Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|075160
Gene name
Locationscaffold_4:2303360..2307838
Strand-
Gene length (bp)4478
Transcript length (bp)4146
Coding sequence length (bp)4146
Protein length (aa) 1382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16414 NPC1_N Niemann-Pick C1 N terminus 1.1E-76 2 232
PF02460 Patched Patched family 3.0E-40 682 955
PF02460 Patched Patched family 5.2E-23 1074 1343
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 3.5E-18 683 746
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 3.1E-23 787 871

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O15118|NPC1_HUMAN Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2 4 1345 0.0E+00
sp|O35604|NPC1_MOUSE Niemann-Pick C1 protein OS=Mus musculus GN=Npc1 PE=1 SV=2 4 1345 0.0E+00
sp|P56941|NPC1_PIG Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1 4 1345 0.0E+00
sp|Q6T3U3|NPCL1_RAT Niemann-Pick C1-like protein 1 OS=Rattus norvegicus GN=Npc1l1 PE=1 SV=1 30 1345 2.0E-159
sp|Q9UHC9|NPCL1_HUMAN Niemann-Pick C1-like protein 1 OS=Homo sapiens GN=NPC1L1 PE=1 SV=2 3 1345 8.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O15118|NPC1_HUMAN Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2 4 1345 0.0E+00
sp|O35604|NPC1_MOUSE Niemann-Pick C1 protein OS=Mus musculus GN=Npc1 PE=1 SV=2 4 1345 0.0E+00
sp|P56941|NPC1_PIG Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1 4 1345 0.0E+00
sp|Q6T3U3|NPCL1_RAT Niemann-Pick C1-like protein 1 OS=Rattus norvegicus GN=Npc1l1 PE=1 SV=1 30 1345 2.0E-159
sp|Q9UHC9|NPCL1_HUMAN Niemann-Pick C1-like protein 1 OS=Homo sapiens GN=NPC1L1 PE=1 SV=2 3 1345 8.0E-147
sp|Q12200|NPC1_YEAST Niemann-Pick type C-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCR1 PE=1 SV=1 697 1327 5.0E-131
sp|Q6T3U4|NPCL1_MOUSE Niemann-Pick C1-like protein 1 OS=Mus musculus GN=Npc1l1 PE=2 SV=1 324 1345 6.0E-124
sp|Q19127|NPC1_CAEEL Niemann-Pick C1 protein homolog 1 OS=Caenorhabditis elegans GN=ncr-1 PE=1 SV=2 35 1348 8.0E-105
sp|Q12200|NPC1_YEAST Niemann-Pick type C-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCR1 PE=1 SV=1 4 627 2.0E-99
sp|P34389|NPC2_CAEEL Niemann-Pick C1 protein homolog 2 OS=Caenorhabditis elegans GN=ncr-2 PE=3 SV=2 347 1365 2.0E-72
sp|Q09614|PTC1_CAEEL Protein patched homolog 1 OS=Caenorhabditis elegans GN=ptc-1 PE=1 SV=2 685 1347 6.0E-32
sp|Q6T3U4|NPCL1_MOUSE Niemann-Pick C1-like protein 1 OS=Mus musculus GN=Npc1l1 PE=2 SV=1 33 217 1.0E-18
sp|Q0EEE2|PTHD3_MOUSE Patched domain-containing protein 3 OS=Mus musculus GN=Ptchd3 PE=1 SV=1 683 981 5.0E-18
sp|Q90693|PTC1_CHICK Protein patched homolog 1 OS=Gallus gallus GN=PTCH1 PE=1 SV=1 685 869 4.0E-17
sp|Q13635|PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens GN=PTCH1 PE=1 SV=2 685 869 4.0E-17
sp|Q61115|PTC1_MOUSE Protein patched homolog 1 OS=Mus musculus GN=Ptch1 PE=1 SV=1 685 869 5.0E-17
sp|Q3KNS1|PTHD3_HUMAN Patched domain-containing protein 3 OS=Homo sapiens GN=PTCHD3 PE=1 SV=3 683 981 2.0E-16
sp|Q0EEE2|PTHD3_MOUSE Patched domain-containing protein 3 OS=Mus musculus GN=Ptchd3 PE=1 SV=1 1145 1343 5.0E-16
sp|Q61115|PTC1_MOUSE Protein patched homolog 1 OS=Mus musculus GN=Ptch1 PE=1 SV=1 891 1345 2.0E-15
sp|P34389|NPC2_CAEEL Niemann-Pick C1 protein homolog 2 OS=Caenorhabditis elegans GN=ncr-2 PE=3 SV=2 48 207 4.0E-15
sp|O35595|PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus GN=Ptch2 PE=2 SV=2 685 869 6.0E-15
sp|Q13635|PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens GN=PTCH1 PE=1 SV=2 891 1345 8.0E-15
sp|Q9Y6C5|PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens GN=PTCH2 PE=2 SV=2 689 869 2.0E-14
sp|P18502|PTC_DROME Protein patched OS=Drosophila melanogaster GN=ptc PE=2 SV=2 689 952 3.0E-14
sp|Q90693|PTC1_CHICK Protein patched homolog 1 OS=Gallus gallus GN=PTCH1 PE=1 SV=1 891 1345 1.0E-13
sp|Q98864|PTC1_DANRE Protein patched homolog 1 OS=Danio rerio GN=ptch1 PE=2 SV=1 1113 1329 1.0E-12
sp|Q9Y6C5|PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens GN=PTCH2 PE=2 SV=2 891 1258 4.0E-11
sp|O35595|PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus GN=Ptch2 PE=2 SV=2 1113 1319 2.0E-10
sp|Q98864|PTC1_DANRE Protein patched homolog 1 OS=Danio rerio GN=ptch1 PE=2 SV=1 685 876 2.0E-10
sp|Q6ZW05|PTHD4_HUMAN Patched domain-containing protein 4 OS=Homo sapiens GN=PTCHD4 PE=2 SV=3 685 1352 4.0E-09
sp|B9EKX1|PTHD4_MOUSE Patched domain-containing protein 4 OS=Mus musculus GN=Ptchd4 PE=2 SV=2 685 1352 6.0E-09
sp|Q5RIV7|PTHD1_DANRE Patched domain-containing protein 1 OS=Danio rerio GN=ptchd1 PE=3 SV=1 782 1352 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 235 257 22
2 337 359 22
3 688 710 22
4 717 739 22
5 804 826 22
6 831 853 22
7 905 927 22
8 1176 1195 19
9 1199 1221 22
10 1228 1250 22
11 1287 1309 22
12 1322 1344 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|075160
MNHCALRSSCGTNVFKPLPCPYEGPPQEPEDRALLTEVCGPEFAAGPVCCSSDQVETLKANFVQVEAFLASCPAC
RNNFRSFFCAFTCSPHQGEFVNVTSTQEGSNGRTAVKSADFFVTEQFGKGFYDSCKDVQFGVTNGYAMDFIGGGA
KDYHAFFKFLGDVKPLGSPFQINFPTTSTPDITPLDPPPRNCHDSELTSRCTCIDCPDMCPALPPAPLPNAGPTC
LVGPLSCLSFILSVTYTVAVLGFLTGYAISAFRRHRREKSYERVALSADAASPRTRSHGLVGAASLSHYIDEDSS
GAPSENRHLGRGVSLLDPMETVQPRQDRINNVIRRGFYHLGLFASNHPWLMFSVVFLVIGLLNIGWDRFAVETDP
VRLWVAPDSESRLQKEYFDQHFGPFYRTEQIFVTAAVPRSESNPNDTTQTTSITIGEKGPVLSWDRLKFWFDVES
QIRNLVSPNGLTLDDVCFKPGGPRGACVTQSIAAWYGNDLEDYDPDTWADHLEECAWNPVDCLPDFQQPLEPQFV
LGGVPLDSKGSKQYLEAEAFVVTYVVSDSLDQHKQAMIMDWETTLRKYLTGLGQRAEAEAGLSVVFSTGVSLEEE
LNKSTNTDVRIVVLSYVAMFLYVSLTLGSGSTTKDEDGVISSLFRWIRNFPKLFKRSGSASTISIDSRDVPTLFP
RFPRSLFVGSKVLLGLFSIFLVLVSISTAVGFFSLLGVKVTLIIAEVIPFLVLAVGVDNVFILVHELDRQNTLHG
PNAAPTYITALSPTNSHRFNFESTQPDVDDTSLPLYLSAEERVTRTLAKMGPSILLSTITETLAFALGALVPMPA
VRNFALYAAGSVLINAILQVTVFIGALLLDLKRVESNRVDCFPCIRLSSRIALPETSASSSGLGRIARFIRRYYA
PFLMNSVTKACVVIIFVGGFVASVISVQHIQIGLDQRLALPADSYLVPYFDSLDAYLDVGPPVYFVAKGVDVAER
TGQQALCGRFTTCPDFSIANRLEAERKRPETSFINQPTASWIDNFLSWLNPVNDECCRVRKNDPSVFCTARTPSR
ACRPCYQDHEPAWNITMTGLPQGEEFMRYLKQWLVSPTTAECSLAGETAFGDAISFTADSSHIEASHFRTYHNPL
KSQDDFINAFAAAHRIADEISEEAGVEVFPYSLFYVFFDQYAHIVGITQEVLGLGLASVLIVTGLLLGSWHTAII
VTGVVAMTVLSVMAVMPLWGINLNAISLVNLVISLGIAVEFCAHIARAFMSVSSSSSVTVVGNTVSHGHGVEQKE
RDERVHIALVDVGPSVLSGITFTKLIGMSVLALTRSKLLEIYYFRMWLTLIVSGALHGLVLLPVVLSLAGGRGFP
PGTDEEWMRDATRIEYEYPTFNADDDSIRSD*
Coding >AgabiH97|075160
ATGAACCACTGTGCTCTGCGCTCCTCATGCGGCACCAACGTCTTCAAGCCGCTGCCCTGTCCCTATGAAGGCCCA
CCGCAAGAGCCTGAAGACCGTGCCCTGCTTACAGAGGTTTGCGGGCCAGAATTCGCCGCCGGTCCAGTATGCTGT
TCCTCTGACCAAGTGGAGACTCTCAAGGCCAACTTTGTCCAAGTAGAAGCCTTCCTAGCGTCGTGTCCGGCGTGC
AGGAACAATTTCAGATCATTCTTTTGTGCCTTTACATGCTCCCCACACCAGGGCGAATTTGTCAATGTCACCTCT
ACACAAGAGGGTTCCAATGGCCGGACCGCTGTCAAGTCTGCCGACTTCTTTGTCACTGAACAGTTTGGCAAGGGC
TTCTATGACAGCTGCAAGGACGTCCAATTTGGTGTGACCAACGGGTATGCTATGGATTTCATTGGGGGAGGTGCC
AAGGATTATCATGCGTTCTTCAAATTCCTGGGTGATGTGAAACCACTTGGAAGTCCATTCCAGATCAACTTCCCA
ACTACCTCGACTCCCGACATCACACCCCTTGACCCGCCTCCGCGAAATTGTCATGACAGCGAACTGACAAGTCGT
TGCACATGCATAGACTGCCCCGACATGTGTCCCGCCTTACCACCCGCTCCTTTACCCAACGCTGGGCCCACATGT
CTCGTCGGTCCATTATCTTGCCTATCATTCATCCTTTCTGTCACCTACACCGTCGCTGTCCTAGGTTTCCTAACA
GGCTATGCTATCTCTGCCTTCCGCAGACATCGCCGAGAGAAATCATACGAACGTGTCGCACTCTCAGCGGATGCT
GCCTCCCCGCGAACACGCAGTCATGGACTTGTTGGCGCTGCTTCTCTATCTCACTATATCGATGAAGACTCGTCG
GGTGCCCCGTCAGAAAACCGGCATCTTGGCCGCGGTGTATCGTTGCTAGACCCTATGGAAACAGTTCAGCCTCGC
CAGGACCGTATCAACAATGTGATTCGGAGAGGATTCTATCACTTGGGTCTGTTCGCCTCTAATCATCCGTGGCTC
ATGTTTTCCGTCGTCTTTCTTGTTATTGGCCTCCTGAACATCGGTTGGGATAGATTCGCAGTTGAAACGGACCCT
GTTAGGTTGTGGGTCGCTCCAGATTCCGAAAGCAGACTTCAGAAAGAATATTTTGACCAGCACTTTGGTCCATTC
TATCGTACCGAACAAATCTTTGTGACCGCTGCAGTACCTCGATCAGAATCTAATCCAAATGATACTACACAAACT
ACATCCATCACCATAGGCGAGAAGGGTCCTGTTTTGTCCTGGGACCGCCTCAAATTCTGGTTTGACGTCGAGTCA
CAAATTCGTAATCTTGTCTCGCCCAATGGTTTAACACTAGATGATGTTTGTTTCAAGCCTGGTGGCCCTCGAGGT
GCTTGTGTCACCCAGTCCATTGCGGCATGGTACGGTAATGACCTAGAGGATTATGACCCGGATACTTGGGCTGAT
CACCTAGAGGAATGTGCTTGGAATCCCGTCGACTGCCTTCCCGATTTCCAGCAACCTCTTGAGCCACAATTTGTT
TTGGGAGGTGTTCCTCTTGATTCCAAGGGTTCGAAGCAGTACTTGGAGGCTGAAGCTTTCGTCGTGACATACGTG
GTATCAGATTCACTTGACCAGCACAAACAAGCTATGATTATGGATTGGGAAACGACTCTGCGGAAATATCTCACT
GGTCTCGGGCAGCGTGCCGAAGCAGAGGCCGGCTTGTCAGTCGTATTTTCTACTGGCGTGTCCCTTGAAGAGGAA
CTAAACAAGAGTACGAATACCGATGTTCGTATCGTTGTATTGTCATATGTGGCAATGTTCCTCTATGTCTCGCTC
ACTCTTGGTAGTGGATCTACTACTAAGGATGAGGATGGAGTCATATCTTCACTCTTCCGGTGGATTCGCAATTTT
CCAAAACTTTTCAAGCGTTCCGGTTCCGCCTCTACCATTTCCATTGATTCTCGCGATGTTCCCACCCTATTTCCC
CGCTTTCCCCGCAGTCTCTTCGTTGGTTCGAAGGTCTTACTTGGTTTGTTCAGCATCTTTCTAGTACTTGTCTCC
ATTTCTACCGCAGTCGGATTCTTCTCCTTGCTCGGAGTGAAAGTGACTCTTATCATTGCCGAGGTTATCCCTTTT
CTTGTCCTCGCAGTTGGGGTCGACAACGTCTTCATCCTTGTCCACGAGCTTGATCGTCAAAACACGCTTCATGGA
CCAAATGCGGCACCAACGTACATCACAGCTCTATCACCCACGAATTCCCACCGATTTAATTTCGAATCGACGCAG
CCTGACGTAGATGATACGTCCCTTCCGTTGTACCTGAGTGCGGAAGAGAGGGTTACTCGGACTTTGGCTAAGATG
GGACCTTCAATCTTATTGAGTACCATCACAGAGACCCTTGCTTTTGCTCTGGGTGCTCTTGTTCCTATGCCTGCC
GTTCGCAATTTTGCACTGTATGCGGCTGGAAGTGTATTGATAAATGCTATTTTGCAAGTGACGGTGTTCATCGGC
GCTTTACTCTTGGATCTCAAGCGCGTAGAGAGTAATCGTGTGGACTGTTTCCCTTGCATTCGTTTGTCTTCCAGA
ATAGCATTGCCAGAGACTTCTGCTAGTTCTAGCGGTTTGGGCCGGATCGCAAGATTCATCCGCCGCTACTATGCT
CCTTTCCTCATGAATTCCGTCACCAAAGCTTGTGTTGTAATCATCTTTGTGGGAGGCTTTGTGGCATCTGTAATT
TCTGTTCAGCATATCCAGATTGGCCTTGATCAACGTCTGGCTCTACCTGCAGACTCGTACCTCGTTCCCTACTTT
GACTCCCTGGATGCCTATCTAGATGTTGGTCCCCCGGTTTATTTTGTTGCGAAGGGTGTCGATGTAGCTGAACGA
ACTGGCCAACAAGCGCTCTGTGGGCGCTTCACAACGTGTCCTGACTTTTCTATTGCAAACCGATTAGAAGCGGAG
CGCAAGAGGCCCGAAACTTCTTTCATTAACCAACCCACTGCCTCCTGGATTGACAACTTCCTTAGTTGGTTGAAT
CCTGTTAATGATGAATGTTGTCGTGTGCGCAAGAATGATCCTTCTGTGTTTTGCACTGCTCGCACTCCTTCAAGA
GCCTGCAGACCTTGTTATCAGGATCACGAACCAGCTTGGAATATCACGATGACAGGGCTTCCTCAGGGAGAGGAA
TTCATGCGATATCTCAAACAGTGGCTGGTTTCACCAACGACGGCAGAGTGTTCGCTCGCTGGAGAGACTGCTTTT
GGGGATGCTATATCTTTCACAGCTGATTCCTCACATATCGAAGCTTCCCACTTCCGCACGTACCATAATCCACTC
AAGTCTCAAGATGATTTCATCAATGCATTCGCGGCGGCTCATCGCATAGCAGACGAAATATCCGAAGAGGCGGGT
GTTGAAGTCTTCCCTTATTCTCTCTTTTACGTCTTTTTCGACCAATATGCGCATATTGTGGGAATCACACAAGAA
GTGCTTGGACTTGGATTGGCTTCTGTGCTTATTGTCACTGGGCTTCTTCTAGGGTCATGGCACACCGCGATCATT
GTTACGGGAGTGGTTGCAATGACCGTTCTGAGTGTGATGGCGGTGATGCCGCTTTGGGGAATCAATCTGAATGCG
ATTAGTTTGGTGAATTTGGTGATTTCGTTGGGGATTGCTGTTGAGTTTTGTGCGCATATTGCGAGGGCTTTTATG
AGTGTTTCGAGTTCTTCGTCGGTTACTGTTGTGGGAAATACGGTGTCGCATGGACATGGTGTGGAGCAGAAGGAG
AGGGATGAGAGGGTACATATCGCATTGGTGGATGTTGGGCCATCTGTTTTGTCTGGTATAACGTTCACTAAGCTT
ATTGGCATGTCAGTCCTTGCTCTGACGCGCTCTAAACTTCTCGAGATCTATTACTTCCGCATGTGGTTGACACTC
ATCGTTTCTGGTGCCCTTCACGGTTTGGTGTTGCTGCCTGTTGTCCTTAGTCTTGCAGGAGGGCGCGGTTTTCCT
CCTGGGACGGACGAAGAGTGGATGCGCGATGCGACTAGAATTGAGTACGAGTATCCAACGTTCAACGCCGATGAC
GACTCCATTCGTAGCGACTAA
Transcript >AgabiH97|075160
ATGAACCACTGTGCTCTGCGCTCCTCATGCGGCACCAACGTCTTCAAGCCGCTGCCCTGTCCCTATGAAGGCCCA
CCGCAAGAGCCTGAAGACCGTGCCCTGCTTACAGAGGTTTGCGGGCCAGAATTCGCCGCCGGTCCAGTATGCTGT
TCCTCTGACCAAGTGGAGACTCTCAAGGCCAACTTTGTCCAAGTAGAAGCCTTCCTAGCGTCGTGTCCGGCGTGC
AGGAACAATTTCAGATCATTCTTTTGTGCCTTTACATGCTCCCCACACCAGGGCGAATTTGTCAATGTCACCTCT
ACACAAGAGGGTTCCAATGGCCGGACCGCTGTCAAGTCTGCCGACTTCTTTGTCACTGAACAGTTTGGCAAGGGC
TTCTATGACAGCTGCAAGGACGTCCAATTTGGTGTGACCAACGGGTATGCTATGGATTTCATTGGGGGAGGTGCC
AAGGATTATCATGCGTTCTTCAAATTCCTGGGTGATGTGAAACCACTTGGAAGTCCATTCCAGATCAACTTCCCA
ACTACCTCGACTCCCGACATCACACCCCTTGACCCGCCTCCGCGAAATTGTCATGACAGCGAACTGACAAGTCGT
TGCACATGCATAGACTGCCCCGACATGTGTCCCGCCTTACCACCCGCTCCTTTACCCAACGCTGGGCCCACATGT
CTCGTCGGTCCATTATCTTGCCTATCATTCATCCTTTCTGTCACCTACACCGTCGCTGTCCTAGGTTTCCTAACA
GGCTATGCTATCTCTGCCTTCCGCAGACATCGCCGAGAGAAATCATACGAACGTGTCGCACTCTCAGCGGATGCT
GCCTCCCCGCGAACACGCAGTCATGGACTTGTTGGCGCTGCTTCTCTATCTCACTATATCGATGAAGACTCGTCG
GGTGCCCCGTCAGAAAACCGGCATCTTGGCCGCGGTGTATCGTTGCTAGACCCTATGGAAACAGTTCAGCCTCGC
CAGGACCGTATCAACAATGTGATTCGGAGAGGATTCTATCACTTGGGTCTGTTCGCCTCTAATCATCCGTGGCTC
ATGTTTTCCGTCGTCTTTCTTGTTATTGGCCTCCTGAACATCGGTTGGGATAGATTCGCAGTTGAAACGGACCCT
GTTAGGTTGTGGGTCGCTCCAGATTCCGAAAGCAGACTTCAGAAAGAATATTTTGACCAGCACTTTGGTCCATTC
TATCGTACCGAACAAATCTTTGTGACCGCTGCAGTACCTCGATCAGAATCTAATCCAAATGATACTACACAAACT
ACATCCATCACCATAGGCGAGAAGGGTCCTGTTTTGTCCTGGGACCGCCTCAAATTCTGGTTTGACGTCGAGTCA
CAAATTCGTAATCTTGTCTCGCCCAATGGTTTAACACTAGATGATGTTTGTTTCAAGCCTGGTGGCCCTCGAGGT
GCTTGTGTCACCCAGTCCATTGCGGCATGGTACGGTAATGACCTAGAGGATTATGACCCGGATACTTGGGCTGAT
CACCTAGAGGAATGTGCTTGGAATCCCGTCGACTGCCTTCCCGATTTCCAGCAACCTCTTGAGCCACAATTTGTT
TTGGGAGGTGTTCCTCTTGATTCCAAGGGTTCGAAGCAGTACTTGGAGGCTGAAGCTTTCGTCGTGACATACGTG
GTATCAGATTCACTTGACCAGCACAAACAAGCTATGATTATGGATTGGGAAACGACTCTGCGGAAATATCTCACT
GGTCTCGGGCAGCGTGCCGAAGCAGAGGCCGGCTTGTCAGTCGTATTTTCTACTGGCGTGTCCCTTGAAGAGGAA
CTAAACAAGAGTACGAATACCGATGTTCGTATCGTTGTATTGTCATATGTGGCAATGTTCCTCTATGTCTCGCTC
ACTCTTGGTAGTGGATCTACTACTAAGGATGAGGATGGAGTCATATCTTCACTCTTCCGGTGGATTCGCAATTTT
CCAAAACTTTTCAAGCGTTCCGGTTCCGCCTCTACCATTTCCATTGATTCTCGCGATGTTCCCACCCTATTTCCC
CGCTTTCCCCGCAGTCTCTTCGTTGGTTCGAAGGTCTTACTTGGTTTGTTCAGCATCTTTCTAGTACTTGTCTCC
ATTTCTACCGCAGTCGGATTCTTCTCCTTGCTCGGAGTGAAAGTGACTCTTATCATTGCCGAGGTTATCCCTTTT
CTTGTCCTCGCAGTTGGGGTCGACAACGTCTTCATCCTTGTCCACGAGCTTGATCGTCAAAACACGCTTCATGGA
CCAAATGCGGCACCAACGTACATCACAGCTCTATCACCCACGAATTCCCACCGATTTAATTTCGAATCGACGCAG
CCTGACGTAGATGATACGTCCCTTCCGTTGTACCTGAGTGCGGAAGAGAGGGTTACTCGGACTTTGGCTAAGATG
GGACCTTCAATCTTATTGAGTACCATCACAGAGACCCTTGCTTTTGCTCTGGGTGCTCTTGTTCCTATGCCTGCC
GTTCGCAATTTTGCACTGTATGCGGCTGGAAGTGTATTGATAAATGCTATTTTGCAAGTGACGGTGTTCATCGGC
GCTTTACTCTTGGATCTCAAGCGCGTAGAGAGTAATCGTGTGGACTGTTTCCCTTGCATTCGTTTGTCTTCCAGA
ATAGCATTGCCAGAGACTTCTGCTAGTTCTAGCGGTTTGGGCCGGATCGCAAGATTCATCCGCCGCTACTATGCT
CCTTTCCTCATGAATTCCGTCACCAAAGCTTGTGTTGTAATCATCTTTGTGGGAGGCTTTGTGGCATCTGTAATT
TCTGTTCAGCATATCCAGATTGGCCTTGATCAACGTCTGGCTCTACCTGCAGACTCGTACCTCGTTCCCTACTTT
GACTCCCTGGATGCCTATCTAGATGTTGGTCCCCCGGTTTATTTTGTTGCGAAGGGTGTCGATGTAGCTGAACGA
ACTGGCCAACAAGCGCTCTGTGGGCGCTTCACAACGTGTCCTGACTTTTCTATTGCAAACCGATTAGAAGCGGAG
CGCAAGAGGCCCGAAACTTCTTTCATTAACCAACCCACTGCCTCCTGGATTGACAACTTCCTTAGTTGGTTGAAT
CCTGTTAATGATGAATGTTGTCGTGTGCGCAAGAATGATCCTTCTGTGTTTTGCACTGCTCGCACTCCTTCAAGA
GCCTGCAGACCTTGTTATCAGGATCACGAACCAGCTTGGAATATCACGATGACAGGGCTTCCTCAGGGAGAGGAA
TTCATGCGATATCTCAAACAGTGGCTGGTTTCACCAACGACGGCAGAGTGTTCGCTCGCTGGAGAGACTGCTTTT
GGGGATGCTATATCTTTCACAGCTGATTCCTCACATATCGAAGCTTCCCACTTCCGCACGTACCATAATCCACTC
AAGTCTCAAGATGATTTCATCAATGCATTCGCGGCGGCTCATCGCATAGCAGACGAAATATCCGAAGAGGCGGGT
GTTGAAGTCTTCCCTTATTCTCTCTTTTACGTCTTTTTCGACCAATATGCGCATATTGTGGGAATCACACAAGAA
GTGCTTGGACTTGGATTGGCTTCTGTGCTTATTGTCACTGGGCTTCTTCTAGGGTCATGGCACACCGCGATCATT
GTTACGGGAGTGGTTGCAATGACCGTTCTGAGTGTGATGGCGGTGATGCCGCTTTGGGGAATCAATCTGAATGCG
ATTAGTTTGGTGAATTTGGTGATTTCGTTGGGGATTGCTGTTGAGTTTTGTGCGCATATTGCGAGGGCTTTTATG
AGTGTTTCGAGTTCTTCGTCGGTTACTGTTGTGGGAAATACGGTGTCGCATGGACATGGTGTGGAGCAGAAGGAG
AGGGATGAGAGGGTACATATCGCATTGGTGGATGTTGGGCCATCTGTTTTGTCTGGTATAACGTTCACTAAGCTT
ATTGGCATGTCAGTCCTTGCTCTGACGCGCTCTAAACTTCTCGAGATCTATTACTTCCGCATGTGGTTGACACTC
ATCGTTTCTGGTGCCCTTCACGGTTTGGTGTTGCTGCCTGTTGTCCTTAGTCTTGCAGGAGGGCGCGGTTTTCCT
CCTGGGACGGACGAAGAGTGGATGCGCGATGCGACTAGAATTGAGTACGAGTATCCAACGTTCAACGCCGATGAC
GACTCCATTCGTAGCGACTAA
Gene >AgabiH97|075160
ATGAACCACTGTGCTCTGCGCTCCTCATGCGGCACCAACGTCTTCAAGCCGCTGCCCTGTCCCTATGAAGGCCCA
CCGCAAGAGGTCTGTCGTTGTCCATTTGCATGTCGCTTTCTCTACTGACCTCCGGGCCTCTTAGCCTGAAGACCG
TGCCCTGCTTACAGAGGTTTGCGGGCCAGAATTCGCCGCCGGTCCAGTATGCTGTTCCTCTGACCAAGTGGAGAC
TCTCAAGGCCAACTTTGTCCAAGTAGAAGCCTTCCTAGCGTCGTGTCCGGCGTGCAGGAACAATTTCAGATCATT
CTTTTGTGCCTTTACATGCTCCCCACACCAGGGCGAATTTGTCAATGTCACCTCTACACAAGAGGGTTCCAATGG
CCGGACCGCTGTCAAGTCTGCCGACTTCTTTGTCACTGAACAGTTTGGCAAGGGCTTCTATGACAGCTGCAAGGA
CGTCCAATTTGGTGTGACCAACGGGTATGCTATGGATTTCATTGGGGGAGGTGCCAAGGATTATCATGCGTTCTT
CAAATTCCTGGGTGATGTGAAACCACTTGGAAGTCCATTCCAGATCAACTTCCCAACTACCTCGACTCCCGACAT
CACACCCCTTGACCCGCCTCCGCGAAATTGTCATGACAGCGAACTGACAAGTCGTTGCACATGCATAGACTGCCC
CGACATGTGTCCCGCCTTACCACCCGCTCCTTTACCCAACGCTGGGCCCACATGTCTCGTCGGTCCATTATCTTG
CCTATCATTCATCCTTTCTGTCACCTACACCGTCGCTGTCCTAGGTTTCCTAACAGGCTATGCTATCTCTGCCTT
CCGCAGACATCGCCGAGAGAAATCATACGAACGTGTCGCACTCTCAGCGGATGCTGCCTCCCCGCGAACACGCAG
TCATGGACTTGTTGGCGCTGCTTCTCTATCTCACTATATCGATGAAGACTCGTCGGGTGCCCCGTCAGAAAACCG
GCATCTTGGCCGCGGTGTATCGTTGCTAGACCCTATGGAAACAGTTCAGCCTCGCCAGGACCGTATCAACAATGT
GATTCGGAGAGGATTCTATCACTTGGGTCTGTTCGCCTCTAATCATCCGTGGCTCATGTTTTCCGTCGTCTTTCT
TGTTATTGGCCTCCTGAACATCGGTTGGGATAGATTCGCAGTTGAAACGGACCCTGTTAGGTTGTGGGTCGCTCC
AGATTCCGAAAGCAGACTTCAGAAAGAATATTTTGACCAGCACTTTGGTCCATTCTATCGTACCGAACAAATCTT
TGTGACCGCTGCAGTACCTCGATCAGAATCTAATCCAAATGATACTACACAAACTACATCCATCACCATAGGCGA
GAAGGGTCCTGTTTTGTCCTGGGACCGCCTCAAATTCTGGTTTGACGTCGAGTCACAAATTCGTAATCTTGTCTC
GCCCAATGGTTTAACACTAGATGATGTTTGTTTCAAGCCTGGTGGCCCTCGAGGTGCTTGTGTCACCCAGTCCAT
TGCGGCATGGTACGGTAATGACCTAGAGGATTATGACCCGGATACTTGGGCTGATCACCTAGAGGAATGTGCTTG
GAATCCCGTCGACTGCCTTCCCGATTTCCAGCAACCTCTTGAGCCACAATTTGTTTTGGGAGGTGTTCCTCTTGA
TTCCAAGGGTTCGAAGCAGTACTTGGAGGCTGAAGCTTTCGTCGTGACATACGTGGTATCAGATTCACTTGACCA
GCACAAACAAGCTATGATTATGGATTGGGAAACGACTCTGCGGAAATATCTCACTGGTCTCGGGCAGCGTGCCGA
AGCAGAGGCCGGCTTGTCAGTCGTATTTTCTACTGGCGTGTCCCTTGAAGAGGAACTAAACAAGAGTACGAATAC
CGATGTTCGTATCGTTGTATTGTCATATGTGGCAATGTTCCTCTATGTCTCGCTCACTCTTGGTAGTGGATCTAC
TACTAAGGATGAGGATGGAGTCATATCTTCACTCTTCCGGTGGATTCGCAATTTTCCAAAACTTTTCAAGCGTTC
CGGTTCCGCCTCTACCATTTCCATTGATTCTCGCGATGTTCCCACCCTATTTCCCCGCTTTCCCCGCAGTCTCTT
CGTTGGTTCGAAGGTCTTACTTGGTTTGTTCAGCATCTTTCTAGTACTTGTCTCCATTTCTACCGCAGTCGGATT
CTTCTCCTTGCTCGGAGTGAAAGTGACTCTTATCATTGCCGAGGTTATCCCTTTTCTTGTCCTCGCAGTTGGGGT
CGACAACGTCTTCATCCTTGTCCACGAGCTTGATCGTCAAAACACGCTTCATGGACCAAATGCGGCACCAACGTA
CATCACAGCTCTATCACCCACGAATTCCCACCGATTTAATTTCGAATCGACGCAGCCTGACGTAGATGATACGTC
CCTTCCGTTGTACCTGAGTGCGGAAGAGAGGGTTACTCGGACTTTGGCTAAGATGGGACCTTCAATCTTATTGAG
TACCATCACAGAGACCCTTGCTTTTGCTCTGGGTGCTCTTGTTCCTATGCCTGCCGTTCGCAATTTTGCACTGTA
TGCGGCTGGAAGTGTATTGATAAATGCTATTTTGCAAGTGACGGTGTTCATCGGCGCTTTACTCTTGGATCTCAA
GCGCGTAGAGGTGAGTAACCAATTGCGCTTTAGTTGAGACAAACTCTAACCACTGTAATCCAGAGTAATCGTGTG
GACTGTTTCCCTTGCATTCGTTTGTCTTCCAGAATAGCATTGCCAGAGACTTCTGCTAGTTCTAGCGGTTTGGGC
CGGATCGCAAGATTCATCCGCCGCTACTATGCTCCTTTCCTCATGAATTCCGTCACCAAAGCTTGTGTTGTAATC
ATCTTTGTGGGAGGCTTTGTGGCATCTGTAATTTCTGTTCAGCATATCCAGATTGGCCTTGGTGAGCACCCTGAA
ACGAGTTTTACGTACGCGTCAAACTGACGCCATTCTCTGCAGATCAACGTCTGGCTCTACCTGCAGACTCGTACC
TCGTTCCCTACTTTGACTCCCTGGATGCCTATCTAGATGTTGGTCCCCCGGTTTATTTTGTTGCGAAGGGTGTCG
ATGTAGCTGAACGAACTGGCCAACAAGCGCTCTGTGGGCGCTTCACAACGTGTCCTGACTTTTCTATTGCAAACC
GATTAGAAGCGGAGCGCAAGAGGCCCGAAACTTCTTTCATTAACCAACCCACTGCCTCCTGGATTGACAACTTCC
TTAGTTGGTTGAATCCTGTTAATGATGAATGTTGTCGTGTGCGCAAGAATGATCCTTCTGTGTTTTGCACTGCTC
GCACTCCTTCAAGAGCCTGCAGACCTTGTTATCAGGATCACGAACCAGCTTGGAATATCACGATGACAGGGCTTC
CTCAGGGAGAGGAATTCATGCGATATCTCAAACAGTGGCTGGTTTCACCAACGACGGCAGAGTGTTCGCTCGCTG
GAGAGACTGCTTTTGGGGATGCTATATCTTTCACAGCTGATTCCTCACATATCGAAGCTTCCCACTTCCGCACGT
ACCATAATCCACTCAAGTCTCAAGATGATTTCATCAATGCATTCGCGGCGGCTCATCGCATAGCAGACGAAATAT
CCGAAGAGGCGGGTGTTGAAGTCTTCCCTTATTCTCTCTTTTACGTCTTTTTCGACCAATATGCGCATATTGTGG
GAATCACACAAGAAGTGCTTGGACTTGGATTGGCTTCTGTGCTTATTGTCACTGGGCTTCTTCTAGGGTCATGGC
ACACCGCGATCATTGTTACGGGAGTGGTTGCAATGACCGTTCTGAGTGTGATGGCGGTGATGCCGCTTTGGGGAA
TCAATCTGAATGCGATTAGTTTGGTGAATTTGGTGATTTCGTTGGGGATTGCTGTTGAGTTTTGTGCGCATATTG
CGAGGGCTTTTATGAGTGTTTCGAGTTCTTCGTCGGTTACTGTTGTGGGAAATACGGTGTCGCATGGACATGGTG
TGGAGCAGAAGGAGAGGGATGAGAGGGTACATATCGCATTGGTGGATGTTGGGCCATCTGTAAGTTTTTTCTTTT
ACATAGTTCAGAAGAAACTCGGAACTGAACGTCATTTTCTTTTAGGTTTTGTCTGGTATAACGTTCACTAAGCTT
ATTGGCATGTCAGTCCTTGCTCTGACGCGCTCTAAACTTCTCGAGGTCTGTTTGATTTTGCAGCAGTACGGAGGG
TGATGCTAACTGGCTGTAGATCTATTACTTCCGCATGTGGTTGACACTCATCGTTTCTGGTGCCCTTCACGGTTT
GGTGTTGCTGCCTGTTGTCCTTAGTCTTGCAGGAGGGCGCGGTTTTCCTCCTGGGACGGACGAAGAGTGGATGCG
CGATGCGACTAGAATTGAGTACGAGTATCCGTGAGTCGAACCAGCTTTTTTTTTTTCAAAATGATTTTTTTTAAA
CTTCATGTCATAGAACGTTCAACGCCGATGACGACTCCATTCGTAGCGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail