Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|075080
Gene name
Locationscaffold_4:2291788..2293109
Strand+
Gene length (bp)1321
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15906 zf-NOSIP Zinc-finger of nitric oxide synthase-interacting protein 9.2E-12 4 74
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 5.9E-07 259 303
PF13445 zf-RING_UBOX RING-type zinc-finger 1.2E-03 260 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6P829|NOSIP_XENTR Nitric oxide synthase-interacting protein OS=Xenopus tropicalis GN=nosip PE=2 SV=1 1 325 1.0E-31
sp|Q6NUH3|NOSIP_XENLA Nitric oxide synthase-interacting protein OS=Xenopus laevis GN=nosip PE=2 SV=1 1 325 3.0E-31
sp|Q5U3S7|NOSIP_DANRE Nitric oxide synthase-interacting protein OS=Danio rerio GN=nosip PE=2 SV=1 1 325 4.0E-31
sp|Q9D6T0|NOSIP_MOUSE Nitric oxide synthase-interacting protein OS=Mus musculus GN=Nosip PE=1 SV=1 1 330 9.0E-31
sp|Q3SWY5|NOSIP_BOVIN Nitric oxide synthase-interacting protein OS=Bos taurus GN=NOSIP PE=2 SV=1 1 330 2.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6P829|NOSIP_XENTR Nitric oxide synthase-interacting protein OS=Xenopus tropicalis GN=nosip PE=2 SV=1 1 325 1.0E-31
sp|Q6NUH3|NOSIP_XENLA Nitric oxide synthase-interacting protein OS=Xenopus laevis GN=nosip PE=2 SV=1 1 325 3.0E-31
sp|Q5U3S7|NOSIP_DANRE Nitric oxide synthase-interacting protein OS=Danio rerio GN=nosip PE=2 SV=1 1 325 4.0E-31
sp|Q9D6T0|NOSIP_MOUSE Nitric oxide synthase-interacting protein OS=Mus musculus GN=Nosip PE=1 SV=1 1 330 9.0E-31
sp|Q3SWY5|NOSIP_BOVIN Nitric oxide synthase-interacting protein OS=Bos taurus GN=NOSIP PE=2 SV=1 1 330 2.0E-30
sp|Q9Y314|NOSIP_HUMAN Nitric oxide synthase-interacting protein OS=Homo sapiens GN=NOSIP PE=1 SV=1 1 330 2.0E-29
sp|Q4R7H4|NOSIP_MACFA Nitric oxide synthase-interacting protein OS=Macaca fascicularis GN=NOSIP PE=2 SV=1 1 330 2.0E-29
sp|Q21755|NOSIP_CAEEL Nitric oxide synthase-interacting protein homolog OS=Caenorhabditis elegans GN=R05G6.4 PE=3 SV=1 1 322 4.0E-26
sp|Q9VWV8|NOSIP_DROME Nitric oxide synthase-interacting protein homolog OS=Drosophila melanogaster GN=CG6179 PE=3 SV=1 1 321 5.0E-26
sp|Q55DU4|NOSIP_DICDI Nitric oxide synthase-interacting protein homolog OS=Dictyostelium discoideum GN=nosip PE=2 SV=1 1 117 3.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|075080
MTKHSKNNTASSIFSYAERKKTEYGTQKQRLGNESMRQFDACTLCLNRARETLACEEGHLFCKECIYTDLLTQKK
DIKRQKEKLDAWKREHEEEKIRVREAARERVLADFEKSHLGLAARSTEIGRTGRTSTEHGRGTKRKFEFDASAVE
TLQREAEETAMRKIEKEQAEALKSKLPDFWLPSLTPTYTSNGLPTSLRQVKVQTMCRGGTPAHPVSLKSLFPIKF
TFFDGSSQQPGSNGSPSDSGTVKTTSRKDELDPICPACKKQLSNNVLISAAKPCGHVTCKSCTDSLIRTSKQCIV
CDELLKEKDILELKREGTGFAGGGIAEASRTGVSFQG*
Coding >AgabiH97|075080
ATGACGAAACATAGCAAGAATAACACCGCCTCGTCCATTTTCAGCTATGCAGAACGCAAGAAAACAGAATATGGC
ACTCAAAAGCAACGCCTTGGAAATGAGTCAATGCGTCAATTTGATGCCTGTACGCTGTGCTTAAATCGCGCCCGG
GAAACTCTGGCATGTGAAGAAGGGCATTTGTTTTGTAAAGAGTGTATTTATACAGATCTTTTGACGCAGAAAAAG
GATATTAAGCGCCAGAAAGAAAAATTGGATGCGTGGAAACGGGAACACGAGGAAGAGAAAATCAGGGTCCGAGAG
GCCGCTCGAGAACGGGTGTTAGCAGATTTTGAGAAAAGTCACCTCGGCTTAGCAGCTCGATCCACTGAAATTGGA
AGGACAGGCAGGACCTCAACGGAACATGGTAGGGGCACAAAGCGCAAGTTTGAGTTTGACGCTTCAGCGGTCGAG
ACTCTACAGCGGGAAGCCGAAGAGACAGCTATGCGTAAAATAGAAAAGGAACAAGCCGAAGCATTGAAGAGCAAA
CTTCCAGATTTCTGGCTACCGTCTTTGACGCCGACCTACACCTCAAACGGACTTCCAACTTCTCTTCGGCAAGTC
AAGGTTCAGACGATGTGTCGAGGCGGGACTCCAGCCCATCCCGTATCCTTGAAGTCCTTGTTTCCAATCAAATTT
ACTTTTTTCGACGGTTCGTCTCAACAGCCTGGATCCAACGGTTCTCCATCAGATTCTGGAACTGTCAAGACAACT
TCTAGAAAGGATGAGTTGGATCCTATATGTCCGGCTTGTAAGAAGCAACTATCAAACAACGTACTTATCTCTGCG
GCGAAACCATGTGGACACGTCACTTGTAAAAGCTGTACAGATTCTCTTATTCGGACATCAAAACAGTGTATAGTT
TGTGACGAGCTGTTGAAGGAGAAAGACATACTCGAACTGAAGCGTGAAGGTACTGGATTCGCTGGTGGGGGAATC
GCTGAGGCTTCCAGGACAGGAGTGTCGTTCCAAGGATAA
Transcript >AgabiH97|075080
ATGACGAAACATAGCAAGAATAACACCGCCTCGTCCATTTTCAGCTATGCAGAACGCAAGAAAACAGAATATGGC
ACTCAAAAGCAACGCCTTGGAAATGAGTCAATGCGTCAATTTGATGCCTGTACGCTGTGCTTAAATCGCGCCCGG
GAAACTCTGGCATGTGAAGAAGGGCATTTGTTTTGTAAAGAGTGTATTTATACAGATCTTTTGACGCAGAAAAAG
GATATTAAGCGCCAGAAAGAAAAATTGGATGCGTGGAAACGGGAACACGAGGAAGAGAAAATCAGGGTCCGAGAG
GCCGCTCGAGAACGGGTGTTAGCAGATTTTGAGAAAAGTCACCTCGGCTTAGCAGCTCGATCCACTGAAATTGGA
AGGACAGGCAGGACCTCAACGGAACATGGTAGGGGCACAAAGCGCAAGTTTGAGTTTGACGCTTCAGCGGTCGAG
ACTCTACAGCGGGAAGCCGAAGAGACAGCTATGCGTAAAATAGAAAAGGAACAAGCCGAAGCATTGAAGAGCAAA
CTTCCAGATTTCTGGCTACCGTCTTTGACGCCGACCTACACCTCAAACGGACTTCCAACTTCTCTTCGGCAAGTC
AAGGTTCAGACGATGTGTCGAGGCGGGACTCCAGCCCATCCCGTATCCTTGAAGTCCTTGTTTCCAATCAAATTT
ACTTTTTTCGACGGTTCGTCTCAACAGCCTGGATCCAACGGTTCTCCATCAGATTCTGGAACTGTCAAGACAACT
TCTAGAAAGGATGAGTTGGATCCTATATGTCCGGCTTGTAAGAAGCAACTATCAAACAACGTACTTATCTCTGCG
GCGAAACCATGTGGACACGTCACTTGTAAAAGCTGTACAGATTCTCTTATTCGGACATCAAAACAGTGTATAGTT
TGTGACGAGCTGTTGAAGGAGAAAGACATACTCGAACTGAAGCGTGAAGGTACTGGATTCGCTGGTGGGGGAATC
GCTGAGGCTTCCAGGACAGGAGTGTCGTTCCAAGGATAA
Gene >AgabiH97|075080
ATGACGAAACATAGCAAGAATAACACCGCCTCGTCCATTTTCAGCTATGCAGAACGCAAGAAAACAGAATATGGC
ACTCAAAAGGTACGTCGTTAGCTGGCTCTATTGCACGCCCTCAGTCCTTAACACCCCGGAAGCAACGCCTTGGAA
ATGAGTCAATGCGTCAATTTGATGCCTGTACGCTGTGCTTAAATCGCGCCCGGGAAACTCTGGCATGTGAAGAAG
GGCATTTGTTTTGTAAAGAGTGTATTTATACAGATCTTTGTGAGAGCAACAGCACCTGGATATCTGCTTTTTACT
GACAGTTCCAGTGACGCAGAAAAAGGATATTAAGCGCCAGAAAGAAAAATTGGATGCGTGGAAACGGGAACACGA
GGAAGAGAAAATCAGGGTCCGAGAGGCCGCTCGAGAACGGGTGTTAGCAGATTTTGAGAAAAGTCACCTCGGCTT
AGCAGCTCGATCCACTGAAATTGGAAGGACAGGCAGGACCTCAACGGAACATGGTGAGATATCTTGTCATCAGCA
CAAAGTGGCTCATCTGATCCTTGTAGGTAGGGGCACAAAGCGCAAGTTTGAGTTTGACGCTTCAGCGGTCGAGAC
TCTACAGCGGGAAGCCGAAGAGACAGCTATGCGTAAAATAGAAAAGGAACAAGCCGAAGCATTGAAGAGCAAACT
TCCAGATTTCTGGCTACCGTCTTTGACGCCGACCTACACCTCAAACGGACTTCCAACTTCTCTTCGGCAAGTCAA
GGTTCAGACGATGTGTCGAGGCGGGACTCCAGCCCATCCCGTATCGTGAGCTCTCCTTCATCATTCCCAAGTATC
CATCTAAATTCTTGGCAGCTTGAAGTCCTTGTTTCCAATCAAATTTACTTTTTTCGACGGTTCGTCTCAACAGCC
TGGATCCAACGGTTCTCCATCAGATTCTGGAACTGTCAAGACAACTTCTAGAAAGGATGAGTTGGATCCTATATG
TCCGGCTTGTAAGAAGCAACTATCAAACAACGTACTTATCTCTGGTGGGATCCCTCTCTTGTTGTACTTGCCTTG
ATAGAAATGAAGTCTAAAGCGTTCCATCAGCGGCGAAACCATGTGGACACGTCACTTGTAAAAGCTGTACAGATT
CTCTTATTCGGACATCAAAACAGTGTATAGTTTGTGACGAGCTGTTGAAGGAGAAAGACATACTCGAACTGAAGC
GTGAAGGTAAGTAAACATTCAGCTTATGGGGATGACTTTTCTGAGATCGTTACTAGGTACTGGATTCGCTGGTGG
GGGAATCGCTGAGGCTTCCAGGACAGGAGTGTCGTTCCAAGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail