Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|075150
Gene name
Locationscaffold_4:2301640..2302985
Strand+
Gene length (bp)1345
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like 5.2E-26 6 57
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.0E-11 79 148

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CJX2|QCR9_KLULA Cytochrome b-c1 complex subunit 9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR9 PE=3 SV=3 1 54 3.0E-17
sp|P22289|QCR9_YEAST Cytochrome b-c1 complex subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR9 PE=1 SV=2 1 56 3.0E-15
sp|O74433|QCR9_SCHPO Cytochrome b-c1 complex subunit 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr9 PE=3 SV=2 4 61 2.0E-10
sp|P00130|QCR9_BOVIN Cytochrome b-c1 complex subunit 9 OS=Bos taurus GN=UQCR10 PE=1 SV=3 2 57 3.0E-10
sp|Q8R1I1|QCR9_MOUSE Cytochrome b-c1 complex subunit 9 OS=Mus musculus GN=Uqcr10 PE=1 SV=1 2 57 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CJX2|QCR9_KLULA Cytochrome b-c1 complex subunit 9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR9 PE=3 SV=3 1 54 3.0E-17
sp|P22289|QCR9_YEAST Cytochrome b-c1 complex subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR9 PE=1 SV=2 1 56 3.0E-15
sp|O74433|QCR9_SCHPO Cytochrome b-c1 complex subunit 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr9 PE=3 SV=2 4 61 2.0E-10
sp|P00130|QCR9_BOVIN Cytochrome b-c1 complex subunit 9 OS=Bos taurus GN=UQCR10 PE=1 SV=3 2 57 3.0E-10
sp|Q8R1I1|QCR9_MOUSE Cytochrome b-c1 complex subunit 9 OS=Mus musculus GN=Uqcr10 PE=1 SV=1 2 57 6.0E-10
sp|Q9UDW1|QCR9_HUMAN Cytochrome b-c1 complex subunit 9 OS=Homo sapiens GN=UQCR10 PE=1 SV=3 2 57 1.0E-09
sp|Q6PG31|RNPS1_DANRE RNA-binding protein with serine-rich domain 1 OS=Danio rerio GN=rnps1 PE=2 SV=1 83 148 4.0E-09
sp|Q1MTR2|RNPS1_SCHPO RNA-binding protein with serine-rich domain 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.14c PE=3 SV=2 77 159 5.0E-09
sp|Q9XY35|QCR9_DROME Cytochrome b-c1 complex subunit 9 OS=Drosophila melanogaster GN=ox PE=3 SV=1 7 57 1.0E-08
sp|Q6AYK1|RNPS1_RAT RNA-binding protein with serine-rich domain 1 OS=Rattus norvegicus GN=Rnps1 PE=2 SV=1 79 148 2.0E-08
sp|Q5NVM8|RNPS1_PONAB RNA-binding protein with serine-rich domain 1 OS=Pongo abelii GN=RNPS1 PE=2 SV=1 79 148 3.0E-08
sp|Q99M28|RNPS1_MOUSE RNA-binding protein with serine-rich domain 1 OS=Mus musculus GN=Rnps1 PE=2 SV=1 79 148 3.0E-08
sp|Q4R5N1|RNPS1_MACFA RNA-binding protein with serine-rich domain 1 OS=Macaca fascicularis GN=RNPS1 PE=2 SV=1 79 148 3.0E-08
sp|Q15287|RNPS1_HUMAN RNA-binding protein with serine-rich domain 1 OS=Homo sapiens GN=RNPS1 PE=1 SV=1 79 148 3.0E-08
sp|A6QR16|RNPS1_BOVIN RNA-binding protein with serine-rich domain 1 OS=Bos taurus GN=RNPS1 PE=2 SV=1 79 148 3.0E-08
sp|Q5XG24|RNP1A_XENLA RNA-binding protein with serine-rich domain 1-A OS=Xenopus laevis GN=rnps1-a PE=2 SV=1 79 148 8.0E-08
sp|Q3KPW1|RNP1B_XENLA RNA-binding protein with serine-rich domain 1-B OS=Xenopus laevis GN=rnps1-b PE=2 SV=1 79 162 9.0E-08
sp|Q28E41|RNPS1_XENTR RNA-binding protein with serine-rich domain 1 OS=Xenopus tropicalis GN=rnps1 PE=2 SV=1 79 148 2.0E-07
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 79 150 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c Yes
GO:0003723 RNA binding Yes
GO:0005750 mitochondrial respiratory chain complex III Yes
GO:0006091 generation of precursor metabolites and energy No
GO:0098796 membrane protein complex No
GO:0008150 biological_process No
GO:0045275 respiratory chain complex III No
GO:0009060 aerobic respiration No
GO:0098803 respiratory chain complex No
GO:0022900 electron transport chain No
GO:0098798 mitochondrial protein-containing complex No
GO:0005575 cellular_component No
GO:0005488 binding No
GO:0019646 aerobic electron transport chain No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0097159 organic cyclic compound binding No
GO:1902495 transmembrane transporter complex No
GO:0008152 metabolic process No
GO:1902494 catalytic complex No
GO:0022904 respiratory electron transport chain No
GO:0003674 molecular_function No
GO:1990351 transporter complex No
GO:0045333 cellular respiration No
GO:0032991 protein-containing complex No
GO:0070069 cytochrome complex No
GO:0009987 cellular process No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:1990204 oxidoreductase complex No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|075150
MSLATGLYNSFFRRNSVFVGSVFAGAFFFGVGFDMGVTSFWERWNKGKLWKDMRHKYVEDDAYRCNMEVESANAD
AKVVVITNLTRNVVEGHLQAVFAFYGDIVKIDLPVFGKSGQNRGKAALEYADAASAHRAFEHMDGGQLDGAVLKL
ELSDLPVRTRARTRSPPPHRSRRGGPPPDAEKNHHSVVDVAVGAEEVLLHHPHAIGIEAIGGPVHHFLVDLAISL
AEDPQVILAEDTVVLIVITVEVVVVLHVEEDLFVADLCLVPTLHVQGLLQILGLVLQGADPQVTQFAPVVQGLGL
SPVLGLHSRAR*
Coding >AgabiH97|075150
ATGAGTCTCGCCACCGGTCTCTACAACTCGTTTTTCAGGCGTAACAGCGTCTTTGTTGGCTCCGTCTTTGCGGGT
GCCTTTTTCTTCGGTGTCGGCTTTGATATGGGCGTGACTTCCTTCTGGGAGCGGTGGAACAAGGGCAAACTATGG
AAAGATATGCGCCATAAATATGTAGAGGATGATGCGTACCGTTGCAACATGGAGGTCGAGTCGGCCAACGCAGAC
GCAAAGGTCGTCGTCATCACAAATCTCACCAGAAACGTCGTCGAAGGCCATCTCCAGGCCGTCTTTGCTTTTTAC
GGCGACATCGTCAAAATCGACCTCCCCGTCTTTGGAAAATCCGGTCAGAACAGAGGCAAGGCCGCTCTTGAGTAT
GCAGACGCCGCGTCGGCTCATCGCGCTTTCGAACACATGGACGGTGGCCAACTCGACGGCGCCGTCCTAAAACTC
GAACTTTCAGACCTCCCCGTTCGCACTCGCGCTCGCACTCGTTCTCCACCACCTCATCGCTCTCGTCGCGGCGGT
CCACCACCAGACGCGGAGAAAAACCATCATTCCGTGGTGGACGTGGCGGTTGGGGCAGAAGAGGTCCTCCTCCAC
CACCCCCACGCAATAGGGATAGAGGCTATCGGAGGTCCCGTTCACCACTTCCTCGTCGACCTGGCTATCTCCCTC
GCCGAAGATCCCCAAGTTATACTCGCGGAGGATACGGTGGTCCTGATCGTGATTACGGTAGAAGTCGTGGTGGTG
CTGCACGTAGAGGAAGACCTATTCGTGGCAGACCTCTGTCTCGTTCCTACTCTCCACGTTCAAGGTCTCCTTCAA
ATTCTAGGTCTCGTTCTCCAAGGAGCAGATCCGCAAGTTACTCAGTTCGCTCCAGTCGTTCAAGGACTAGGTCTA
TCACCCGTTCTAGGACTCCACTCTCGCGCTCGCTGA
Transcript >AgabiH97|075150
ATGAGTCTCGCCACCGGTCTCTACAACTCGTTTTTCAGGCGTAACAGCGTCTTTGTTGGCTCCGTCTTTGCGGGT
GCCTTTTTCTTCGGTGTCGGCTTTGATATGGGCGTGACTTCCTTCTGGGAGCGGTGGAACAAGGGCAAACTATGG
AAAGATATGCGCCATAAATATGTAGAGGATGATGCGTACCGTTGCAACATGGAGGTCGAGTCGGCCAACGCAGAC
GCAAAGGTCGTCGTCATCACAAATCTCACCAGAAACGTCGTCGAAGGCCATCTCCAGGCCGTCTTTGCTTTTTAC
GGCGACATCGTCAAAATCGACCTCCCCGTCTTTGGAAAATCCGGTCAGAACAGAGGCAAGGCCGCTCTTGAGTAT
GCAGACGCCGCGTCGGCTCATCGCGCTTTCGAACACATGGACGGTGGCCAACTCGACGGCGCCGTCCTAAAACTC
GAACTTTCAGACCTCCCCGTTCGCACTCGCGCTCGCACTCGTTCTCCACCACCTCATCGCTCTCGTCGCGGCGGT
CCACCACCAGACGCGGAGAAAAACCATCATTCCGTGGTGGACGTGGCGGTTGGGGCAGAAGAGGTCCTCCTCCAC
CACCCCCACGCAATAGGGATAGAGGCTATCGGAGGTCCCGTTCACCACTTCCTCGTCGACCTGGCTATCTCCCTC
GCCGAAGATCCCCAAGTTATACTCGCGGAGGATACGGTGGTCCTGATCGTGATTACGGTAGAAGTCGTGGTGGTG
CTGCACGTAGAGGAAGACCTATTCGTGGCAGACCTCTGTCTCGTTCCTACTCTCCACGTTCAAGGTCTCCTTCAA
ATTCTAGGTCTCGTTCTCCAAGGAGCAGATCCGCAAGTTACTCAGTTCGCTCCAGTCGTTCAAGGACTAGGTCTA
TCACCCGTTCTAGGACTCCACTCTCGCGCTCGCTGA
Gene >AgabiH97|075150
ATGAGTGTAAGTCGTCCTCCTCGCAGCCCAATATCGCTTGCTCACCCTGCTTTCAGCTCGCCACCGGTCTCTACA
ACTCGTTTTTCAGGCGTAACAGTGCGCTTTATCCCCCGCCTCTGCCCGCAGCTGCTCACACCCCATAGGCGTCTT
TGTTGGCTCCGTCTTTGCGGGTGCCTTTTTCTTCGGTGTCGGCTTTGATATGGGCGTGACTTCCTTCTGGGAGCG
GTGGAACAAGGGCGTACGTCCCCTTTCTCTTCAGCAATTTCCTTTTTCACATTTCTGGCTGTAGAAACTATGGAA
AGATATGCGCCATAAATATGTAGAGGATGATGCGTAGTTAGTTAAACCTATAGAGATATGTGTGACGTGTGTGAC
ATCCAGCCCTTGAGCCGTTGCAACATGGAGGTCGAGTCGGCCAACGCAGACGCAAAGGTCGTCGTCATCACAAAT
CTCACCAGAAACGTCGTCGAAGGCCATCTCCAGGCCGTCTTTGCTTTTTACGGCGACATCGTCAAAATCGACCTC
CCCGTCTTTGGAAAATGTGCGTTTCTCTTTCTTTCTCTCTCTCTCCCCGCTCCTCAACGACGCGCAGCCGGTCAG
AACAGAGGCAAGGCCGCTCTTGAGTATGCAGACGCCGCGTCGGCTCATCGCGCTTTCGAACACATGGACGGTGGC
CAACTCGACGGCGCCGTCCTAAAACTCGAACTTTCAGACCTCCCCGTTCGCACTCGCGCTCGCACTCGTTCTCCA
CCACCTCATCGCTCTCGTCGCGGCGGTCCACCACCAGGTTCGCGTTATCGCAACGGTCGAGGCCCGCGTTCTCCC
TCCTTCTCACGTTCACGCTCTCCTTACTCCCGTTCCCTGTCACCTCGTTCAAGGAGCCCAAGGTCACCTAGGTCC
TTGTCAAGATCCAGAACTCGTTCACCATCACCTTATTCCCGTAGACGCGGAGAAAAACCATCATTCCGTGGTGGA
CGTGGCGGTTGGGGCAGAAGAGGTCCTCCTCCACCACCCCCACGCAATAGGGATAGAGGCTATCGGAGGTCCCGT
TCACCACTTCCTCGTCGACCTGGCTATCTCCCTCGCCGAAGATCCCCAAGTTATACTCGCGGAGGATACGGTGGT
CCTGATCGTGATTACGGTAGAAGTCGTGGTGGTGCTGCACGTAGAGGAAGACCTATTCGTGGCAGACCTCTGTCT
CGTTCCTACTCTCCACGTTCAAGGTCTCCTTCAAATTCTAGGTCTCGTTCTCCAAGGAGCAGATCCGCAAGTTAC
TCAGTTCGCTCCAGTCGTTCAAGGACTAGGTCTATCACCCGTTCTAGGACTCCACTCTCGCGCTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail