Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|075000
Gene name
Locationscaffold_4:2275703..2277754
Strand+
Gene length (bp)2051
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00202 Aminotran_3 Aminotransferase class-III 2.8E-102 131 540

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3I3|ARGD_NEUCR Acetylornithine aminotransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-8 PE=3 SV=1 122 543 7.0E-140
sp|Q6C846|ARGD_YARLI Acetylornithine aminotransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARG8 PE=3 SV=1 123 541 2.0E-137
sp|Q6BUP9|ARGD_DEBHA Acetylornithine aminotransferase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARG8 PE=3 SV=1 85 543 3.0E-121
sp|O74548|ARGD_SCHPO Probable acetylornithine aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg1 PE=2 SV=1 99 543 6.0E-117
sp|O14433|ARGD_KLULA Acetylornithine aminotransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARG8 PE=3 SV=2 126 543 6.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3I3|ARGD_NEUCR Acetylornithine aminotransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-8 PE=3 SV=1 122 543 7.0E-140
sp|Q6C846|ARGD_YARLI Acetylornithine aminotransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARG8 PE=3 SV=1 123 541 2.0E-137
sp|Q6BUP9|ARGD_DEBHA Acetylornithine aminotransferase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARG8 PE=3 SV=1 85 543 3.0E-121
sp|O74548|ARGD_SCHPO Probable acetylornithine aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg1 PE=2 SV=1 99 543 6.0E-117
sp|O14433|ARGD_KLULA Acetylornithine aminotransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARG8 PE=3 SV=2 126 543 6.0E-108
sp|P18544|ARGD_YEAST Acetylornithine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG8 PE=1 SV=1 126 543 5.0E-106
sp|Q55DT8|ARGD_DICDI Probable acetylornithine aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=argD PE=3 SV=1 116 540 3.0E-104
sp|Q75AW1|ARGD_ASHGO Acetylornithine aminotransferase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARG8 PE=3 SV=1 122 540 4.0E-103
sp|O04866|ARGD_ALNGL Acetylornithine aminotransferase, mitochondrial OS=Alnus glutinosa GN=AG118 PE=2 SV=1 122 543 2.0E-97
sp|Q97GH9|ARGD_CLOAB Acetylornithine aminotransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argD PE=3 SV=1 122 541 5.0E-97
sp|Q9M8M7|ARGD_ARATH Acetylornithine aminotransferase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=WIN1 PE=1 SV=1 122 543 1.0E-95
sp|B5YQ35|ASTC_ECO5E Succinylornithine transaminase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=astC PE=3 SV=1 122 534 4.0E-95
sp|Q8X598|ASTC_ECO57 Succinylornithine transaminase OS=Escherichia coli O157:H7 GN=astC PE=3 SV=1 122 534 4.0E-95
sp|B7L6M2|ASTC_ECO55 Succinylornithine transaminase OS=Escherichia coli (strain 55989 / EAEC) GN=astC PE=3 SV=1 119 541 5.0E-95
sp|A8AHE0|ASTC_CITK8 Succinylornithine transaminase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=astC PE=3 SV=1 122 529 7.0E-95
sp|B7NT29|ASTC_ECO7I Succinylornithine transaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=astC PE=3 SV=1 122 541 1.0E-94
sp|B7USC9|ASTC_ECO27 Succinylornithine transaminase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=astC PE=3 SV=1 122 541 1.0E-94
sp|A1JS45|ASTC_YERE8 Succinylornithine transaminase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=astC PE=3 SV=1 122 529 1.0E-94
sp|B1LDY3|ASTC_ECOSM Succinylornithine transaminase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=astC PE=3 SV=1 122 541 2.0E-94
sp|Q3Z295|ASTC_SHISS Succinylornithine transaminase OS=Shigella sonnei (strain Ss046) GN=astC PE=3 SV=1 122 541 2.0E-94
sp|B7LQ44|ASTC_ESCF3 Succinylornithine transaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=astC PE=3 SV=1 122 534 3.0E-94
sp|Q66B21|ASTC_YERPS Succinylornithine transaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=astC PE=3 SV=1 122 529 3.0E-94
sp|A8A0U0|ASTC_ECOHS Succinylornithine transaminase OS=Escherichia coli O9:H4 (strain HS) GN=astC PE=3 SV=1 122 541 5.0E-94
sp|A7FIL6|ASTC_YERP3 Succinylornithine transaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=astC PE=3 SV=1 122 529 6.0E-94
sp|B6IBG8|ASTC_ECOSE Succinylornithine transaminase OS=Escherichia coli (strain SE11) GN=astC PE=3 SV=1 122 541 7.0E-94
sp|P77581|ASTC_ECOLI Succinylornithine transaminase OS=Escherichia coli (strain K12) GN=astC PE=1 SV=1 122 541 7.0E-94
sp|B1IPI2|ASTC_ECOLC Succinylornithine transaminase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=astC PE=3 SV=1 122 541 7.0E-94
sp|B1XGK9|ASTC_ECODH Succinylornithine transaminase OS=Escherichia coli (strain K12 / DH10B) GN=astC PE=3 SV=1 122 541 7.0E-94
sp|C4ZZA4|ASTC_ECOBW Succinylornithine transaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=astC PE=3 SV=1 122 541 7.0E-94
sp|B7M1G0|ASTC_ECO8A Succinylornithine transaminase OS=Escherichia coli O8 (strain IAI1) GN=astC PE=3 SV=1 122 541 7.0E-94
sp|A7ZML6|ASTC_ECO24 Succinylornithine transaminase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=astC PE=3 SV=1 122 541 7.0E-94
sp|A9QZ63|ASTC_YERPG Succinylornithine transaminase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=astC PE=3 SV=1 122 529 7.0E-94
sp|Q8D0D7|ASTC_YERPE Succinylornithine transaminase OS=Yersinia pestis GN=astC PE=3 SV=2 122 529 7.0E-94
sp|Q1C8B1|ASTC_YERPA Succinylornithine transaminase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=astC PE=3 SV=1 122 529 7.0E-94
sp|Q1RB45|ASTC_ECOUT Succinylornithine transaminase OS=Escherichia coli (strain UTI89 / UPEC) GN=astC PE=3 SV=1 122 541 8.0E-94
sp|Q8FGZ9|ASTC_ECOL6 Succinylornithine transaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=astC PE=3 SV=1 122 541 8.0E-94
sp|Q0TH82|ASTC_ECOL5 Succinylornithine transaminase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=astC PE=3 SV=1 122 541 8.0E-94
sp|A1ABS9|ASTC_ECOK1 Succinylornithine transaminase OS=Escherichia coli O1:K1 / APEC GN=astC PE=3 SV=1 122 541 8.0E-94
sp|B7MVM7|ASTC_ECO81 Succinylornithine transaminase OS=Escherichia coli O81 (strain ED1a) GN=astC PE=3 SV=1 122 541 8.0E-94
sp|B7MAV9|ASTC_ECO45 Succinylornithine transaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=astC PE=3 SV=1 122 541 8.0E-94
sp|Q9X2A5|ARGD_THEMA Acetylornithine aminotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=argD PE=1 SV=1 122 543 1.0E-93
sp|B7N584|ASTC_ECOLU Succinylornithine transaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=astC PE=3 SV=1 122 539 1.0E-93
sp|Q6FXA4|ARGD_CANGA Acetylornithine aminotransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARG8 PE=3 SV=1 123 540 1.0E-93
sp|Q321P0|ASTC_SHIBS Succinylornithine transaminase OS=Shigella boydii serotype 4 (strain Sb227) GN=astC PE=3 SV=1 122 541 4.0E-93
sp|B2U3D0|ASTC_SHIB3 Succinylornithine transaminase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=astC PE=3 SV=1 122 541 4.0E-93
sp|B4T3Z4|ASTC_SALNS Succinylornithine transaminase OS=Salmonella newport (strain SL254) GN=astC PE=3 SV=1 122 529 3.0E-91
sp|O66442|ARGD_AQUAE Acetylornithine aminotransferase OS=Aquifex aeolicus (strain VF5) GN=argD PE=1 SV=1 122 536 3.0E-91
sp|B5RB01|ASTC_SALG2 Succinylornithine transaminase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=astC PE=3 SV=1 122 529 7.0E-91
sp|B5QWJ0|ASTC_SALEP Succinylornithine transaminase OS=Salmonella enteritidis PT4 (strain P125109) GN=astC PE=3 SV=1 122 529 7.0E-91
sp|B5F846|ASTC_SALA4 Succinylornithine transaminase OS=Salmonella agona (strain SL483) GN=astC PE=3 SV=1 122 529 7.0E-91
sp|A9N278|ASTC_SALPB Succinylornithine transaminase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=astC PE=3 SV=1 122 529 7.0E-91
sp|Q8Z6F9|ASTC_SALTI Succinylornithine transaminase OS=Salmonella typhi GN=astC PE=3 SV=1 122 529 9.0E-91
sp|C0Q6X9|ASTC_SALPC Succinylornithine transaminase OS=Salmonella paratyphi C (strain RKS4594) GN=astC PE=3 SV=1 122 529 1.0E-90
sp|B4TGE0|ASTC_SALHS Succinylornithine transaminase OS=Salmonella heidelberg (strain SL476) GN=astC PE=3 SV=1 122 529 1.0E-90
sp|B5FJD8|ASTC_SALDC Succinylornithine transaminase OS=Salmonella dublin (strain CT_02021853) GN=astC PE=3 SV=1 122 529 1.0E-90
sp|Q8ZPV2|ASTC_SALTY Succinylornithine transaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=astC PE=2 SV=1 122 529 4.0E-90
sp|B5BA72|ASTC_SALPK Succinylornithine transaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=astC PE=3 SV=1 122 529 4.0E-90
sp|Q5PHC8|ASTC_SALPA Succinylornithine transaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=astC PE=3 SV=1 122 529 4.0E-90
sp|Q57PX9|ASTC_SALCH Succinylornithine transaminase OS=Salmonella choleraesuis (strain SC-B67) GN=astC PE=3 SV=1 122 529 6.0E-90
sp|P59324|ARGD_YERPE Acetylornithine/succinyldiaminopimelate aminotransferase OS=Yersinia pestis GN=argD PE=3 SV=2 122 543 4.0E-89
sp|P59086|ARGD_BUCAP Acetylornithine/succinyldiaminopimelate aminotransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argD PE=3 SV=1 119 529 2.0E-87
sp|Q9CNT1|ARGD_PASMU Acetylornithine aminotransferase OS=Pasteurella multocida (strain Pm70) GN=argD PE=3 SV=1 116 540 2.0E-87
sp|Q7N9E5|ARGD_PHOLL Acetylornithine/succinyldiaminopimelate aminotransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argD PE=3 SV=1 122 543 9.0E-87
sp|P59317|ARGD_ECOL6 Acetylornithine/succinyldiaminopimelate aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argD PE=3 SV=2 122 530 2.0E-86
sp|Q9JTX9|ARGD_NEIMA Acetylornithine aminotransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argD PE=3 SV=1 122 540 3.0E-86
sp|P40732|ARGD_SALTY Acetylornithine/succinyldiaminopimelate aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argD PE=1 SV=3 122 531 4.0E-86
sp|Q58131|ARGD_METJA Acetylornithine aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argD PE=3 SV=1 123 537 4.0E-86
sp|Q8PH31|ARGD_XANAC Acetylornithine aminotransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=argD PE=3 SV=1 123 529 4.0E-86
sp|P30900|ARGD_RHOCB Acetylornithine aminotransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=argD PE=3 SV=2 120 543 5.0E-86
sp|P57600|ARGD_BUCAI Acetylornithine/succinyldiaminopimelate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argD PE=3 SV=1 122 543 5.0E-86
sp|P59321|ARGD_SHIFL Acetylornithine/succinyldiaminopimelate aminotransferase OS=Shigella flexneri GN=argD PE=3 SV=1 122 530 6.0E-86
sp|P18335|ARGD_ECOLI Acetylornithine/succinyldiaminopimelate aminotransferase OS=Escherichia coli (strain K12) GN=argD PE=1 SV=4 122 530 6.0E-86
sp|Q8X4S6|ARGD_ECO57 Acetylornithine/succinyldiaminopimelate aminotransferase OS=Escherichia coli O157:H7 GN=argD PE=3 SV=3 122 530 8.0E-86
sp|Q8R7C1|ARGD_CALS4 Acetylornithine aminotransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argD PE=3 SV=1 122 543 1.0E-85
sp|Q8Z1Z3|ARGD_SALTI Acetylornithine/succinyldiaminopimelate aminotransferase OS=Salmonella typhi GN=argD PE=3 SV=3 122 531 2.0E-85
sp|Q9JYY4|ARGD_NEIMB Acetylornithine aminotransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argD PE=3 SV=1 122 540 9.0E-85
sp|P59319|ARGD_PSEPK Acetylornithine aminotransferase OS=Pseudomonas putida (strain KT2440) GN=argD PE=3 SV=1 122 543 1.0E-84
sp|Q7N2G7|ASTC_PHOLL Succinylornithine transaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=astC PE=3 SV=1 122 540 1.0E-83
sp|Q87DM8|ARGD_XYLFT Acetylornithine aminotransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=argD PE=3 SV=1 123 540 4.0E-83
sp|Q9PIR7|ARGD_CAMJE Acetylornithine aminotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=argD PE=1 SV=2 122 543 8.0E-83
sp|Q7NN66|ARGD_GLOVI Acetylornithine aminotransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=argD PE=3 SV=2 122 543 9.0E-83
sp|Q9PDF2|ARGD_XYLFA Acetylornithine aminotransferase OS=Xylella fastidiosa (strain 9a5c) GN=argD PE=3 SV=1 123 540 2.0E-82
sp|Q8PX16|ARGD_METMA Acetylornithine aminotransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argD PE=3 SV=1 122 539 1.0E-81
sp|O30508|ARUC_PSEAE Succinylornithine transaminase/acetylornithine aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruC PE=1 SV=2 122 543 2.0E-81
sp|Q8CUM9|ARGD_OCEIH Acetylornithine aminotransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argD PE=3 SV=1 114 537 3.0E-81
sp|Q8P5Q4|ARGD_XANCP Acetylornithine aminotransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=argD PE=3 SV=1 123 529 7.0E-81
sp|O27392|ARGD_METTH Acetylornithine aminotransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argD PE=3 SV=1 122 536 3.0E-80
sp|Q8TUE8|ARGD_METAC Acetylornithine aminotransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argD PE=3 SV=2 103 539 7.0E-80
sp|Q7VAS9|ARGD_PROMA Acetylornithine aminotransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argD PE=3 SV=2 118 543 1.0E-79
sp|Q885K0|ARGD1_PSESM Acetylornithine aminotransferase 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argD1 PE=3 SV=1 122 543 3.0E-79
sp|Q9KNW2|ARGD_VIBCH Acetylornithine aminotransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argD PE=3 SV=1 122 543 4.0E-79
sp|P59323|ARGD_VIBVU Acetylornithine aminotransferase OS=Vibrio vulnificus (strain CMCP6) GN=argD PE=3 SV=1 122 543 3.0E-78
sp|Q7MH19|ARGD_VIBVY Acetylornithine aminotransferase OS=Vibrio vulnificus (strain YJ016) GN=argD PE=3 SV=1 122 543 3.0E-78
sp|P54752|ARGD_NOSS1 Acetylornithine aminotransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argD PE=3 SV=1 108 540 2.0E-77
sp|P59320|ARGD_SHEON Acetylornithine aminotransferase OS=Shewanella oneidensis (strain MR-1) GN=argD PE=3 SV=1 119 543 2.0E-77
sp|P59316|ARGD_CHLTE Acetylornithine aminotransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argD PE=3 SV=1 126 537 5.0E-77
sp|Q7VMS5|ARGD_HAEDU Acetylornithine aminotransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=argD PE=3 SV=2 126 543 2.0E-76
sp|Q98BB7|ARGD_RHILO Acetylornithine aminotransferase OS=Rhizobium loti (strain MAFF303099) GN=argD PE=3 SV=1 117 543 3.0E-76
sp|P59322|ARGD_THEEB Acetylornithine aminotransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=argD PE=3 SV=1 113 543 4.0E-76
sp|Q59928|ARGD_STRMU Acetylornithine aminotransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argD PE=3 SV=2 122 537 6.0E-76
sp|Q92BC0|ARGD_LISIN Acetylornithine aminotransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argD PE=3 SV=1 122 541 1.0E-75
sp|Q8XWN8|ARGD_RALSO Acetylornithine aminotransferase OS=Ralstonia solanacearum (strain GMI1000) GN=argD PE=3 SV=1 115 542 1.0E-75
sp|Q8TUZ5|ARGD_METKA Acetylornithine aminotransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=argD PE=3 SV=1 126 542 2.0E-75
sp|Q9AAL3|ARGD1_CAUCR Acetylornithine aminotransferase 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argD1 PE=3 SV=1 122 529 3.0E-75
sp|Q87L20|ARGD_VIBPA Acetylornithine aminotransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argD PE=3 SV=1 122 543 5.0E-75
sp|Q71Z79|ARGD_LISMF Acetylornithine aminotransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argD PE=3 SV=1 122 541 3.0E-74
sp|Q9A652|ARGD2_CAUCR Acetylornithine aminotransferase 2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argD2 PE=3 SV=1 122 537 1.0E-73
sp|Q9K8V5|ARGD_BACHD Acetylornithine aminotransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argD PE=3 SV=1 122 540 2.0E-73
sp|Q7V0G0|ARGD_PROMP Acetylornithine aminotransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argD PE=3 SV=2 118 537 4.0E-73
sp|Q8Y6U4|ARGD_LISMO Acetylornithine aminotransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argD PE=3 SV=1 122 541 2.0E-72
sp|P36839|ARGD_BACSU Acetylornithine aminotransferase OS=Bacillus subtilis (strain 168) GN=argD PE=3 SV=2 120 540 3.0E-72
sp|Q9CHD3|ARGD_LACLA Acetylornithine aminotransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argD PE=3 SV=1 122 540 3.0E-72
sp|O30156|ARGD_ARCFU Acetylornithine aminotransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argD PE=3 SV=1 122 536 4.0E-72
sp|Q7MAE6|ARGD_WOLSU Acetylornithine aminotransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argD PE=3 SV=2 122 543 5.0E-72
sp|Q92SA0|ARGD_RHIME Acetylornithine aminotransferase OS=Rhizobium meliloti (strain 1021) GN=argD PE=3 SV=1 121 543 7.0E-72
sp|Q8UI71|ARGD_AGRFC Acetylornithine aminotransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=argD PE=3 SV=1 120 543 1.0E-71
sp|Q89VE9|ARGD1_BRADU Acetylornithine aminotransferase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argD1 PE=3 SV=1 122 543 1.0E-71
sp|P73133|ARGD_SYNY3 Acetylornithine aminotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argD PE=3 SV=1 78 543 1.0E-71
sp|P59318|ARGD_MYXXA Acetylornithine aminotransferase OS=Myxococcus xanthus GN=argD PE=3 SV=1 122 530 5.0E-71
sp|A0QYS9|ARGD_MYCS2 Acetylornithine aminotransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=argD PE=1 SV=1 126 541 3.0E-70
sp|Q7WKW5|ARGD1_BORBR Acetylornithine aminotransferase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argD1 PE=3 SV=1 119 536 4.0E-70
sp|P63567|ARGD_BRUSU Acetylornithine aminotransferase OS=Brucella suis biovar 1 (strain 1330) GN=argD PE=3 SV=1 121 543 7.0E-70
sp|P63566|ARGD_BRUME Acetylornithine aminotransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=argD PE=3 SV=1 121 543 7.0E-70
sp|Q5SHH5|ARGD_THET8 Acetylornithine/acetyl-lysine aminotransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=argD PE=1 SV=1 125 540 3.0E-69
sp|Q7W7H6|ARGD1_BORPA Acetylornithine aminotransferase 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argD1 PE=3 SV=2 119 536 3.0E-69
sp|Q7VTJ7|ARGD1_BORPE Acetylornithine aminotransferase 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argD1 PE=3 SV=1 119 536 3.0E-69
sp|Q93R93|ARGD_THET2 Acetylornithine/acetyl-lysine aminotransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argD PE=1 SV=1 125 540 1.0E-68
sp|Q7V8L1|ARGD_PROMM Acetylornithine aminotransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=argD PE=3 SV=1 106 540 2.0E-68
sp|Q818W2|ARGD_BACCR Acetylornithine aminotransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=argD PE=3 SV=2 122 537 4.0E-68
sp|Q8FTN2|ARGD_COREF Acetylornithine aminotransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=argD PE=3 SV=1 122 529 4.0E-68
sp|Q82UP3|ARGD_NITEU Acetylornithine aminotransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argD PE=3 SV=1 122 533 5.0E-68
sp|Q882K8|ARGD2_PSESM Acetylornithine aminotransferase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argD2 PE=3 SV=1 117 542 8.0E-68
sp|Q07907|ARGD_GEOSE Acetylornithine aminotransferase OS=Geobacillus stearothermophilus GN=argD PE=3 SV=2 122 541 1.0E-67
sp|Q7U5R5|ARGD_SYNPX Acetylornithine aminotransferase OS=Synechococcus sp. (strain WH8102) GN=argD PE=3 SV=1 107 543 1.0E-67
sp|Q5HP24|ARGD_STAEQ Acetylornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argD PE=3 SV=1 122 536 9.0E-67
sp|Q828A3|ARGD_STRAW Acetylornithine aminotransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argD PE=3 SV=1 122 543 1.0E-66
sp|P9WPZ7|ARGD_MYCTU Acetylornithine aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=argD PE=1 SV=1 126 541 2.0E-66
sp|P9WPZ6|ARGD_MYCTO Acetylornithine aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=argD PE=3 SV=1 126 541 2.0E-66
sp|P63569|ARGD_MYCBO Acetylornithine aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=argD PE=3 SV=1 126 541 2.0E-66
sp|Q8CSG1|ARGD_STAES Acetylornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argD PE=3 SV=2 122 536 3.0E-66
sp|P24087|ARGD_LEPIN Acetylornithine aminotransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=argD PE=3 SV=2 114 541 5.0E-66
sp|Q72RH8|ARGD_LEPIC Acetylornithine aminotransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=argD PE=3 SV=1 114 541 5.0E-66
sp|Q8U0B4|ARGD_PYRFU Acetylornithine/acetyl-lysine aminotransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=argD PE=3 SV=1 128 543 2.0E-65
sp|Q8NYM5|OAT1_STAAW Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain MW2) GN=rocD1 PE=3 SV=1 126 541 4.0E-65
sp|Q6GCU1|OAT1_STAAS Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain MSSA476) GN=rocD1 PE=3 SV=1 126 541 4.0E-65
sp|Q5HJI8|OAT1_STAAC Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain COL) GN=rocD1 PE=3 SV=1 126 541 4.0E-65
sp|Q9CC12|ARGD_MYCLE Acetylornithine aminotransferase OS=Mycobacterium leprae (strain TN) GN=argD PE=3 SV=1 126 542 5.0E-65
sp|P60296|OAT1_STAAN Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain N315) GN=rocD1 PE=3 SV=1 126 541 5.0E-65
sp|P60295|OAT1_STAAM Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rocD1 PE=3 SV=1 126 541 5.0E-65
sp|O08321|ARGD_LACPL Acetylornithine aminotransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argD PE=3 SV=4 122 522 8.0E-65
sp|Q9L1A4|ARGD_STRCO Acetylornithine aminotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argD PE=3 SV=1 122 541 8.0E-65
sp|Q8ZV07|ARGD_PYRAE Acetylornithine/acetyl-lysine aminotransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=argD PE=3 SV=1 139 539 9.0E-65
sp|Q7SI94|ARGD_SULSO Acetylornithine/acetyl-lysine aminotransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=argD PE=3 SV=2 122 532 1.0E-64
sp|Q81M98|ARGD_BACAN Acetylornithine aminotransferase OS=Bacillus anthracis GN=argD PE=3 SV=1 122 537 1.0E-64
sp|Q59282|ARGD_CORGL Acetylornithine aminotransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=argD PE=3 SV=2 122 536 1.0E-64
sp|Q9RW75|ARGD_DEIRA Acetylornithine/acetyl-lysine aminotransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=argD PE=3 SV=2 125 540 3.0E-64
sp|Q6GKC1|OAT1_STAAR Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain MRSA252) GN=rocD1 PE=3 SV=1 126 541 5.0E-64
sp|Q7VSH3|ARGD2_BORPE Acetylornithine aminotransferase 2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argD2 PE=3 SV=1 122 543 8.0E-64
sp|Q7WDN7|ARGD2_BORBR Acetylornithine aminotransferase 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argD2 PE=3 SV=1 122 543 2.0E-63
sp|Q89LG2|ARGD2_BRADU Acetylornithine aminotransferase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argD2 PE=3 SV=1 118 540 1.0E-62
sp|P59315|ARGD_BIFLO Acetylornithine aminotransferase OS=Bifidobacterium longum (strain NCC 2705) GN=argD PE=3 SV=1 123 537 2.0E-62
sp|Q9YBY6|ARGD_AERPE Acetylornithine/acetyl-lysine aminotransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=argD PE=3 SV=1 136 537 2.0E-62
sp|Q7VSA0|OAT_BORPE Ornithine aminotransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rocD PE=3 SV=2 130 536 3.0E-62
sp|Q7W1E4|OAT_BORPA Ornithine aminotransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rocD PE=3 SV=3 130 536 3.0E-62
sp|Q7WP51|OAT_BORBR Ornithine aminotransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rocD PE=3 SV=2 130 536 3.0E-62
sp|Q7W2N9|ARGD2_BORPA Acetylornithine aminotransferase 2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argD2 PE=3 SV=1 122 543 6.0E-62
sp|Q5JFW3|ARGD_THEKO Acetylornithine aminotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=argD PE=3 SV=1 123 543 1.0E-61
sp|Q9LCS5|ARGD_STRC2 Acetylornithine aminotransferase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=argD PE=3 SV=1 122 543 4.0E-61
sp|Q976K0|ARGD_SULTO Acetylornithine/acetyl-lysine aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=argD PE=3 SV=1 122 532 6.0E-61
sp|O59401|ARGD_PYRHO Acetylornithine/acetyl-lysine aminotransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=argD PE=3 SV=1 128 534 7.0E-61
sp|Q89RB7|OAT_BRADU Ornithine aminotransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rocD PE=3 SV=1 132 534 7.0E-60
sp|Q49W96|OAT2_STAS1 Ornithine aminotransferase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rocD2 PE=3 SV=1 131 534 1.0E-58
sp|Q4A0N2|OAT1_STAS1 Ornithine aminotransferase 1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rocD1 PE=3 SV=1 126 541 2.0E-58
sp|Q18040|OAT_CAEEL Probable ornithine aminotransferase, mitochondrial OS=Caenorhabditis elegans GN=C16A3.10 PE=3 SV=3 133 536 6.0E-58
sp|C4L2E7|OAT_EXISA Ornithine aminotransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rocD PE=3 SV=1 131 540 1.0E-57
sp|Q9V1I4|ARGD_PYRAB Acetylornithine/acetyl-lysine aminotransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=argD PE=3 SV=1 128 540 2.0E-57
sp|P60299|OAT2_STAAW Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain MW2) GN=rocD2 PE=3 SV=1 131 534 7.0E-57
sp|Q6GAW9|OAT2_STAAS Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain MSSA476) GN=rocD2 PE=3 SV=1 131 534 7.0E-57
sp|P60298|OAT2_STAAN Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain N315) GN=rocD2 PE=1 SV=1 131 534 7.0E-57
sp|P60297|OAT2_STAAM Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rocD2 PE=3 SV=1 131 534 7.0E-57
sp|Q5HHC8|OAT2_STAAC Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain COL) GN=rocD2 PE=3 SV=1 131 534 7.0E-57
sp|Q6GID1|OAT2_STAAR Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain MRSA252) GN=rocD2 PE=3 SV=1 131 534 2.0E-56
sp|Q8EP32|OAT_OCEIH Ornithine aminotransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rocD PE=3 SV=1 131 540 2.0E-56
sp|Q9K5Z2|OAT_BACHD Ornithine aminotransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rocD PE=3 SV=2 131 541 5.0E-56
sp|C5D6R2|OAT_GEOSW Ornithine aminotransferase OS=Geobacillus sp. (strain WCH70) GN=rocD PE=3 SV=1 132 534 4.0E-55
sp|P30268|Y2045_BACPE Uncharacterized aminotransferase BpOF4_10225 OS=Bacillus pseudofirmus (strain OF4) GN=BpOF4_10225 PE=3 SV=2 137 540 2.0E-54
sp|Q81GP2|OAT_BACCR Ornithine aminotransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rocD PE=3 SV=1 131 540 9.0E-54
sp|C1EL61|OAT_BACC3 Ornithine aminotransferase OS=Bacillus cereus (strain 03BB102) GN=rocD PE=3 SV=1 131 540 2.0E-53
sp|B9ITF9|OAT_BACCQ Ornithine aminotransferase OS=Bacillus cereus (strain Q1) GN=rocD PE=3 SV=1 131 540 2.0E-53
sp|B9DIU0|OAT_STACT Ornithine aminotransferase OS=Staphylococcus carnosus (strain TM300) GN=rocD PE=3 SV=1 118 534 3.0E-53
sp|Q5HQK4|OAT_STAEQ Ornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rocD PE=3 SV=1 131 540 4.0E-53
sp|Q8CT82|OAT_STAES Ornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rocD PE=3 SV=1 131 540 9.0E-53
sp|Q81TV3|OAT_BACAN Ornithine aminotransferase OS=Bacillus anthracis GN=rocD PE=1 SV=1 131 540 9.0E-53
sp|C3LBX0|OAT_BACAC Ornithine aminotransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rocD PE=3 SV=1 131 540 9.0E-53
sp|C3P3K3|OAT_BACAA Ornithine aminotransferase OS=Bacillus anthracis (strain A0248) GN=rocD PE=3 SV=1 131 540 9.0E-53
sp|Q92413|OAT_EMENI Ornithine aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=otaA PE=3 SV=2 132 543 1.0E-52
sp|B9EAM9|OAT_MACCJ Ornithine aminotransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=rocD PE=3 SV=1 118 534 2.0E-52
sp|Q9FNK4|OAT_ARATH Ornithine aminotransferase, mitochondrial OS=Arabidopsis thaliana GN=DELTA-OAT PE=1 SV=1 132 541 4.0E-52
sp|Q6D6Y6|PAT_PECAS Putrescine aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=patA PE=3 SV=1 141 543 4.0E-52
sp|A7MIU0|PAT_CROS8 Putrescine aminotransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=patA PE=3 SV=2 141 543 2.0E-51
sp|C0ZBR4|OAT_BREBN Ornithine aminotransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rocD PE=3 SV=1 132 540 2.0E-51
sp|P29758|OAT_MOUSE Ornithine aminotransferase, mitochondrial OS=Mus musculus GN=Oat PE=1 SV=1 133 536 4.0E-51
sp|Q10G56|OAT_ORYSJ Ornithine aminotransferase, mitochondrial OS=Oryza sativa subsp. japonica GN=OAT PE=2 SV=1 132 541 7.0E-51
sp|P49724|OAT_DROAN Ornithine aminotransferase, mitochondrial OS=Drosophila ananassae GN=Oat PE=1 SV=1 133 543 1.0E-50
sp|A4WEQ6|PAT_ENT38 Putrescine aminotransferase OS=Enterobacter sp. (strain 638) GN=patA PE=3 SV=1 136 543 4.0E-50
sp|A6TEB2|PAT_KLEP7 Putrescine aminotransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=patA PE=3 SV=2 141 530 4.0E-50
sp|B7ND61|PAT_ECOLU Putrescine aminotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=patA PE=3 SV=2 141 543 5.0E-50
sp|A8A4N0|PAT_ECOHS Putrescine aminotransferase OS=Escherichia coli O9:H4 (strain HS) GN=patA PE=3 SV=2 136 543 7.0E-50
sp|P42588|PAT_ECOLI Putrescine aminotransferase OS=Escherichia coli (strain K12) GN=patA PE=1 SV=2 136 543 7.0E-50
sp|B1XG77|PAT_ECODH Putrescine aminotransferase OS=Escherichia coli (strain K12 / DH10B) GN=patA PE=3 SV=2 136 543 7.0E-50
sp|C4ZQY9|PAT_ECOBW Putrescine aminotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=patA PE=3 SV=1 136 543 7.0E-50
sp|Q1R6Q7|PAT_ECOUT Putrescine aminotransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=patA PE=3 SV=2 141 543 1.0E-49
sp|B6I445|PAT_ECOSE Putrescine aminotransferase OS=Escherichia coli (strain SE11) GN=patA PE=3 SV=2 141 543 1.0E-49
sp|A1AFZ3|PAT_ECOK1 Putrescine aminotransferase OS=Escherichia coli O1:K1 / APEC GN=patA PE=3 SV=2 141 543 1.0E-49
sp|B7N0M2|PAT_ECO81 Putrescine aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=patA PE=3 SV=2 141 543 1.0E-49
sp|B5YRB3|PAT_ECO5E Putrescine aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=patA PE=3 SV=1 141 543 1.0E-49
sp|Q8XAN1|PAT_ECO57 Putrescine aminotransferase OS=Escherichia coli O157:H7 GN=patA PE=3 SV=2 141 543 1.0E-49
sp|B7LH08|PAT_ECO55 Putrescine aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=patA PE=3 SV=2 141 543 1.0E-49
sp|B7MB08|PAT_ECO45 Putrescine aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=patA PE=3 SV=2 141 543 1.0E-49
sp|B7UIY0|PAT_ECO27 Putrescine aminotransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=patA PE=3 SV=1 141 543 1.0E-49
sp|A7ZRV6|PAT_ECO24 Putrescine aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=patA PE=3 SV=2 141 543 1.0E-49
sp|Q31WW1|PAT_SHIBS Putrescine aminotransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=patA PE=3 SV=2 136 543 1.0E-49
sp|A8APX8|PAT_CITK8 Putrescine aminotransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=patA PE=3 SV=2 136 543 1.0E-49
sp|B7LQF8|PAT_ESCF3 Putrescine aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=patA PE=3 SV=2 141 543 1.0E-49
sp|B1IRP4|PAT_ECOLC Putrescine aminotransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=patA PE=3 SV=2 141 543 1.0E-49
sp|Q07805|OAT_PLAFD Ornithine aminotransferase OS=Plasmodium falciparum (isolate CDC / Honduras) GN=OAT PE=1 SV=1 132 541 2.0E-49
sp|Q6LFH8|OAT_PLAF7 Ornithine aminotransferase OS=Plasmodium falciparum (isolate 3D7) GN=OAT PE=1 SV=1 132 541 2.0E-49
sp|P04182|OAT_RAT Ornithine aminotransferase, mitochondrial OS=Rattus norvegicus GN=Oat PE=1 SV=1 133 536 2.0E-49
sp|Q8FDF5|PAT_ECOL6 Putrescine aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=patA PE=3 SV=2 141 543 3.0E-49
sp|B7NJT8|PAT_ECO7I Putrescine aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=patA PE=3 SV=2 136 543 3.0E-49
sp|P38021|OAT_BACSU Ornithine aminotransferase OS=Bacillus subtilis (strain 168) GN=rocD PE=1 SV=2 131 541 3.0E-49
sp|P04181|OAT_HUMAN Ornithine aminotransferase, mitochondrial OS=Homo sapiens GN=OAT PE=1 SV=1 133 536 3.0E-49
sp|B5XTY7|PAT_KLEP3 Putrescine aminotransferase OS=Klebsiella pneumoniae (strain 342) GN=patA PE=3 SV=1 141 530 3.0E-49
sp|B7LZM2|PAT_ECO8A Putrescine aminotransferase OS=Escherichia coli O8 (strain IAI1) GN=patA PE=3 SV=2 141 543 3.0E-49
sp|Q0TD34|PAT_ECOL5 Putrescine aminotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=patA PE=3 SV=2 141 543 4.0E-49
sp|Q83JJ8|PAT_SHIFL Putrescine aminotransferase OS=Shigella flexneri GN=patA PE=3 SV=5 141 543 5.0E-49
sp|Q0T0J2|PAT_SHIF8 Putrescine aminotransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=patA PE=3 SV=1 141 543 5.0E-49
sp|B1LF65|PAT_ECOSM Putrescine aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=patA PE=3 SV=2 141 543 5.0E-49
sp|Q3ZCF5|OAT_BOVIN Ornithine aminotransferase, mitochondrial OS=Bos taurus GN=OAT PE=2 SV=1 133 536 1.0E-48
sp|Q3YXH0|PAT_SHISS Putrescine aminotransferase OS=Shigella sonnei (strain Ss046) GN=patA PE=3 SV=2 136 543 2.0E-48
sp|Q9VW26|OAT_DROME Ornithine aminotransferase, mitochondrial OS=Drosophila melanogaster GN=Oat PE=2 SV=1 133 536 4.0E-48
sp|B5BG29|PAT_SALPK Putrescine aminotransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=patA PE=3 SV=2 136 543 5.0E-48
sp|Q5PC95|PAT_SALPA Putrescine aminotransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=patA PE=3 SV=2 136 543 5.0E-48
sp|Q8Z3L9|PAT_SALTI Putrescine aminotransferase OS=Salmonella typhi GN=patA PE=3 SV=2 136 543 9.0E-48
sp|B4TIU6|PAT_SALHS Putrescine aminotransferase OS=Salmonella heidelberg (strain SL476) GN=patA PE=3 SV=1 136 543 9.0E-48
sp|Q8ZLX7|PAT_SALTY Putrescine aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=patA PE=3 SV=2 136 543 1.0E-47
sp|B4TVV2|PAT_SALSV Putrescine aminotransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=patA PE=3 SV=1 136 543 1.0E-47
sp|B4T688|PAT_SALNS Putrescine aminotransferase OS=Salmonella newport (strain SL254) GN=patA PE=3 SV=1 136 543 1.0E-47
sp|B5F6B4|PAT_SALA4 Putrescine aminotransferase OS=Salmonella agona (strain SL483) GN=patA PE=3 SV=1 136 543 1.0E-47
sp|A9MPU4|PAT_SALAR Putrescine aminotransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=patA PE=3 SV=2 136 543 1.0E-47
sp|B5REH5|PAT_SALG2 Putrescine aminotransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=patA PE=3 SV=2 136 543 1.0E-47
sp|B5QZ53|PAT_SALEP Putrescine aminotransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=patA PE=3 SV=2 136 543 1.0E-47
sp|B5FHV3|PAT_SALDC Putrescine aminotransferase OS=Salmonella dublin (strain CT_02021853) GN=patA PE=3 SV=1 136 543 1.0E-47
sp|C0PYZ1|PAT_SALPC Putrescine aminotransferase OS=Salmonella paratyphi C (strain RKS4594) GN=patA PE=3 SV=2 136 543 2.0E-47
sp|Q57JP1|PAT_SALCH Putrescine aminotransferase OS=Salmonella choleraesuis (strain SC-B67) GN=patA PE=3 SV=1 136 543 2.0E-47
sp|Q7RT90|OAT_PLAYO Ornithine aminotransferase OS=Plasmodium yoelii yoelii GN=OAT PE=1 SV=1 132 541 2.0E-47
sp|Q4XWV5|OAT_PLACH Ornithine aminotransferase OS=Plasmodium chabaudi GN=OAT PE=3 SV=1 132 541 1.0E-46
sp|A9N5Z8|PAT_SALPB Putrescine aminotransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=patA PE=3 SV=1 136 543 1.0E-46
sp|P07991|OAT_YEAST Ornithine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAR2 PE=1 SV=2 132 543 4.0E-46
sp|Q6CWC1|OAT_KLULA Ornithine aminotransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CAR2 PE=1 SV=1 132 543 4.0E-44
sp|Q5WL78|ECTB_BACSK Diaminobutyrate--2-oxoglutarate transaminase OS=Bacillus clausii (strain KSM-K16) GN=ectB PE=3 SV=1 132 543 1.0E-42
sp|Q54JP5|OAT_DICDI Probable ornithine aminotransferase OS=Dictyostelium discoideum GN=oatA PE=3 SV=1 132 543 2.0E-42
sp|Q9ZJ10|ARGD_BACAM Acetylornithine aminotransferase (Fragment) OS=Bacillus amyloliquefaciens GN=argD PE=3 SV=1 120 382 4.0E-42
sp|Q9P7L5|OAT_SCHPO Ornithine aminotransferase car2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=car2 PE=2 SV=1 133 543 5.0E-42
sp|Q9KED4|ECTB_BACHD Diaminobutyrate--2-oxoglutarate transaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ectB PE=3 SV=1 132 543 2.0E-41
sp|Q9SR86|AGT23_ARATH Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana GN=At3g08860 PE=2 SV=1 86 543 1.0E-40
sp|Q8ESU8|ECTB_OCEIH Diaminobutyrate--2-oxoglutarate transaminase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ectB PE=3 SV=1 132 542 3.0E-40
sp|Q7M9K2|ECTB_WOLSU Diaminobutyrate--2-oxoglutarate transaminase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ectB PE=3 SV=1 132 540 5.0E-40
sp|P22256|GABT_ECOLI 4-aminobutyrate aminotransferase GabT OS=Escherichia coli (strain K12) GN=gabT PE=1 SV=1 141 536 2.0E-39
sp|Q5YW77|ECTB_NOCFA Diaminobutyrate--2-oxoglutarate transaminase OS=Nocardia farcinica (strain IFM 10152) GN=ectB PE=3 SV=1 132 543 2.0E-39
sp|Q9I6M4|DAVT_PSEAE 5-aminovalerate aminotransferase DavT OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=davT PE=1 SV=1 132 536 6.0E-39
sp|Q6PR32|ECTB_VIRPA Diaminobutyrate--2-oxoglutarate transaminase OS=Virgibacillus pantothenticus GN=ectB PE=3 SV=1 132 541 2.0E-38
sp|M1GRN3|ILE2E_LACBU Isoleucine 2-epimerase OS=Lactobacillus buchneri PE=1 SV=1 131 543 4.0E-38
sp|Q3UEG6|AGT2_MOUSE Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus GN=Agxt2 PE=1 SV=1 120 540 1.0E-37
sp|Q94AL9|AGT22_ARATH Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial OS=Arabidopsis thaliana GN=AGT3 PE=1 SV=2 122 543 3.0E-37
sp|Q88RB9|DAVT_PSEPK 5-aminovalerate aminotransferase DavT OS=Pseudomonas putida (strain KT2440) GN=davT PE=1 SV=1 129 537 3.0E-37
sp|Q64565|AGT2_RAT Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Rattus norvegicus GN=Agxt2 PE=1 SV=2 120 540 4.0E-37
sp|P50457|PUUE_ECOLI 4-aminobutyrate aminotransferase PuuE OS=Escherichia coli (strain K12) GN=puuE PE=1 SV=1 131 540 4.0E-37
sp|P56969|Y1815_ARCFU Uncharacterized aminotransferase AF_1815 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1815 PE=3 SV=1 130 541 5.0E-37
sp|P94427|GABT_BACSU Probable 4-aminobutyrate aminotransferase OS=Bacillus subtilis (strain 168) GN=gabT PE=3 SV=1 136 542 6.0E-37
sp|Q9AP34|ECTB_SPOPA Diaminobutyrate--2-oxoglutarate transaminase OS=Sporosarcina pasteurii GN=ectB PE=2 SV=1 132 543 9.0E-37
sp|P40829|GABT_MYCLE 4-aminobutyrate aminotransferase OS=Mycobacterium leprae (strain TN) GN=gabT PE=3 SV=1 129 536 9.0E-37
sp|Q9BYV1|AGT2_HUMAN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Homo sapiens GN=AGXT2 PE=1 SV=1 120 540 1.0E-36
sp|Q7W979|ECTB_BORPA Diaminobutyrate--2-oxoglutarate transaminase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ectB PE=3 SV=1 132 540 2.0E-36
sp|Q7WHI8|ECTB_BORBR Diaminobutyrate--2-oxoglutarate transaminase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ectB PE=3 SV=1 132 540 2.0E-36
sp|Q5RFA3|AGT2_PONAB Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Pongo abelii GN=AGXT2 PE=2 SV=1 120 540 1.0E-35
sp|O06060|ECTB_MARHA Diaminobutyrate--2-oxoglutarate transaminase OS=Marinococcus halophilus GN=ectB PE=3 SV=1 132 543 1.0E-35
sp|Q940M2|AGT21_ARATH Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana GN=AGT2 PE=2 SV=1 122 543 2.0E-35
sp|P31893|OAT_VIGAC Ornithine aminotransferase OS=Vigna aconitifolia PE=2 SV=1 143 483 2.0E-35
sp|Q17QF0|AGT2_BOVIN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Bos taurus GN=AGXT2 PE=2 SV=1 120 540 3.0E-35
sp|Q2FVJ6|BIOA_STAA8 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=bioA PE=3 SV=1 123 540 5.0E-35
sp|P33189|YHXA_BACSU Uncharacterized aminotransferase YhxA OS=Bacillus subtilis (strain 168) GN=yhxA PE=3 SV=4 131 543 1.0E-34
sp|Q829L4|ECTB_STRAW Diaminobutyrate--2-oxoglutarate transaminase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ectB PE=3 SV=1 132 541 3.0E-34
sp|Q93RW1|ECTB_STRCO Diaminobutyrate--2-oxoglutarate transaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ectB PE=3 SV=1 132 541 1.0E-33
sp|Q7XN11|GATP1_ORYSJ Gamma-aminobutyrate transaminase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=OSL2 PE=1 SV=2 131 542 5.0E-33
sp|O52250|ECTB_HALED Diaminobutyrate--2-oxoglutarate transaminase OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=ectB PE=1 SV=1 132 541 1.0E-32
sp|Q01K11|GATP1_ORYSI Gamma-aminobutyrate transaminase 1, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_17385 PE=3 SV=1 131 542 1.0E-32
sp|Q87NZ7|ECTB_VIBPA Diaminobutyrate--2-oxoglutarate transaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ectB PE=3 SV=1 132 543 1.0E-32
sp|P55628|Y4QG_RHISN Uncharacterized aminotransferase y4qG OS=Rhizobium sp. (strain NGR234) GN=NGR_a01910 PE=3 SV=1 132 542 3.0E-32
sp|P14010|GABAT_EMENI 4-aminobutyrate aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gatA PE=3 SV=1 138 543 4.0E-32
sp|Q9KLC2|ECTB_VIBCH Diaminobutyrate--2-oxoglutarate transaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ectB PE=3 SV=1 137 540 6.0E-32
sp|Q6QUY9|ECTB_STRAQ Diaminobutyrate--2-oxoglutarate transaminase OS=Streptomyces anulatus GN=ectB PE=3 SV=1 132 536 9.0E-32
sp|Q9ZEU7|ECTB_CHRSD Diaminobutyrate--2-oxoglutarate transaminase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ectB PE=3 SV=1 132 543 1.0E-31
sp|Q7XN12|GATP2_ORYSJ Probable gamma-aminobutyrate transaminase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=Os04g0614500 PE=2 SV=2 132 542 7.0E-31
sp|Q01K12|GATP2_ORYSI Probable gamma-aminobutyrate transaminase 2, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_17384 PE=3 SV=1 132 542 7.0E-31
sp|Q6ZH29|GATP4_ORYSJ Probable gamma-aminobutyrate transaminase 4 OS=Oryza sativa subsp. japonica GN=GABA-T PE=2 SV=1 129 542 1.0E-30
sp|P44951|DAT_HAEIN Diaminobutyrate--2-oxoglutarate aminotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dat PE=1 SV=1 131 530 2.0E-30
sp|O53379|Y3329_MYCTU Probable aminotransferase Rv3329 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3329 PE=1 SV=2 132 540 2.0E-30
sp|Q74CT9|BIOA_GEOSL Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=bioA PE=3 SV=1 132 543 4.0E-30
sp|Q84P54|GATP1_SOLLC Gamma aminobutyrate transaminase 1, mitochondrial OS=Solanum lycopersicum GN=GABA-TP1 PE=1 SV=1 131 541 6.0E-30
sp|P9WQ77|LAT_MYCTU Probable L-lysine-epsilon aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lat PE=1 SV=1 133 540 2.0E-29
sp|P9WQ76|LAT_MYCTO Probable L-lysine-epsilon aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lat PE=3 SV=1 133 540 2.0E-29
sp|P63510|LAT_MYCBO Probable L-lysine-epsilon aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lat PE=3 SV=1 133 540 2.0E-29
sp|Q7SY54|AT2L1_DANRE Ethanolamine-phosphate phospho-lyase OS=Danio rerio GN=etnppl PE=2 SV=1 137 543 1.0E-28
sp|Q84P53|GATP2_SOLLC Gamma aminobutyrate transaminase 2 OS=Solanum lycopersicum GN=GABA-TP2 PE=1 SV=1 131 541 1.0E-28
sp|Q94CE5|GATP_ARATH Gamma-aminobutyrate transaminase POP2, mitochondrial OS=Arabidopsis thaliana GN=POP2 PE=1 SV=1 131 542 1.0E-28
sp|Q9Z3R2|RHBA_RHIME Diaminobutyrate--2-oxoglutarate aminotransferase OS=Rhizobium meliloti (strain 1021) GN=rhbA PE=3 SV=1 112 543 2.0E-28
sp|P22805|BIOA_LYSSH Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Lysinibacillus sphaericus GN=bioA PE=1 SV=1 118 444 3.0E-28
sp|Q84P52|GATP3_SOLLC Gamma aminobutyrate transaminase 3, chloroplastic OS=Solanum lycopersicum GN=GABA-TP3 PE=1 SV=1 131 541 4.0E-28
sp|P16932|DGDA_BURCE 2,2-dialkylglycine decarboxylase OS=Burkholderia cepacia GN=dgdA PE=1 SV=3 131 541 5.0E-28
sp|B8BBZ7|GATP3_ORYSI Probable gamma-aminobutyrate transaminase 3, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_28220 PE=3 SV=1 131 542 1.0E-27
sp|P9WQ79|GABT_MYCTU 4-aminobutyrate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gabT PE=1 SV=1 129 543 2.0E-27
sp|P9WQ78|GABT_MYCTO 4-aminobutyrate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gabT PE=3 SV=1 129 543 2.0E-27
sp|P63505|GABT_MYCBO 4-aminobutyrate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gabT PE=3 SV=1 129 543 2.0E-27
sp|Q6ZCF0|GATP3_ORYSJ Probable gamma-aminobutyrate transaminase 3, mitochondrial OS=Oryza sativa subsp. japonica GN=Os08g0205900 PE=3 SV=1 131 542 3.0E-27
sp|O66998|GSA_AQUAE Glutamate-1-semialdehyde 2,1-aminomutase OS=Aquifex aeolicus (strain VF5) GN=hemL PE=3 SV=1 110 493 4.0E-27
sp|O13837|GABAT_SCHPO 4-aminobutyrate aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uga1 PE=1 SV=1 138 537 5.0E-27
sp|A6Q2X6|GSA_NITSB Glutamate-1-semialdehyde 2,1-aminomutase OS=Nitratiruptor sp. (strain SB155-2) GN=hemL PE=3 SV=1 110 503 5.0E-27
sp|Q97B25|GSA_THEVO Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hemL PE=3 SV=1 119 490 1.0E-26
sp|Q6DEB1|AT2L1_XENLA Ethanolamine-phosphate phospho-lyase OS=Xenopus laevis GN=etnppl PE=2 SV=1 126 543 5.0E-26
sp|Q58696|BIOA_METJA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=bioA PE=3 SV=2 131 541 5.0E-26
sp|O34662|YODT_BACSU Uncharacterized aminotransferase YodT OS=Bacillus subtilis (strain 168) GN=yodT PE=3 SV=1 132 543 6.0E-26
sp|Q728P4|BIOA_DESVH Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=bioA PE=3 SV=1 132 543 7.0E-26
sp|Q6L2G9|GSA_PICTO Glutamate-1-semialdehyde 2,1-aminomutase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=hemL PE=3 SV=1 132 493 1.0E-25
sp|A8ETJ2|GSA_ARCB4 Glutamate-1-semialdehyde 2,1-aminomutase OS=Arcobacter butzleri (strain RM4018) GN=hemL PE=3 SV=1 110 492 1.0E-25
sp|O66557|BIOA_AQUAE Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=bioA PE=3 SV=1 123 543 2.0E-25
sp|P17649|GABAT_YEAST 4-aminobutyrate aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA1 PE=1 SV=2 85 543 2.0E-25
sp|Q21217|GABT_CAEEL Probable 4-aminobutyrate aminotransferase, mitochondrial OS=Caenorhabditis elegans GN=gta-1 PE=3 SV=1 138 543 2.0E-25
sp|Q8BWU8|AT2L1_MOUSE Ethanolamine-phosphate phospho-lyase OS=Mus musculus GN=Etnppl PE=2 SV=1 136 543 2.0E-25
sp|Q9VU95|AGT2L_DROME Alanine--glyoxylate aminotransferase 2-like OS=Drosophila melanogaster GN=CG8745 PE=2 SV=2 133 530 3.0E-25
sp|Q8TBG4|AT2L1_HUMAN Ethanolamine-phosphate phospho-lyase OS=Homo sapiens GN=ETNPPL PE=1 SV=1 140 543 4.0E-25
sp|Q9APM5|TPA_BILWA Taurine--pyruvate aminotransferase OS=Bilophila wadsworthia GN=tpa PE=1 SV=1 132 543 1.0E-24
sp|C3N842|GSA_SULIY Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=hemL PE=3 SV=1 119 467 1.0E-24
sp|C3NF69|GSA_SULIN Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=hemL PE=3 SV=1 119 467 1.0E-24
sp|C3MJ22|GSA_SULIL Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=hemL PE=3 SV=1 119 467 1.0E-24
sp|C4KJ00|GSA_SULIK Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=hemL PE=3 SV=1 119 467 1.0E-24
sp|C3MYE0|GSA_SULIM Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=hemL PE=3 SV=1 119 467 2.0E-24
sp|C3MZR9|GSA_SULIA Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain M.16.27) GN=hemL PE=3 SV=1 119 467 2.0E-24
sp|Q5E9S4|AT2L1_BOVIN Ethanolamine-phosphate phospho-lyase OS=Bos taurus GN=ETNPPL PE=2 SV=1 139 543 2.0E-24
sp|A4IXN8|GSA_FRATW Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=hemL PE=3 SV=1 129 493 3.0E-24
sp|A4SGT2|GSA_CHLPM Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hemL PE=3 SV=1 97 458 3.0E-24
sp|Q9US34|YFZ7_SCHPO Uncharacterized aminotransferase C1039.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.07c PE=3 SV=1 132 540 4.0E-24
sp|Q5NGB9|GSA_FRATT Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=hemL PE=3 SV=1 129 493 5.0E-24
sp|Q14HS1|GSA_FRAT1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=hemL PE=3 SV=1 129 493 5.0E-24
sp|Q6CJ86|GABAT_KLULA 4-aminobutyrate aminotransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F20548g PE=3 SV=1 85 543 5.0E-24
sp|Q4L706|GSA2_STAHJ Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hemL2 PE=3 SV=1 129 485 5.0E-24
sp|A0RQ51|GSA_CAMFF Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hemL PE=3 SV=1 110 479 6.0E-24
sp|Q9PP70|GSA_CAMJE Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hemL PE=3 SV=1 99 435 7.0E-24
sp|B7GHM5|BIOA_ANOFW Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=bioA PE=3 SV=1 126 540 8.0E-24
sp|P49604|GABAT_USTMA 4-aminobutyrate aminotransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GATA PE=2 SV=2 131 543 9.0E-24
sp|Q980U5|GSA_SULSO Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hemL PE=1 SV=2 119 467 9.0E-24
sp|P56744|DAT_ACIBA Diaminobutyrate--2-oxoglutarate aminotransferase OS=Acinetobacter baumannii GN=dat PE=1 SV=1 131 495 1.0E-23
sp|B9LA83|GSA_NAUPA Glutamate-1-semialdehyde 2,1-aminomutase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=hemL PE=3 SV=1 125 492 1.0E-23
sp|E1V7V7|DOED_HALED Diaminobutyrate--2-oxoglutarate transaminase OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=doeD PE=3 SV=1 129 540 1.0E-23
sp|B0U0T6|GSA_FRAP2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=hemL PE=3 SV=1 129 493 2.0E-23
sp|A0Q628|GSA_FRATN Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. novicida (strain U112) GN=hemL PE=3 SV=1 129 493 2.0E-23
sp|Q0BLC7|GSA_FRATO Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=hemL PE=3 SV=1 129 493 2.0E-23
sp|A7NCX8|GSA_FRATF Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=hemL PE=3 SV=1 129 493 2.0E-23
sp|B3EKJ7|GSA_CHLPB Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium phaeobacteroides (strain BS1) GN=hemL PE=3 SV=1 110 460 2.0E-23
sp|Q5HUU3|GSA_CAMJR Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter jejuni (strain RM1221) GN=hemL PE=3 SV=1 125 435 2.0E-23
sp|A7H3N1|GSA_CAMJD Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=hemL PE=3 SV=1 125 435 2.0E-23
sp|A1VZJ6|GSA_CAMJJ Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hemL PE=3 SV=1 125 435 2.0E-23
sp|A8FLR2|GSA_CAMJ8 Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=hemL PE=3 SV=1 125 435 2.0E-23
sp|Q3SFU6|GSA_THIDA Glutamate-1-semialdehyde 2,1-aminomutase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hemL PE=3 SV=1 110 462 3.0E-23
sp|Q2A2U8|GSA_FRATH Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=hemL PE=3 SV=1 129 493 3.0E-23
sp|B2SGG7|GSA_FRATM Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=hemL PE=3 SV=1 129 493 3.0E-23
sp|Q8R1K4|AT2L2_MOUSE 5-phosphohydroxy-L-lysine phospho-lyase OS=Mus musculus GN=Phykpl PE=1 SV=1 136 543 6.0E-23
sp|Q53196|Y4UB_RHISN Uncharacterized aminotransferase y4uB OS=Rhizobium sp. (strain NGR234) GN=NGR_a01380 PE=3 SV=1 112 543 6.0E-23
sp|B6J495|GSA_COXB1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Coxiella burnetii (strain CbuK_Q154) GN=hemL PE=3 SV=1 129 492 7.0E-23
sp|Q83AK3|GSA_COXBU Glutamate-1-semialdehyde 2,1-aminomutase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=hemL PE=3 SV=1 129 492 8.0E-23
sp|A9NAX3|GSA_COXBR Glutamate-1-semialdehyde 2,1-aminomutase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=hemL PE=3 SV=1 129 492 8.0E-23
sp|A5N5Y1|GSA_CLOK5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=hemL PE=3 SV=1 106 467 9.0E-23
sp|B9DZG0|GSA_CLOK1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium kluyveri (strain NBRC 12016) GN=hemL PE=3 SV=2 106 467 9.0E-23
sp|B4S3Q6|GSA_PROA2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hemL PE=3 SV=1 124 460 9.0E-23
sp|P80404|GABT_HUMAN 4-aminobutyrate aminotransferase, mitochondrial OS=Homo sapiens GN=ABAT PE=1 SV=3 65 540 1.0E-22
sp|Q3B1A1|GSA_CHLL7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hemL PE=3 SV=1 103 458 1.0E-22
sp|P18492|GSA_HORVU Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Hordeum vulgare GN=GSA PE=1 SV=3 131 459 1.0E-22
sp|A6URL2|GSA_METVS Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hemL PE=3 SV=1 119 460 1.0E-22
sp|A9KBA0|GSA_COXBN Glutamate-1-semialdehyde 2,1-aminomutase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=hemL PE=3 SV=1 129 492 1.0E-22
sp|Q97MU2|GSA_CLOAB Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hemL PE=3 SV=1 132 444 1.0E-22
sp|B6J3H2|GSA_COXB2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Coxiella burnetii (strain CbuG_Q212) GN=hemL PE=3 SV=1 129 459 2.0E-22
sp|Q4JAM7|GSA_SULAC Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hemL PE=3 SV=1 119 508 2.0E-22
sp|Q8IUZ5|AT2L2_HUMAN 5-phosphohydroxy-L-lysine phospho-lyase OS=Homo sapiens GN=PHYKPL PE=1 SV=1 136 543 3.0E-22
sp|Q30RJ4|GSA_SULDN Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hemL PE=3 SV=1 110 509 3.0E-22
sp|O94562|YGD3_SCHPO Uncharacterized aminotransferase C1771.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.03c PE=3 SV=1 128 536 3.0E-22
sp|P80147|GABT_PIG 4-aminobutyrate aminotransferase, mitochondrial OS=Sus scrofa GN=ABAT PE=1 SV=2 137 540 4.0E-22
sp|Q7W3U1|GSA_BORPA Glutamate-1-semialdehyde 2,1-aminomutase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hemL PE=3 SV=1 108 463 4.0E-22
sp|C0ZAH4|GSA2_BREBN Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hemL2 PE=3 SV=1 124 462 4.0E-22
sp|A7I252|GSA_CAMHC Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=hemL PE=3 SV=1 110 507 4.0E-22
sp|P50554|GABT_RAT 4-aminobutyrate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Abat PE=1 SV=3 68 540 5.0E-22
sp|B5YHH6|GSA_THEYD Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=hemL PE=3 SV=1 110 463 5.0E-22
sp|A6VIL1|GSA_METM7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hemL PE=3 SV=1 119 460 6.0E-22
sp|B1I4L1|GSA_DESAP Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulforudis audaxviator (strain MP104C) GN=hemL PE=3 SV=1 110 462 7.0E-22
sp|B3EI07|GSA_CHLL2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hemL PE=3 SV=1 124 458 8.0E-22
sp|Q42522|GSA2_ARATH Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic OS=Arabidopsis thaliana GN=GSA2 PE=2 SV=2 132 458 9.0E-22
sp|Q8D3C8|GSA_WIGBR Glutamate-1-semialdehyde 2,1-aminomutase OS=Wigglesworthia glossinidia brevipalpis GN=hemL PE=3 SV=1 119 463 9.0E-22
sp|B4U8M6|GSA_HYDS0 Glutamate-1-semialdehyde 2,1-aminomutase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=hemL PE=3 SV=1 110 474 1.0E-21
sp|Q8RFY7|GSA_FUSNN Glutamate-1-semialdehyde 2,1-aminomutase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=hemL PE=3 SV=1 110 469 1.0E-21
sp|Q8KAQ7|GSA_CHLTE Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hemL PE=3 SV=1 124 458 1.0E-21
sp|A7GXK4|GSA_CAMC5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter curvus (strain 525.92) GN=hemL PE=3 SV=1 132 479 1.0E-21
sp|P61922|GABT_MOUSE 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus GN=Abat PE=1 SV=1 100 540 2.0E-21
sp|Q55FI1|GABT_DICDI 4-aminobutyrate aminotransferase OS=Dictyostelium discoideum GN=gabT PE=3 SV=1 134 543 2.0E-21
sp|E1WTS4|BIOAB_BACF6 Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain 638R) GN=bioB PE=3 SV=1 219 543 2.0E-21
sp|Q10174|YAV5_SCHPO Uncharacterized aminotransferase C27F1.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27F1.05c PE=3 SV=1 228 540 2.0E-21
sp|B5Y1L5|GSA_KLEP3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Klebsiella pneumoniae (strain 342) GN=hemL PE=3 SV=1 110 492 4.0E-21
sp|Q31FB1|GSA_THICR Glutamate-1-semialdehyde 2,1-aminomutase OS=Thiomicrospira crunogena (strain XCL-2) GN=hemL PE=3 SV=1 110 463 4.0E-21
sp|A1BJG8|GSA_CHLPD Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hemL PE=3 SV=1 124 458 5.0E-21
sp|D5AKY0|TPA_RHOCB Taurine--pyruvate aminotransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=tpa PE=2 SV=1 132 543 6.0E-21
sp|B2JED5|GSA_BURP8 Glutamate-1-semialdehyde 2,1-aminomutase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hemL PE=3 SV=1 96 502 6.0E-21
sp|A7NKV1|GSA_ROSCS Glutamate-1-semialdehyde 2,1-aminomutase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=hemL PE=3 SV=1 110 458 6.0E-21
sp|B9MRJ7|GSA_CALBD Glutamate-1-semialdehyde 2,1-aminomutase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=hemL PE=3 SV=1 132 462 6.0E-21
sp|A1WYL3|GSA_HALHL Glutamate-1-semialdehyde 2,1-aminomutase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hemL PE=3 SV=1 110 463 7.0E-21
sp|A4J6H0|GSA_DESRM Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfotomaculum reducens (strain MI-1) GN=hemL PE=3 SV=1 95 462 7.0E-21
sp|P45621|GSA_SOYBN Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Glycine max GN=GSA1 PE=2 SV=1 110 462 7.0E-21
sp|P44426|BIOA_HAEIN Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bioA PE=3 SV=1 129 543 7.0E-21
sp|Q40147|GSA_SOLLC Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 132 460 7.0E-21
sp|Q7WF71|GSA_BORBR Glutamate-1-semialdehyde 2,1-aminomutase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hemL PE=3 SV=1 108 463 7.0E-21
sp|A4YD91|GSA_METS5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hemL PE=3 SV=1 119 467 7.0E-21
sp|Q64VX4|BIOAB_BACFR Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain YCH46) GN=bioB PE=3 SV=1 219 543 8.0E-21
sp|Q0TQG7|GSA_CLOP1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=hemL PE=3 SV=1 132 444 8.0E-21
sp|A4XK09|GSA_CALS8 Glutamate-1-semialdehyde 2,1-aminomutase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hemL PE=3 SV=1 132 452 8.0E-21
sp|Q3AP59|GSA_CHLCH Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium chlorochromatii (strain CaD3) GN=hemL PE=3 SV=1 124 463 9.0E-21
sp|Q92BG1|GSA1_LISIN Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hemL1 PE=3 SV=1 100 493 9.0E-21
sp|Q5LEY1|BIOAB_BACFN Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=bioB PE=3 SV=1 219 543 9.0E-21
sp|Q85WB7|GSA_BRANA Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Brassica napus GN=GSA PE=2 SV=1 137 458 1.0E-20
sp|A4FZY1|GSA_METM5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hemL PE=3 SV=1 119 452 1.0E-20
sp|Q6M0P5|GSA_METMP Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus maripaludis (strain S2 / LL) GN=hemL PE=3 SV=1 119 452 1.0E-20
sp|B4SGW1|GSA_PELPB Glutamate-1-semialdehyde 2,1-aminomutase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hemL PE=3 SV=1 124 458 1.0E-20
sp|Q5UZ90|GSA_HALMA Glutamate-1-semialdehyde 2,1-aminomutase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hemL PE=3 SV=1 131 488 2.0E-20
sp|P31593|GSA_TOBAC Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Nicotiana tabacum GN=GSA PE=2 SV=1 66 460 2.0E-20
sp|Q7M847|GSA_WOLSU Glutamate-1-semialdehyde 2,1-aminomutase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hemL PE=3 SV=1 110 507 2.0E-20
sp|B9DND8|GSA1_STACT Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus carnosus (strain TM300) GN=hemL1 PE=3 SV=1 129 443 2.0E-20
sp|A9A875|GSA_METM6 Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hemL PE=3 SV=1 119 452 2.0E-20
sp|A0LXY3|GSA_GRAFK Glutamate-1-semialdehyde 2,1-aminomutase OS=Gramella forsetii (strain KT0803) GN=hemL PE=3 SV=1 110 463 2.0E-20
sp|B8G2L6|GSA_DESHD Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hemL PE=3 SV=1 128 467 2.0E-20
sp|Q7W050|GSA_BORPE Glutamate-1-semialdehyde 2,1-aminomutase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hemL PE=3 SV=1 108 463 2.0E-20
sp|A9B550|GSA_HERA2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=hemL PE=3 SV=1 129 460 2.0E-20
sp|B1X023|GSA_CYAA5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Cyanothece sp. (strain ATCC 51142) GN=hemL PE=3 SV=2 84 467 2.0E-20
sp|Q2NF42|GSA_METST Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hemL PE=3 SV=1 110 458 2.0E-20
sp|P0C2D9|GSA_CLOPE Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium perfringens (strain 13 / Type A) GN=hemL PE=3 SV=1 132 444 3.0E-20
sp|A7MGR5|GSA_CROS8 Glutamate-1-semialdehyde 2,1-aminomutase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=hemL PE=3 SV=1 110 462 3.0E-20
sp|C6AR33|GSA_TERTT Glutamate-1-semialdehyde 2,1-aminomutase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=hemL PE=3 SV=1 110 467 3.0E-20
sp|A0B885|GSA_METTP Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=hemL PE=3 SV=1 86 464 3.0E-20
sp|B3QSA6|GSA_CHLT3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hemL PE=3 SV=1 110 463 4.0E-20
sp|Q7UPM9|GSA_RHOBA Glutamate-1-semialdehyde 2,1-aminomutase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hemL PE=3 SV=1 110 492 4.0E-20
sp|Q8CNZ1|GSA1_STAES Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hemL1 PE=3 SV=1 129 485 4.0E-20
sp|Q5HNN6|GSA1_STAEQ Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hemL1 PE=3 SV=1 129 485 4.0E-20
sp|A5D3M2|GSA_PELTS Glutamate-1-semialdehyde 2,1-aminomutase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hemL PE=3 SV=1 110 542 4.0E-20
sp|B3QRD2|GSA_CHLP8 Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hemL PE=3 SV=1 124 458 5.0E-20
sp|C1DUY4|GSA_SULAA Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfurihydrogenibium azorense (strain Az-Fu1 / DSM 15241 / OCM 825) GN=hemL PE=3 SV=1 133 502 5.0E-20
sp|A6T4V8|GSA_KLEP7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hemL PE=3 SV=1 110 492 5.0E-20
sp|A4IRG2|GSA2_GEOTN Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hemL2 PE=3 SV=1 133 493 5.0E-20
sp|Q6YZE2|GSA_ORYSJ Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Oryza sativa subsp. japonica GN=GSA PE=2 SV=1 132 459 5.0E-20
sp|P91408|AGT2L_CAEEL Alanine--glyoxylate aminotransferase 2-like OS=Caenorhabditis elegans GN=T01B11.2 PE=3 SV=1 126 540 5.0E-20
sp|Q58020|GSA_METJA Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hemL PE=3 SV=2 119 543 6.0E-20
sp|Q1GXW0|GSA_METFK Glutamate-1-semialdehyde 2,1-aminomutase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hemL PE=3 SV=1 110 462 6.0E-20
sp|Q8A7T2|BIOAB_BACTN Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=bioB PE=3 SV=2 219 529 6.0E-20
sp|B7GH35|GSA2_ANOFW Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hemL2 PE=3 SV=2 110 493 7.0E-20
sp|B7K2I1|GSA_CYAP8 Glutamate-1-semialdehyde 2,1-aminomutase OS=Cyanothece sp. (strain PCC 8801) GN=hemL PE=3 SV=1 110 467 7.0E-20
sp|C0QQ98|GSA_PERMH Glutamate-1-semialdehyde 2,1-aminomutase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=hemL PE=3 SV=1 133 508 7.0E-20
sp|Q9HKM6|GSA_THEAC Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hemL PE=3 SV=2 119 473 7.0E-20
sp|Q24VD4|GSA_DESHY Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfitobacterium hafniense (strain Y51) GN=hemL PE=3 SV=1 128 467 8.0E-20
sp|B2J7M9|GSA_NOSP7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=hemL PE=3 SV=1 110 467 9.0E-20
sp|A6UWB3|GSA_META3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hemL PE=3 SV=1 119 444 9.0E-20
sp|P53555|BIOK_BACSU L-Lysine--8-amino-7-oxononanoate transaminase OS=Bacillus subtilis (strain 168) GN=bioK PE=1 SV=1 126 540 9.0E-20
sp|P42799|GSA1_ARATH Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic OS=Arabidopsis thaliana GN=GSA1 PE=2 SV=1 137 458 9.0E-20
sp|B2UX41|GSA_CLOBA Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hemL PE=3 SV=1 132 444 9.0E-20
sp|P53656|BIOA_ESCVU Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Escherichia vulneris GN=bioA PE=3 SV=1 206 529 1.0E-19
sp|B9L0Q2|GSA_THERP Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=hemL PE=3 SV=1 119 474 1.0E-19
sp|Q2YTC2|GSA1_STAAB Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hemL1 PE=3 SV=1 129 443 1.0E-19
sp|Q7VHK3|GSA_HELHP Glutamate-1-semialdehyde 2,1-aminomutase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hemL PE=3 SV=1 110 493 1.0E-19
sp|Q5X529|GSA_LEGPA Glutamate-1-semialdehyde 2,1-aminomutase OS=Legionella pneumophila (strain Paris) GN=hemL PE=3 SV=1 110 462 1.0E-19
sp|Q5ZVA6|GSA_LEGPH Glutamate-1-semialdehyde 2,1-aminomutase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hemL PE=3 SV=2 110 462 1.0E-19
sp|Q6GG38|GSA1_STAAR Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain MRSA252) GN=hemL1 PE=3 SV=1 129 443 1.0E-19
sp|A6Q9P9|GSA_SULNB Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfurovum sp. (strain NBC37-1) GN=hemL PE=3 SV=1 110 507 1.0E-19
sp|P99096|GSA1_STAAN Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain N315) GN=hemL1 PE=1 SV=1 129 443 1.0E-19
sp|P63508|GSA1_STAAM Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hemL1 PE=3 SV=1 129 443 1.0E-19
sp|A5ITJ2|GSA1_STAA9 Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain JH9) GN=hemL1 PE=3 SV=1 129 443 1.0E-19
sp|A6U2D5|GSA1_STAA2 Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain JH1) GN=hemL1 PE=3 SV=1 129 443 1.0E-19
sp|A7X388|GSA1_STAA1 Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hemL1 PE=3 SV=1 129 443 1.0E-19
sp|A5CXH8|GSA_VESOH Glutamate-1-semialdehyde 2,1-aminomutase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hemL PE=3 SV=1 133 469 2.0E-19
sp|A5UU40|GSA_ROSS1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Roseiflexus sp. (strain RS-1) GN=hemL PE=3 SV=1 110 458 2.0E-19
sp|Q2S8X9|GSA_HAHCH Glutamate-1-semialdehyde 2,1-aminomutase OS=Hahella chejuensis (strain KCTC 2396) GN=hemL PE=3 SV=1 110 463 2.0E-19
sp|Q11WK1|GSA_CYTH3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hemL PE=3 SV=1 110 463 2.0E-19
sp|Q8NW75|GSA1_STAAW Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain MW2) GN=hemL1 PE=3 SV=1 129 443 2.0E-19
sp|Q6G8Q8|GSA1_STAAS Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain MSSA476) GN=hemL1 PE=3 SV=1 129 443 2.0E-19
sp|B9KFS8|GSA_CAMLR Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=hemL PE=3 SV=1 118 474 2.0E-19
sp|O25627|BIOA_HELPY Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=bioA PE=3 SV=1 119 543 2.0E-19
sp|A6TJD8|GSA_ALKMQ Glutamate-1-semialdehyde 2,1-aminomutase OS=Alkaliphilus metalliredigens (strain QYMF) GN=hemL PE=3 SV=1 72 467 2.0E-19
sp|Q9K8G3|GSA2_BACHD Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hemL2 PE=3 SV=1 110 444 2.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0008483 transaminase activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0003674 molecular_function No
GO:0016769 transferase activity, transferring nitrogenous groups No
GO:0070279 vitamin B6 binding No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0019842 vitamin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|075000
MLCMLGFTLARCWPVLVVNAHTPFLSLPSLSARRNIVLGLCCQRQQRGAASIIFTMHRHTSSRSLSAVVRGRRSL
AGYPPCIRLLSTTSWSLPNAPSTKYVKPTHKFSSPGDLSSKVPNAPLLPVYARPEFVLSHGKGSYIWDTEGRKYL
DFSAGIAVNALGHADEGVLKVLNEQASKLIHTSNVYHNEWAPKLASLLVQITQLEGGLGYAPNHKSTTPPNGLQV
FFSNSGTEANEGALKIARKVGKERWSLKNGKAWDTPPGSEQCTKTKIVCFENAFHGRSMGSLSVTTNPKYQAPFA
PLLPGVSVGQLNDANALEGLVTEDTCAVIVEPIQGEGGINMAKTEWLVQLRKRCNDVGAVLIFDEIQCGLYRTGT
LWAHSSLPVEAHPDMLTMAKPLANGYPIGAILLRDAVANTMTPGTHGTTFGGSPLACAIGHHVLSRLSDPGVKSQ
LKNTSAYLVERLQLLTKWFPQHLQPTVRGRGLILGLGFKNPEVPAKIVALARERGVFVLTAGKDVVRLVPSLNIG
KEEVDLAVEVLEGALKAL*
Coding >AgabiH97|075000
ATGTTATGTATGCTTGGTTTCACTTTGGCTCGTTGTTGGCCCGTCCTAGTAGTTAACGCTCATACACCCTTTCTC
TCCCTCCCTTCATTATCCGCGCGTCGGAACATTGTTTTGGGATTGTGTTGTCAACGGCAACAACGTGGCGCGGCC
TCGATCATTTTTACCATGCACCGACATACTTCTTCTCGTTCGCTTTCTGCGGTAGTCCGCGGCCGTCGAAGCTTG
GCAGGATACCCACCTTGCATTCGTCTACTTTCGACGACGTCGTGGTCACTTCCTAATGCTCCCAGCACTAAATAC
GTGAAACCGACACATAAGTTCTCTAGTCCTGGTGACTTGAGTAGTAAAGTTCCCAACGCTCCACTTCTTCCGGTT
TATGCTCGGCCTGAGTTTGTGTTATCCCATGGGAAAGGATCGTATATCTGGGATACGGAGGGAAGGAAGTACCTC
GATTTCTCTGCTGGTATTGCTGTGAACGCGTTGGGTCATGCTGATGAAGGTGTTCTAAAGGTTCTCAATGAACAA
GCGTCAAAGCTCATCCATACGAGTAACGTGTACCACAACGAATGGGCACCTAAACTAGCTTCCCTCCTCGTACAA
ATCACTCAACTCGAAGGTGGTCTCGGTTACGCACCCAACCATAAATCTACCACACCTCCCAACGGACTCCAAGTC
TTCTTCTCCAATTCCGGTACAGAAGCCAACGAAGGTGCTCTCAAAATTGCTCGTAAAGTCGGAAAAGAACGCTGG
TCGTTAAAAAATGGCAAAGCATGGGATACACCACCAGGATCAGAACAATGCACTAAAACCAAGATTGTGTGTTTT
GAAAATGCGTTTCATGGAAGGAGTATGGGTTCTCTTAGTGTGACGACGAATCCGAAATACCAAGCGCCATTTGCT
CCGCTTTTGCCTGGGGTGTCTGTTGGTCAATTGAACGATGCAAATGCGTTGGAGGGATTGGTCACGGAAGATACT
TGTGCAGTTATTGTTGAACCTATACAAGGAGAAGGTGGGATCAACATGGCAAAGACGGAGTGGCTCGTTCAATTG
AGAAAGAGATGCAATGACGTTGGTGCGGTACTGATTTTCGATGAAATTCAGTGTGGTCTATACAGGACGGGCACT
TTATGGGCTCATTCATCTCTACCCGTCGAAGCGCATCCTGATATGCTGACTATGGCCAAACCACTCGCGAACGGC
TACCCCATTGGTGCCATCCTTCTCCGTGATGCGGTCGCCAACACAATGACTCCCGGAACTCATGGAACTACCTTT
GGAGGCTCGCCACTTGCTTGCGCAATCGGCCATCACGTCCTCAGTCGACTTTCCGACCCCGGAGTTAAATCACAA
TTAAAAAATACCAGCGCATATCTCGTCGAGCGCCTACAACTTCTCACAAAGTGGTTCCCTCAACATTTACAACCT
ACCGTGCGGGGCCGCGGTCTTATCTTGGGGCTTGGGTTCAAGAATCCCGAAGTGCCTGCAAAGATTGTTGCTCTT
GCGAGAGAGAGGGGTGTATTTGTGTTGACGGCTGGAAAGGATGTTGTGAGGCTGGTACCGAGTTTGAATATTGGG
AAGGAAGAAGTGGATTTGGCTGTGGAAGTGCTTGAAGGTGCTTTGAAAGCGTTGTGA
Transcript >AgabiH97|075000
ATGTTATGTATGCTTGGTTTCACTTTGGCTCGTTGTTGGCCCGTCCTAGTAGTTAACGCTCATACACCCTTTCTC
TCCCTCCCTTCATTATCCGCGCGTCGGAACATTGTTTTGGGATTGTGTTGTCAACGGCAACAACGTGGCGCGGCC
TCGATCATTTTTACCATGCACCGACATACTTCTTCTCGTTCGCTTTCTGCGGTAGTCCGCGGCCGTCGAAGCTTG
GCAGGATACCCACCTTGCATTCGTCTACTTTCGACGACGTCGTGGTCACTTCCTAATGCTCCCAGCACTAAATAC
GTGAAACCGACACATAAGTTCTCTAGTCCTGGTGACTTGAGTAGTAAAGTTCCCAACGCTCCACTTCTTCCGGTT
TATGCTCGGCCTGAGTTTGTGTTATCCCATGGGAAAGGATCGTATATCTGGGATACGGAGGGAAGGAAGTACCTC
GATTTCTCTGCTGGTATTGCTGTGAACGCGTTGGGTCATGCTGATGAAGGTGTTCTAAAGGTTCTCAATGAACAA
GCGTCAAAGCTCATCCATACGAGTAACGTGTACCACAACGAATGGGCACCTAAACTAGCTTCCCTCCTCGTACAA
ATCACTCAACTCGAAGGTGGTCTCGGTTACGCACCCAACCATAAATCTACCACACCTCCCAACGGACTCCAAGTC
TTCTTCTCCAATTCCGGTACAGAAGCCAACGAAGGTGCTCTCAAAATTGCTCGTAAAGTCGGAAAAGAACGCTGG
TCGTTAAAAAATGGCAAAGCATGGGATACACCACCAGGATCAGAACAATGCACTAAAACCAAGATTGTGTGTTTT
GAAAATGCGTTTCATGGAAGGAGTATGGGTTCTCTTAGTGTGACGACGAATCCGAAATACCAAGCGCCATTTGCT
CCGCTTTTGCCTGGGGTGTCTGTTGGTCAATTGAACGATGCAAATGCGTTGGAGGGATTGGTCACGGAAGATACT
TGTGCAGTTATTGTTGAACCTATACAAGGAGAAGGTGGGATCAACATGGCAAAGACGGAGTGGCTCGTTCAATTG
AGAAAGAGATGCAATGACGTTGGTGCGGTACTGATTTTCGATGAAATTCAGTGTGGTCTATACAGGACGGGCACT
TTATGGGCTCATTCATCTCTACCCGTCGAAGCGCATCCTGATATGCTGACTATGGCCAAACCACTCGCGAACGGC
TACCCCATTGGTGCCATCCTTCTCCGTGATGCGGTCGCCAACACAATGACTCCCGGAACTCATGGAACTACCTTT
GGAGGCTCGCCACTTGCTTGCGCAATCGGCCATCACGTCCTCAGTCGACTTTCCGACCCCGGAGTTAAATCACAA
TTAAAAAATACCAGCGCATATCTCGTCGAGCGCCTACAACTTCTCACAAAGTGGTTCCCTCAACATTTACAACCT
ACCGTGCGGGGCCGCGGTCTTATCTTGGGGCTTGGGTTCAAGAATCCCGAAGTGCCTGCAAAGATTGTTGCTCTT
GCGAGAGAGAGGGGTGTATTTGTGTTGACGGCTGGAAAGGATGTTGTGAGGCTGGTACCGAGTTTGAATATTGGG
AAGGAAGAAGTGGATTTGGCTGTGGAAGTGCTTGAAGGTGCTTTGAAAGCGTTGTGA
Gene >AgabiH97|075000
ATGTTATGTATGCTTGGTTTCACTTTGGCTCGTTGTTGGCCCGTCCTAGTAGTTAACGCTCATACACCGTGCGCT
TTTTACGCCATTTGTATAACGATGTTTTGAGAACTCTTGGGTAGTGATGCCAATGCATAATTGAATAGTAGTACC
TCGAAGGTATAAAGGCTGGCAGTTTCGTCCAGCTTTCTCTCCCTCCCTTCATTATCCGCGCGTCGGAACATTGTT
TTGGGATTGTGTTGTCAACGGCAACAACGTGGGTGAGCTATTATTATCTTATCAATTGACATCGGGGACATACGG
TCTGTTTAGCGCGGCCTCGATCATTTTTACCATGCACCGACATACTTCTTCTCGTTCGCTTTCTGCGGTAGTCCG
CGGCCGTCGAAGCTTGGCAGGATACCCACCTTGCATTCGTCTACTTTCGGTAGGTCAATCCATACGTTATTTCAG
TAGGAACCAACATTTTGATATAAGATTTTTTCGTTGAACAGACGACGTCGTGGTCACTTCCTAATGCTCCCAGCA
CTAAATACGTGAAACCGACACATAAGTTCTCTAGTCCTGGTGACTTGAGTAGTAAAGTTCCCAACGCTCCACTTC
TTCCGGTTTATGCTCGGCCTGAGTTTGTGTTATCCCATGGGAAAGGATCGTATATCTGGGATACGGAGGGAAGGA
AGTACCTCGATTTCTCTGCTGGTATTGCTGTGAACGCGTTGGGTCATGCTGATGAAGGTGTTCTAAAGGTATGTA
TATCGTTATATCCATGTAAAATTTCTTGAAGTCGTTAAAGCGCCAACTAGGTTCTCAATGAACAAGCGTCAAAGC
TCATCCATACGAGTAACGTGTACCACAACGAATGGGCACCTAAACTAGCTTCCCTCCTCGTACAAATCACTCAAC
TCGAAGGTGGTCTCGGTTACGCACCCAACCATAAATCTACCACACCTCCCAACGGACTCCAAGTCTTCTTCTCCA
ATTCCGGTACAGAAGCCAACGAAGGTGCTCTCAAAATTGCTCGTAAAGTCGGAAAAGAACGCTGGTCGTTAAAAA
ATGGCAAAGCATGGGATACACCACCAGGATCAGAACAATGCACTAAAACCAAGATTGTGTGTTTTGAAAATGCGT
TTCATGGAAGGAGTATGGGTTCTCTTAGTGTGACGACGAATCCGAAATACCAAGCGCCATTTGCTCCGCTTTTGC
CTGGGGTGTCTGTTGGTCAATTGAACGATGCAAATGCGTTGGAGGGATTGGTCACGGAAGATACTTGTGCAGTTA
TTGTTGAACCTATACAAGGAGAAGGTGGGATCAACATGGCAAAGACGGAGTGGCTCGTTCAATTGAGAAAGAGAT
GCAATGACGTTGGTGCGGTACTGATTTTCGATGAAATTCAGGTCCGTTGTTCTCGTTGAACCCGTGGTTGATACC
CGGGAAGAAAACTGATTTTATTACCCACAGTGTGGTCTATACAGGACGGGCACTTTATGGGCTCATTCATCTCTA
CCCGTCGAAGCGCATCCTGATATGCTGACTATGGCCAAACCACTCGCGAACGGCTACCCCATTGGTGCCATCCTT
CTCCGTGATGCGGTCGCCAACACAATGACTCCCGGTCCGTCCAACTAGCCAATACACAAAAGGAGAATATTTTTT
CTGATATCTATTCCGTTACATTAGGAACTCATGGAACTACCTTTGGAGGCTCGCCACTTGCTTGCGCAATCGGCC
ATCACGTCCTCAGTCGACTTTCCGACCCCGGAGTTAAATCACAATTAAAAAATACCAGCGCATATCTCGTCGAGC
GCCTACAACTTCTCACAAAGTGGTTCCCTCAACATTTACAACCTACCGTGCGGGGCCGCGGTCTTATCTTGGGGC
TTGGGTTCAAGAATCCCGAAGTGCCTGCAAAGATTGTTGCTCTTGCGAGAGAGAGGGGTGTATTTGTGTTGACGG
CTGGAAAGGATGTTGTGAGGCTGGTACCGAGTTTGAATATTGGGAAGGAAGAAGTGGATTTGGCTGTGGAAGTGC
TTGAAGGTGCTTTGAAAGCGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail