATTAACTCATGGATTCTACAGGGCAGTATTGTCTCCAGAGACAAAGGCTTGGTTGAACCA
GCCTATCTCCGAGAAAGATCGGGCCGCTCTTTGTGGCTTCAATTAGGATCGTCGAGTACTGCTACACCTGTATTA
TATAATATGATCGCAAATGAGACTACTTCTTTATCCTCTTTGCTTGATCGAATGAATCCAATATGTGAAGTTCTC
CATGCCTGTCATTCAAATTGTGAGGGTTGCAAAACCCGAAAGAATCTAGAAAAACATAGTTGGTTGCTCGATAGT
GGTGCTTCATGCCACTTCACACCGAACCTTGAGGATTTTGCACATTTACAATGTGGAAACTTCGGTATCGTGCAT
ACTGCAAATAAAGACTCTGTACTCAAAATCCAGGGACGCGGACATGTCTTAATCGAGCATACCGTAAAAGATATC
TCCACGGGAAAAGAATTTAAATCAGTATCAAAGATCTGGCCCGTGTTCTATGTCAACGGCATGAATCATAGACTT
CTTTCAACTGCTCAGTTGTTGAAGTCTGGACTTAAACTAGAGTCTACAAAAGATGGATCTGTATTCAAAAACGAA
GCAGGTCAAGCGATTCTTAGTGCCCGTCCGGAAGGTCTTTTTGGCGGCATGCACATTGTTGAGTGTACCTTCTTA
AAACACTCCAAAACAGAACCATACTTGCTTAACGCAAGCGGAATACTCCAGCTCCCTGACTACACCATTTGGCAT
TGTAGATTAGGTCATCCTTCTGATAATGTGTTGAAGAAATTCTTCGAGGAAACCCTAGGAGTACCGAAGATTAAT
ATTCCACAACAGAAACCGGTTTGTGATGGTTGTGTTCGTGGCAAACTTACGCAACAATCATTTCCACAATCGGAA
AAATGTGCTACTTCAGTACTCGAACTGGTCCACTTGGATCTATTCGAACTCCCTGTCCCCTCTTATCACAAATAC
AAATGGGTGATGACTTTGCTTGACGACTATTCCGGTCTCGCTCAGATTGTCATGATAACCAAGAAAAGTGATGCC
GCGTTACAGTTGATTAATATCCTAAAACAGTTGGCTACTCAATCTGATCAAAAGATCAAAAGATTGCGTACAGAT
CAAGGAGGAGAGTATGTCAATGATACACTCTCGACATACCTGAAGTCACAAGGCATTGTGCATGAACTCTCACAT
CAGGAAAAGGTAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail