© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|075090 |
| Gene name | |
| Location | scaffold_4:2293909..2295667 |
| Strand | + |
| Gene length (bp) | 1758 |
| Transcript length (bp) | 1272 |
| Coding sequence length (bp) | 1272 |
| Protein length (aa) | 424 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00026 | Asp | Eukaryotic aspartyl protease | 2.3E-79 | 115 | 421 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O60020|ASPR1_PHARH | Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 | 11 | 420 | 1.0E-79 |
| sp|Q05744|CATD_CHICK | Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1 | 113 | 420 | 1.0E-54 |
| sp|Q03168|ASPP_AEDAE | Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 | 74 | 420 | 1.0E-54 |
| sp|P43159|CATE_RABIT | Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 | 50 | 420 | 3.0E-53 |
| sp|P07339|CATD_HUMAN | Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 | 101 | 423 | 7.0E-51 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O60020|ASPR1_PHARH | Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 | 11 | 420 | 1.0E-79 |
| sp|Q05744|CATD_CHICK | Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1 | 113 | 420 | 1.0E-54 |
| sp|Q03168|ASPP_AEDAE | Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 | 74 | 420 | 1.0E-54 |
| sp|P43159|CATE_RABIT | Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 | 50 | 420 | 3.0E-53 |
| sp|P07339|CATD_HUMAN | Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 | 101 | 423 | 7.0E-51 |
| sp|P14091|CATE_HUMAN | Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 | 82 | 420 | 1.0E-50 |
| sp|P16228|CATE_RAT | Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 | 47 | 420 | 3.0E-50 |
| sp|O93428|CATD_CHIHA | Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 | 62 | 420 | 2.0E-49 |
| sp|P70269|CATE_MOUSE | Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 | 47 | 420 | 3.0E-49 |
| sp|Q9GMY8|PEPA_SORUN | Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 | 82 | 423 | 5.0E-49 |
| sp|P80209|CATD_BOVIN | Cathepsin D OS=Bos taurus GN=CTSD PE=1 SV=2 | 101 | 423 | 5.0E-49 |
| sp|Q805F3|CATEA_XENLA | Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 | 102 | 420 | 1.0E-48 |
| sp|P81497|PEPA_SUNMU | Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 | 104 | 423 | 2.0E-48 |
| sp|P18242|CATD_MOUSE | Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 | 78 | 421 | 4.0E-48 |
| sp|P24268|CATD_RAT | Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1 | 78 | 423 | 6.0E-48 |
| sp|Q9DEX3|CATD_CLUHA | Cathepsin D OS=Clupea harengus GN=ctsd PE=1 SV=1 | 113 | 420 | 6.0E-48 |
| sp|P25796|CATE_CAVPO | Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 | 92 | 420 | 6.0E-48 |
| sp|Q9GMY7|PEPA_RHIFE | Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 | 88 | 423 | 1.0E-47 |
| sp|Q4LAL9|CATD_CANLF | Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 | 101 | 420 | 1.0E-47 |
| sp|Q9N2D3|PEPC_CALJA | Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 | 56 | 423 | 1.0E-47 |
| sp|Q805F2|CATEB_XENLA | Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 | 62 | 420 | 4.0E-47 |
| sp|P27821|PEPA2_RABIT | Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 | 82 | 420 | 5.0E-47 |
| sp|Q689Z7|PEPC_MONDO | Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 | 44 | 420 | 7.0E-47 |
| sp|P28713|PEPA4_RABIT | Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 | 82 | 420 | 9.0E-47 |
| sp|Q800A0|CATE_LITCT | Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 | 62 | 420 | 1.0E-46 |
| sp|Q9GMY6|PEPA_CANLF | Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 | 99 | 423 | 1.0E-46 |
| sp|P16476|PEPE_CHICK | Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 | 49 | 420 | 1.0E-46 |
| sp|P56272|PEP2B_GADMO | Pepsin-2B OS=Gadus morhua PE=1 SV=1 | 105 | 423 | 2.0E-46 |
| sp|P28712|PEPA1_RABIT | Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 | 113 | 420 | 2.0E-46 |
| sp|Q8SQ41|PEPB_CANLF | Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 | 52 | 420 | 5.0E-46 |
| sp|Q9N2D2|CHYM_CALJA | Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 | 60 | 420 | 7.0E-46 |
| sp|P0DJD9|PEPA5_HUMAN | Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 | 104 | 423 | 1.0E-45 |
| sp|P00795|CATD_PIG | Cathepsin D OS=Sus scrofa GN=CTSD PE=1 SV=2 | 101 | 423 | 1.0E-45 |
| sp|Q9N2D4|PEPA_CALJA | Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 | 104 | 423 | 1.0E-45 |
| sp|O76856|CATD_DICDI | Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 | 73 | 420 | 1.0E-45 |
| sp|Q9GMY3|PEPC_RHIFE | Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 | 113 | 423 | 2.0E-45 |
| sp|P0DJD8|PEPA3_HUMAN | Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 | 104 | 423 | 2.0E-45 |
| sp|P0DJD7|PEPA4_HUMAN | Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 | 104 | 423 | 2.0E-45 |
| sp|P81498|PEPC_SUNMU | Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 | 52 | 423 | 2.0E-45 |
| sp|P04073|PEPC_RAT | Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 | 113 | 420 | 3.0E-45 |
| sp|P20142|PEPC_HUMAN | Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 | 113 | 423 | 3.0E-45 |
| sp|Q9D7R7|PEPC_MOUSE | Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 | 113 | 420 | 4.0E-45 |
| sp|Q9MZS8|CATD_SHEEP | Cathepsin D (Fragment) OS=Ovis aries GN=CTSD PE=1 SV=1 | 101 | 403 | 7.0E-45 |
| sp|P00791|PEPA_PIG | Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 | 101 | 423 | 1.0E-44 |
| sp|P03954|PEPA1_MACFU | Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 | 105 | 423 | 1.0E-44 |
| sp|P11489|PEPA_MACMU | Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 | 105 | 423 | 1.0E-44 |
| sp|Q9GMY4|PEPC_SORUN | Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 | 113 | 423 | 2.0E-44 |
| sp|P00792|PEPA_BOVIN | Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 | 68 | 423 | 4.0E-44 |
| sp|P27678|PEPA4_MACFU | Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 | 105 | 423 | 5.0E-44 |
| sp|Q29079|PAG2_PIG | Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 | 54 | 420 | 6.0E-44 |
| sp|P27677|PEPA2_MACFU | Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 | 105 | 423 | 6.0E-44 |
| sp|P03955|PEPC_MACFU | Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 | 113 | 423 | 6.0E-44 |
| sp|O42630|CARP_ASPFU | Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 | 43 | 420 | 3.0E-43 |
| sp|P27822|PEPA3_RABIT | Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 | 56 | 420 | 4.0E-43 |
| sp|Q01294|CARP_NEUCR | Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 | 77 | 420 | 4.0E-43 |
| sp|Q9GMY2|PEPC_RABIT | Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 | 106 | 423 | 5.0E-43 |
| sp|P18276|CHYM_SHEEP | Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 | 81 | 420 | 2.0E-42 |
| sp|Q28389|PAG_HORSE | Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 | 86 | 420 | 5.0E-42 |
| sp|D4DEN7|CARP_TRIVH | Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 | 74 | 420 | 7.0E-42 |
| sp|D4B385|CARP_ARTBC | Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 | 74 | 420 | 9.0E-42 |
| sp|P00794|CHYM_BOVIN | Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 | 81 | 420 | 1.0E-40 |
| sp|B6HL60|PEPA_PENRW | Aspartic protease pep1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=pep1 PE=3 SV=1 | 126 | 420 | 3.0E-40 |
| sp|Q06902|PEPA_ASPOR | Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 | 126 | 420 | 4.0E-40 |
| sp|B8NLY9|PEPA_ASPFN | Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 | 126 | 420 | 4.0E-40 |
| sp|P08424|RENI_RAT | Renin OS=Rattus norvegicus GN=Ren1 PE=2 SV=2 | 97 | 420 | 4.0E-40 |
| sp|Q6DYE7|RENI_CANLF | Renin OS=Canis lupus familiaris GN=REN PE=2 SV=1 | 99 | 420 | 5.0E-40 |
| sp|Q9TSZ1|RENI_CALJA | Renin OS=Callithrix jacchus GN=REN PE=2 SV=1 | 100 | 420 | 9.0E-40 |
| sp|Q29432|PAG1_BOVIN | Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 | 104 | 420 | 2.0E-39 |
| sp|P07267|CARP_YEAST | Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 | 74 | 420 | 2.0E-39 |
| sp|P81214|CARP_SYNRA | Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 | 66 | 420 | 3.0E-39 |
| sp|P00793|PEPA_CHICK | Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 | 62 | 423 | 8.0E-39 |
| sp|O96009|NAPSA_HUMAN | Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 | 103 | 420 | 1.0E-38 |
| sp|Q6DLW5|RENI_MACMU | Renin OS=Macaca mulatta GN=REN PE=2 SV=2 | 79 | 420 | 1.0E-38 |
| sp|P83493|PAG6_SHEEP | Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 | 104 | 420 | 4.0E-38 |
| sp|P41748|PEPA_ASPFU | Aspartic protease pep1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep1 PE=1 SV=2 | 126 | 420 | 7.0E-38 |
| sp|B0Y1V8|PEPA_ASPFC | Aspartic protease pep1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pep1 PE=3 SV=1 | 126 | 420 | 7.0E-38 |
| sp|Q03700|CARP4_RHINI | Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 | 97 | 423 | 1.0E-37 |
| sp|P60016|RENI_PANTR | Renin OS=Pan troglodytes GN=REN PE=3 SV=1 | 79 | 420 | 1.0E-37 |
| sp|P00797|RENI_HUMAN | Renin OS=Homo sapiens GN=REN PE=1 SV=1 | 79 | 420 | 1.0E-37 |
| sp|P27823|PEPAF_RABIT | Pepsin F OS=Oryctolagus cuniculus PE=2 SV=1 | 104 | 420 | 2.0E-37 |
| sp|Q28057|PAG2_BOVIN | Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 | 104 | 420 | 2.0E-37 |
| sp|Q6DLS0|RENI_MACFA | Renin OS=Macaca fascicularis GN=REN PE=2 SV=1 | 79 | 420 | 2.0E-37 |
| sp|P06026|CARP_RHICH | Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 | 101 | 423 | 3.0E-37 |
| sp|P00796|RENI2_MOUSE | Renin-2 OS=Mus musculus GN=Ren2 PE=1 SV=1 | 113 | 420 | 4.0E-37 |
| sp|P83495|PAG4_SHEEP | Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 | 82 | 420 | 7.0E-37 |
| sp|A1DDK1|PEPA_NEOFI | Aspartic protease pep1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pep1 PE=3 SV=1 | 126 | 420 | 9.0E-37 |
| sp|Q64411|PEPC_CAVPO | Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 | 113 | 423 | 9.0E-37 |
| sp|P52115|RENI_SHEEP | Renin OS=Ovis aries GN=REN PE=2 SV=1 | 100 | 420 | 2.0E-36 |
| sp|C5FS55|CARP_ARTOC | Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 | 113 | 420 | 2.0E-36 |
| sp|P06281|RENI1_MOUSE | Renin-1 OS=Mus musculus GN=Ren1 PE=1 SV=1 | 97 | 420 | 2.0E-36 |
| sp|O09043|NAPSA_MOUSE | Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 | 86 | 418 | 3.0E-36 |
| sp|Q01972|PEPA_PENRO | Aspartic protease pep1 OS=Penicillium roqueforti GN=pep1 PE=2 SV=1 | 102 | 420 | 4.0E-36 |
| sp|Q28755|PAG1_SHEEP | Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 | 104 | 420 | 8.0E-36 |
| sp|P10602|CARP1_RHINI | Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 | 95 | 423 | 2.0E-35 |
| sp|Q12567|PEPA_ASPPH | Aspartic protease pep1 OS=Aspergillus phoenicis GN=pep1 PE=1 SV=1 | 102 | 420 | 5.0E-35 |
| sp|P78735|PEPA_PENJA | Aspartic protease pepA OS=Penicillium janthinellum GN=pepA PE=1 SV=1 | 126 | 420 | 1.0E-34 |
| sp|O93885|PEPA_EMENI | Aspartic protease pep1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pep1 PE=3 SV=1 | 109 | 420 | 1.0E-34 |
| sp|A2R3L3|PEPA_ASPNC | Aspartic protease pep1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pep1 PE=3 SV=1 | 102 | 420 | 2.0E-34 |
| sp|Q29078|PAG1_PIG | Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 | 79 | 419 | 3.0E-34 |
| sp|P55325|PEPA_ASPNG | Aspartic protease pep1 OS=Aspergillus niger GN=pep1 PE=1 SV=1 | 102 | 420 | 4.0E-34 |
| sp|Q03699|CARP3_RHINI | Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 | 74 | 423 | 1.0E-33 |
| sp|P17946|PEPA_ASPAW | Aspartic protease pep1 OS=Aspergillus awamori GN=pep1 PE=1 SV=1 | 102 | 420 | 1.0E-33 |
| sp|Q9HEZ3|PEPB_PENJA | Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 | 78 | 420 | 2.0E-33 |
| sp|E5A7T3|PEPA_LEPMJ | Aspartic protease PEP1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=PEP1 PE=3 SV=2 | 31 | 423 | 3.0E-33 |
| sp|Q69IF8|PEPA_PHANO | Aspartic protease PEP1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PEP1 PE=3 SV=1 | 60 | 423 | 3.0E-33 |
| sp|O13340|CARP_PODAS | Podosporapepsin OS=Podospora anserina GN=PAPA PE=2 SV=1 | 21 | 420 | 3.0E-33 |
| sp|P00798|PENP_PENJA | Penicillopepsin OS=Penicillium janthinellum PE=1 SV=2 | 128 | 420 | 8.0E-33 |
| sp|P10977|CARPV_CANAX | Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 | 44 | 420 | 1.0E-32 |
| sp|P43231|CARP2_RHINI | Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 | 74 | 423 | 2.0E-32 |
| sp|D4DGR1|Y6366_TRIVH | Probable aspartic-type endopeptidase TRV_06366 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06366 PE=3 SV=1 | 108 | 423 | 5.0E-32 |
| sp|P11838|CARP_CRYPA | Endothiapepsin OS=Cryphonectria parasitica GN=EAPA PE=1 SV=2 | 86 | 420 | 2.0E-31 |
| sp|B8MF81|PEPA_TALSN | Aspartic protease pep1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=pep1 PE=3 SV=1 | 76 | 420 | 2.0E-31 |
| sp|Q8VYL3|APA2_ARATH | Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 | 103 | 319 | 2.0E-31 |
| sp|O65390|APA1_ARATH | Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 | 113 | 319 | 3.0E-31 |
| sp|D4AT39|Y7403_ARTBC | Probable aspartic-type endopeptidase ARB_07403 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07403 PE=3 SV=2 | 108 | 423 | 6.0E-31 |
| sp|Q9XFX4|CARDB_CYNCA | Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 | 86 | 338 | 1.0E-30 |
| sp|A1CBR4|PEPA_ASPCL | Aspartic protease pep1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pep1 PE=3 SV=1 | 128 | 420 | 1.0E-30 |
| sp|P55956|ASP3_CAEEL | Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 | 105 | 420 | 1.0E-30 |
| sp|P43232|CARP5_RHINI | Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 | 101 | 423 | 1.0E-30 |
| sp|P42211|ASPRX_ORYSJ | Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 | 93 | 330 | 1.0E-29 |
| sp|P40782|CYPR1_CYNCA | Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 | 103 | 324 | 1.0E-29 |
| sp|P85137|CARDF_CYNCA | Cardosin-F (Fragments) OS=Cynara cardunculus PE=1 SV=1 | 103 | 423 | 2.0E-29 |
| sp|Q9XEC4|APA3_ARATH | Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 | 66 | 319 | 2.0E-29 |
| sp|Q9XFX3|CARDA_CYNCA | Procardosin-A OS=Cynara cardunculus GN=cardA PE=1 SV=1 | 25 | 330 | 5.0E-29 |
| sp|Q4WNV0|CTSD_ASPFU | Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 | 113 | 421 | 1.0E-28 |
| sp|Q42456|ASPR1_ORYSJ | Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 | 103 | 319 | 3.0E-28 |
| sp|C5FZ57|Y7979_ARTOC | Putative aspergillopepsin A-like aspartic endopeptidase MCYG_07979 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07979 PE=3 SV=1 | 117 | 420 | 2.0E-27 |
| sp|P42210|ASPR_HORVU | Phytepsin OS=Hordeum vulgare PE=1 SV=1 | 103 | 319 | 6.0E-27 |
| sp|D4D7C5|PEPA_TRIVH | Aspartic endopeptidase PEP1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP1 PE=3 SV=1 | 84 | 420 | 8.0E-27 |
| sp|Q4WZS3|Y5950_ASPFU | Putative aspergillopepsin A-like aspartic endopeptidase AFUA_2G15950 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G15950 PE=3 SV=2 | 124 | 420 | 8.0E-27 |
| sp|P00799|CARP_RHIMI | Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 | 31 | 423 | 9.0E-27 |
| sp|D4ANC3|PEPA_ARTBC | Aspartic protease PEP1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP1 PE=3 SV=1 | 84 | 420 | 1.0E-26 |
| sp|P09177|CARP_RHIPU | Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 | 31 | 423 | 4.0E-26 |
| sp|P85138|CARDG_CYNCA | Cardosin-G (Fragments) OS=Cynara cardunculus PE=1 SV=1 | 103 | 423 | 2.0E-25 |
| sp|P85139|CARDH_CYNCA | Cardosin-H (Fragments) OS=Cynara cardunculus PE=1 SV=1 | 103 | 423 | 3.0E-25 |
| sp|C5PEI9|PEPA_COCP7 | Aspartic protease PEP3 OS=Coccidioides posadasii (strain C735) GN=PEP3 PE=3 SV=1 | 86 | 411 | 5.0E-25 |
| sp|Q5AEM6|CARP8_CANAL | Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 | 96 | 422 | 5.0E-25 |
| sp|P22929|CARP_SACFI | Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 | 106 | 420 | 6.0E-25 |
| sp|O42778|CARP8_CANAX | Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 | 96 | 422 | 8.0E-25 |
| sp|D4AZK1|CTSD_ARTBC | Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 | 107 | 420 | 4.0E-24 |
| sp|D4D8U6|CTSD_TRIVH | Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 | 107 | 420 | 4.0E-24 |
| sp|O01530|ASP6_CAEEL | Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 | 62 | 420 | 9.0E-24 |
| sp|C5FEK4|CTSD_ARTOC | Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 | 130 | 420 | 5.0E-23 |
| sp|P0CY28|CARP3_CANAX | Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 | 72 | 422 | 1.0E-22 |
| sp|P0CY29|CARP3_CANAL | Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 | 72 | 422 | 1.0E-22 |
| sp|C4YNQ5|CARP3_CANAW | Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 | 72 | 422 | 2.0E-22 |
| sp|D4DE18|Y5382_TRIVH | Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 | 67 | 420 | 2.0E-22 |
| sp|E5R1B9|PEPA_ARTGP | Aspartic protease PEP1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=PEP1 PE=3 SV=1 | 84 | 420 | 3.0E-22 |
| sp|C5FBS2|PEPA_ARTOC | Aspartic protease PEP1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP1 PE=3 SV=1 | 84 | 420 | 5.0E-22 |
| sp|P0CY27|CARP1_CANAL | Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 | 102 | 420 | 1.0E-21 |
| sp|Q00663|CARP_CANTR | Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 | 93 | 420 | 2.0E-21 |
| sp|C4YSF6|CARP1_CANAW | Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 | 106 | 420 | 2.0E-21 |
| sp|P0DJ06|CARP2_CANAL | Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 | 96 | 420 | 3.0E-21 |
| sp|P0CY26|CARP1_CANAX | Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 | 102 | 420 | 3.0E-21 |
| sp|P0CS83|CARP2_CANAX | Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 | 96 | 420 | 4.0E-21 |
| sp|C4YMJ3|CARP2_CANAW | Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 | 96 | 420 | 4.0E-21 |
| sp|P46925|PLM2_PLAFA | Plasmepsin-2 OS=Plasmodium falciparum PE=1 SV=1 | 60 | 420 | 7.0E-21 |
| sp|P39898|PLM1_PLAFA | Plasmepsin-1 OS=Plasmodium falciparum PE=1 SV=2 | 80 | 420 | 9.0E-21 |
| sp|Q7KQM4|PLM1_PLAF7 | Plasmepsin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0076 PE=2 SV=1 | 80 | 420 | 9.0E-21 |
| sp|O04057|ASPR_CUCPE | Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 | 94 | 334 | 2.0E-20 |
| sp|P32951|CARP1_CANPA | Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 | 84 | 422 | 8.0E-20 |
| sp|P43094|CARP5_CANAL | Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 | 106 | 420 | 3.0E-19 |
| sp|C5FW52|Y6955_ARTOC | Probable aspartic-type endopeptidase MCYG_06955 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_06955 PE=3 SV=1 | 128 | 420 | 7.0E-19 |
| sp|P43095|CARP6_CANAX | Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 | 106 | 420 | 6.0E-18 |
| sp|D4AIC4|Y4018_ARTBC | Probable aspartic-type endopeptidase ARB_04018 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04018 PE=3 SV=1 | 67 | 420 | 2.0E-17 |
| sp|P43093|CARP4_CANAW | Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 | 106 | 420 | 5.0E-17 |
| sp|Q5A8N2|CARP4_CANAL | Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 | 106 | 420 | 5.0E-17 |
| sp|Q5AC08|CARP6_CANAL | Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 | 106 | 420 | 8.0E-17 |
| sp|P32950|CARP2_CANPA | Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 | 117 | 407 | 4.0E-16 |
| sp|Q8NKB6|OPSB_ASPOR | Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 | 106 | 421 | 4.0E-15 |
| sp|Q12303|YPS3_YEAST | Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 | 95 | 420 | 1.0E-14 |
| sp|D4DFT3|OPSB_TRIVH | Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 | 106 | 420 | 1.0E-14 |
| sp|D4AIS3|OPSB_ARTBC | Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 | 106 | 420 | 1.0E-14 |
| sp|Q4WDN4|OPSB_ASPFU | Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 | 106 | 421 | 4.0E-14 |
| sp|Q59VH7|CARP7_CANAL | Candidapepsin-7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP7 PE=1 SV=1 | 98 | 423 | 2.0E-13 |
| sp|Q9JL18|BACE2_MOUSE | Beta-secretase 2 OS=Mus musculus GN=Bace2 PE=2 SV=1 | 85 | 420 | 2.0E-12 |
| sp|Q6IE75|BACE2_RAT | Beta-secretase 2 OS=Rattus norvegicus GN=Bace2 PE=2 SV=1 | 85 | 420 | 2.0E-12 |
| sp|Q9Y5Z0|BACE2_HUMAN | Beta-secretase 2 OS=Homo sapiens GN=BACE2 PE=1 SV=1 | 113 | 420 | 5.0E-12 |
| sp|P56819|BACE1_RAT | Beta-secretase 1 OS=Rattus norvegicus GN=Bace1 PE=2 SV=1 | 113 | 420 | 6.0E-12 |
| sp|P56818|BACE1_MOUSE | Beta-secretase 1 OS=Mus musculus GN=Bace1 PE=1 SV=2 | 113 | 420 | 9.0E-12 |
| sp|C5FRQ0|OPSB_ARTOC | Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 | 130 | 420 | 1.0E-11 |
| sp|P56817|BACE1_HUMAN | Beta-secretase 1 OS=Homo sapiens GN=BACE1 PE=1 SV=2 | 113 | 420 | 1.0E-11 |
| sp|P43096|CARP7_CANAX | Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 | 97 | 423 | 2.0E-11 |
| sp|P85136|CARDE_CYNCA | Cardosin-E (Fragments) OS=Cynara cardunculus PE=1 SV=1 | 258 | 423 | 6.0E-11 |
| sp|P32329|YPS1_YEAST | Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 | 139 | 420 | 3.0E-10 |
| sp|P17576|CARP_IRPLA | Polyporopepsin OS=Irpex lacteus PE=1 SV=1 | 99 | 419 | 7.0E-10 |
| sp|Q1KLR6|BACE1_CAVPO | Beta-secretase 1 OS=Cavia porcellus GN=BACE1 PE=2 SV=1 | 113 | 420 | 2.0E-09 |
| sp|P12630|BAR1_YEAST | Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 | 105 | 420 | 3.0E-09 |
| sp|P32834|SXA1_SCHPO | Aspartic proteinase sxa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa1 PE=3 SV=2 | 59 | 422 | 9.0E-09 |
| sp|P54958|ASP2_BLAGE | Aspartic protease Bla g 2 OS=Blattella germanica PE=1 SV=1 | 124 | 419 | 9.0E-08 |
| sp|Q42456|ASPR1_ORYSJ | Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 | 351 | 423 | 3.0E-07 |
| sp|O59774|YPS1_SCHPO | Aspartic proteinase yapsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yps1 PE=3 SV=1 | 81 | 418 | 8.0E-07 |
| sp|W8W138|BACE_STRPU | Beta-secretase OS=Strongylocentrotus purpuratus GN=BACE PE=2 SV=1 | 113 | 420 | 1.0E-06 |
| sp|Q5A651|CAR10_CANAL | Candidapepsin-10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP10 PE=1 SV=1 | 103 | 321 | 1.0E-06 |
| sp|P42210|ASPR_HORVU | Phytepsin OS=Hordeum vulgare PE=1 SV=1 | 351 | 423 | 3.0E-06 |
| sp|P40782|CYPR1_CYNCA | Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 | 350 | 423 | 5.0E-06 |
| sp|O65390|APA1_ARATH | Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 | 353 | 423 | 6.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 21 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 42.15 | 24.25 | 60.04 |
| Initials | Initials knots | 11.50 | 5.55 | 17.45 |
| Pileal_Stipeal_center | Stage I stipe center | 11.60 | 5.80 | 17.40 |
| Pileal_Stipeal_shell | Stage I stipe shell | 5.92 | 2.66 | 9.19 |
| DIF_stipe_center | Stage II stipe center | 23.49 | 12.86 | 34.12 |
| DIF_stipe_shell | Stage II stipe shell | 14.87 | 7.60 | 22.15 |
| DIF_stipe_skin | Stage II stipe skin | 10.38 | 5.07 | 15.69 |
| DIF_cap_skin | Stage II cap skin | 4.31 | 1.85 | 6.77 |
| DIF_cap_tissue | Stage II cap tissue | 6.75 | 3.12 | 10.38 |
| DIF_gill_tissue | Stage II gill tissue | 8.29 | 3.90 | 12.68 |
| YFB_stipe_center | Young fruiting body stipe center | 22.60 | 12.20 | 33.01 |
| YFB_stipe_shell | Young fruiting body stipe shell | 24.72 | 13.60 | 35.84 |
| YFB_stipe_skin | Young fruiting body stipe skin | 13.02 | 6.59 | 19.44 |
| YFB_cap_skin | Young fruiting body cap skin | 3.04 | 1.22 | 4.85 |
| YFB_cap_tissue | Young fruiting body cap tissue | 8.20 | 3.86 | 12.54 |
| YFB_gill_tissue | Young fruiting body gill tissue | 3.37 | 1.36 | 5.39 |
| YFB_veil | Young fruiting body veil | 4.18 | 1.70 | 6.67 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.032504 | yes |
| Casing | YFB_stipe_shell | 0.072330 | no |
| Casing | YFB_stipe_skin | 0.000613 | yes |
| Casing | YFB_cap_skin | 0.000613 | yes |
| Casing | YFB_cap_tissue | 0.000613 | yes |
| Casing | YFB_gill_tissue | 0.000613 | yes |
| Casing | YFB_veil | 0.000613 | yes |
| Casing | Initials | 0.000613 | yes |
| Casing | Pileal_Stipeal_center | 0.000613 | yes |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.042041 | yes |
| Casing | DIF_stipe_shell | 0.000613 | yes |
| Casing | DIF_stipe_skin | 0.000613 | yes |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.002525 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.225481 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.005302 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.987729 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.018344 | yes |
| DIF_gill_tissue | YFB_veil | 0.077343 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.870176 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.086750 | no |
| YFB_stipe_center | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_veil | 0.000613 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.035309 | yes |
| YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_veil | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.211238 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_veil | 0.002084 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.003765 | yes |
| YFB_cap_skin | YFB_gill_tissue | 0.888964 | no |
| YFB_cap_skin | YFB_veil | 0.556189 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.017226 | yes |
| YFB_cap_tissue | YFB_veil | 0.083843 | no |
| YFB_gill_tissue | YFB_veil | 0.735336 | no |
| Initials | DIF_gill_tissue | 0.459614 | no |
| Initials | YFB_stipe_center | 0.040723 | yes |
| Initials | YFB_stipe_shell | 0.015242 | yes |
| Initials | YFB_stipe_skin | 0.830601 | no |
| Initials | YFB_cap_skin | 0.000613 | yes |
| Initials | YFB_cap_tissue | 0.437516 | no |
| Initials | YFB_gill_tissue | 0.000613 | yes |
| Initials | YFB_veil | 0.006032 | yes |
| Initials | Pileal_Stipeal_center | 0.989730 | no |
| Initials | Pileal_Stipeal_shell | 0.069952 | no |
| Initials | DIF_stipe_center | 0.028193 | yes |
| Initials | DIF_stipe_shell | 0.579591 | no |
| Initials | DIF_stipe_skin | 0.867574 | no |
| Initials | DIF_cap_skin | 0.005302 | yes |
| Initials | DIF_cap_tissue | 0.166446 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.429462 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.035993 | yes |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.014668 | yes |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.842251 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.408674 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_veil | 0.004928 | yes |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.059513 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.024187 | yes |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.586494 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.851293 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.004548 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.152325 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.451917 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.021322 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.094821 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.470451 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.173847 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.476299 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.005671 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.126467 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.514796 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.837067 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.001625 | yes |
| DIF_stipe_center | YFB_stipe_center | 0.950023 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.930866 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.060104 | no |
| DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_veil | 0.000613 | yes |
| DIF_stipe_center | DIF_stipe_shell | 0.175675 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.006742 | yes |
| DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.096131 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.238213 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.122909 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.805046 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.089469 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_veil | 0.001140 | yes |
| DIF_stipe_shell | DIF_stipe_skin | 0.364332 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.021583 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.646942 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.011041 | yes |
| DIF_stipe_skin | YFB_stipe_shell | 0.002951 | yes |
| DIF_stipe_skin | YFB_stipe_skin | 0.628731 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.624033 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.002525 | yes |
| DIF_stipe_skin | YFB_veil | 0.011350 | yes |
| DIF_stipe_skin | DIF_cap_skin | 0.011041 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.285338 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.088095 | no |
| DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.001140 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.491358 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.093997 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.670370 | no |
| DIF_cap_skin | YFB_veil | 0.968647 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.301178 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.702303 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.060299 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.034837 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.719104 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.078944 | no |
| DIF_cap_tissue | YFB_veil | 0.269269 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|075090 MRLSSTFAALVAIVPAFVNAIPPRIGTTIPTRVGTVIPLTKRAVHLADEQGVVDCEVLRSQVTKVSRKLGRGFQA YQKNTGKAHPNAMKELLELLETRATGSVPLIDDQEVLWHGSISVGTPPKEFTVDFDTGSSDLFLPGATCGATCQG HEIYDTSASSTAQDQSRDFSLLFGDGSSIQGEVFSDTVTLGGLTVTNQAVGSATQYSTGFSAEQFPPDGLMGMAF PQISEFRANPFFQTLVAQGGADAPQFGFKLSTQGSELFLGGVNNNSFTGEFTNIDITQQGFWQIPLDSVNTGGSS AVQNVQAAIDTGTTLIVAPQQEAIQLYLAIPGAKDASNVIGPGFFTFPCNSDPQISLTFGGKAFAIPTNTFNLGQ LFQGSEDCVGGITGTTNIPLWVVGDVFLSNFYTKFDAGANQVGFADLA* |
| Coding | >AgabiH97|075090 ATGCGCTTATCTTCGACCTTTGCTGCTTTGGTTGCTATCGTTCCTGCTTTTGTTAATGCTATCCCTCCTCGTATT GGCACGACTATTCCTACCCGTGTTGGCACGGTCATCCCACTCACCAAACGTGCCGTCCACCTGGCGGATGAACAA GGCGTGGTCGACTGTGAAGTGCTAAGATCTCAGGTTACTAAAGTGTCAAGGAAATTGGGCCGCGGTTTCCAAGCT TACCAGAAAAATACCGGGAAAGCTCATCCTAATGCTATGAAAGAATTGTTGGAATTGTTGGAGACGAGAGCTACA GGATCTGTTCCTCTCATTGACGATCAAGAAGTGCTTTGGCACGGATCGATCTCAGTGGGTACACCCCCCAAAGAA TTCACAGTCGATTTTGACACTGGTAGTAGTGATTTATTTTTGCCCGGAGCTACTTGTGGCGCTACGTGCCAAGGA CACGAAATCTATGATACGTCTGCGAGTTCAACTGCGCAGGACCAAAGTCGGGATTTCTCACTCCTGTTCGGCGAT GGATCTTCGATCCAGGGCGAGGTATTCTCTGACACCGTAACTCTTGGTGGCCTAACTGTGACCAATCAAGCTGTT GGATCTGCAACGCAATACTCTACTGGTTTCAGCGCAGAGCAGTTCCCTCCTGATGGTCTTATGGGCATGGCGTTC CCTCAAATTTCCGAATTTAGAGCGAACCCATTCTTCCAGACTTTGGTTGCACAAGGTGGTGCGGACGCCCCGCAA TTTGGGTTCAAGCTTTCAACACAAGGGTCTGAATTGTTTTTGGGCGGCGTGAACAACAACTCGTTCACTGGGGAA TTTACTAATATCGATATTACACAACAGGGCTTTTGGCAGATACCACTTGATAGTGTGAATACTGGTGGTAGCAGT GCGGTTCAGAACGTACAAGCCGCTATCGACACTGGAACGACACTCATTGTTGCACCCCAGCAAGAAGCCATCCAG CTCTACTTGGCCATTCCCGGAGCAAAGGATGCGTCGAATGTTATTGGTCCGGGATTCTTCACCTTCCCTTGTAAC AGTGACCCACAGATCAGCTTGACATTTGGCGGAAAGGCCTTTGCAATTCCTACGAATACGTTTAACTTGGGTCAA CTTTTCCAAGGATCTGAGGATTGTGTCGGTGGAATCACCGGTACTACGAATATTCCTCTCTGGGTAGTCGGAGAT GTTTTCCTAAGCAACTTCTACACAAAATTCGATGCGGGTGCCAACCAGGTCGGATTCGCCGATCTCGCGTAA |
| Transcript | >AgabiH97|075090 ATGCGCTTATCTTCGACCTTTGCTGCTTTGGTTGCTATCGTTCCTGCTTTTGTTAATGCTATCCCTCCTCGTATT GGCACGACTATTCCTACCCGTGTTGGCACGGTCATCCCACTCACCAAACGTGCCGTCCACCTGGCGGATGAACAA GGCGTGGTCGACTGTGAAGTGCTAAGATCTCAGGTTACTAAAGTGTCAAGGAAATTGGGCCGCGGTTTCCAAGCT TACCAGAAAAATACCGGGAAAGCTCATCCTAATGCTATGAAAGAATTGTTGGAATTGTTGGAGACGAGAGCTACA GGATCTGTTCCTCTCATTGACGATCAAGAAGTGCTTTGGCACGGATCGATCTCAGTGGGTACACCCCCCAAAGAA TTCACAGTCGATTTTGACACTGGTAGTAGTGATTTATTTTTGCCCGGAGCTACTTGTGGCGCTACGTGCCAAGGA CACGAAATCTATGATACGTCTGCGAGTTCAACTGCGCAGGACCAAAGTCGGGATTTCTCACTCCTGTTCGGCGAT GGATCTTCGATCCAGGGCGAGGTATTCTCTGACACCGTAACTCTTGGTGGCCTAACTGTGACCAATCAAGCTGTT GGATCTGCAACGCAATACTCTACTGGTTTCAGCGCAGAGCAGTTCCCTCCTGATGGTCTTATGGGCATGGCGTTC CCTCAAATTTCCGAATTTAGAGCGAACCCATTCTTCCAGACTTTGGTTGCACAAGGTGGTGCGGACGCCCCGCAA TTTGGGTTCAAGCTTTCAACACAAGGGTCTGAATTGTTTTTGGGCGGCGTGAACAACAACTCGTTCACTGGGGAA TTTACTAATATCGATATTACACAACAGGGCTTTTGGCAGATACCACTTGATAGTGTGAATACTGGTGGTAGCAGT GCGGTTCAGAACGTACAAGCCGCTATCGACACTGGAACGACACTCATTGTTGCACCCCAGCAAGAAGCCATCCAG CTCTACTTGGCCATTCCCGGAGCAAAGGATGCGTCGAATGTTATTGGTCCGGGATTCTTCACCTTCCCTTGTAAC AGTGACCCACAGATCAGCTTGACATTTGGCGGAAAGGCCTTTGCAATTCCTACGAATACGTTTAACTTGGGTCAA CTTTTCCAAGGATCTGAGGATTGTGTCGGTGGAATCACCGGTACTACGAATATTCCTCTCTGGGTAGTCGGAGAT GTTTTCCTAAGCAACTTCTACACAAAATTCGATGCGGGTGCCAACCAGGTCGGATTCGCCGATCTCGCGTAA |
| Gene | >AgabiH97|075090 ATGCGCTTATCTTCGACCTTTGCTGCTTTGGTTGCTATCGTTCCTGCTTTTGTTAATGCTATCCCTCCTCGTATT GGCACGACTATTCCTACCCGTGTTGGCACGGTCATCCCACTCACCAAACGTGCCGTCCACCTGGCGGATGAACAA GGCGTGGTCGACTGTGAAGTGCTAAGATCTCAGGTTACTAAAGTGTCAAGGTACTTTTCGACCAACGATGAAAGA CGAATTGACGAAACTGACTTGCGCTACTAATCCAGGAAATTGGGCCGCGGTTTCCAAGCTTACCAGAAAAATACC GGGAAAGCTCATCCTAATGCTATGAAAGAATTGTTGGAATTGTTGGAGACGAGAGCTACAGGATCTGTTCCTCTC ATTGACGATCAAGAAGTGCTTTGGCACGGATCGATCTCAGTGGGTACACCCCCCAAAGAATTCACAGGTAAAAAA AGATAACAACTCTTTTCAATCTGTCAAAATACTGATTAACAAATTGTAGTCGATTTTGACACTGGTATGTGAAGT TGAATAGATGGACGTGTTCCCCTGGCGAGTAATGCTGATGATATCTTTTAAAGGTAGTAGTGATTTATTTTTGCC CGGAGCTACTTGTGGCGCTACGTGCCAAGGACACGAAATCTATGATACGTCTGCGAGTTCAACTGCGCAGGACCA AAGTCGGGATTTCTCACTCCTGTTCGGCGATGGATCTTCGATCCAGGGCGAGGTATTCTCTGACACCGTAACTCT TGGTGGCCTAACTGTGATTATCTCTTGTCAGCATTCATGTGAATCAAGTTCTTAACTTTTTTCTTCTTCTTCTCC CCTTAGGTGACCAATCAAGCTGTTGGATCTGCAACGCAATACTCTACTGGTTTCAGCGCAGAGCAGTTCCCTCCT GATGGTCTTATGGGCATGGCGTTCCCTCAAATTTCCGAATTTAGAGCGAACCCATTCTTCCAGACTTTGGTTGCA CAAGGTGGTGCGGACGCCCCGCAATTTGGGTTCAAGCTTTCAACACAAGGGTCTGAATTGTTTTTGGGCGGCGTG AACAACAACTCGTTCACTGGGGAATTTACTAATATCGATATTACACAACAGGTGTGATATTATTTGTCAAGTGTT GGGGGGGAAAGCGTTTGCTGACATGATATACTTGGACAGGGCTTTTGGCAGATACCACTTGATAGTGTGAATACT GGTGGTAGCAGTGCGGTTCAGAACGTACAAGCCGCTATCGACACTGGAACGACACTCATTGTTGCACCCCAGCAA GAAGCCATCCAGCTCTACTTGGCCATTCCCGGAGCAAAGGATGCGTCGAATGTTATTGGTCCGGGATTCTTCACC TGTGAGATAATTTTCTTTGCAGAATTGAAAGCAGTACTGACTGACATCTTTTCAAAAAGTCCCTTGTAACAGTGA CCCACAGATCAGCTTGACATTTGGCGGAAAGGCCTTTGCAATTCCTACGAATACGTTTAACTTGGGTCAACTTTT CCAAGGATCTGAGGATTGTGTCGGTGGAATCACCGGTACTACGAATATTCCTCGTGAGTATAGTTTACGCTTTTG TTGAGTAATGTATTTGATGCTGATGCTTCGGACAGTCTGGGTAGTCGGAGATGTTTTCCTAAGCAACTTCTACAC AAGTAAGCAAAAAAACCTGTTTTACTTATGACCCACGGCATGAACTGATATATGACTGTAGAATTCGATGCGGGT GCCAACCAGGTCGGATTCGCCGATCTCGCGTAA |