Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|074210
Gene name
Locationscaffold_4:2095280..2096810
Strand-
Gene length (bp)1530
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00925 GTP_cyclohydro2 GTP cyclohydrolase II 3.2E-57 184 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7M9|RIB1_SCHPO Probable GTP cyclohydrolase-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rib1 PE=3 SV=1 179 497 2.0E-67
sp|P50139|RIB1_PICGU GTP cyclohydrolase-2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RIB1 PE=3 SV=2 180 495 4.0E-65
sp|P38066|RIB1_YEAST GTP cyclohydrolase-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIB1 PE=1 SV=2 180 499 3.0E-61
sp|P57863|RIBA_PASMU GTP cyclohydrolase-2 OS=Pasteurella multocida (strain Pm70) GN=ribA PE=3 SV=1 286 458 9.0E-40
sp|A5UAU5|RIBA_HAEIE GTP cyclohydrolase-2 OS=Haemophilus influenzae (strain PittEE) GN=ribA PE=3 SV=1 286 444 7.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7M9|RIB1_SCHPO Probable GTP cyclohydrolase-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rib1 PE=3 SV=1 179 497 2.0E-67
sp|P50139|RIB1_PICGU GTP cyclohydrolase-2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RIB1 PE=3 SV=2 180 495 4.0E-65
sp|P38066|RIB1_YEAST GTP cyclohydrolase-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIB1 PE=1 SV=2 180 499 3.0E-61
sp|P57863|RIBA_PASMU GTP cyclohydrolase-2 OS=Pasteurella multocida (strain Pm70) GN=ribA PE=3 SV=1 286 458 9.0E-40
sp|A5UAU5|RIBA_HAEIE GTP cyclohydrolase-2 OS=Haemophilus influenzae (strain PittEE) GN=ribA PE=3 SV=1 286 444 7.0E-39
sp|A0Q3H7|RIBBA_CLONN Riboflavin biosynthesis protein RibBA OS=Clostridium novyi (strain NT) GN=ribBA PE=3 SV=1 286 429 7.0E-39
sp|P44571|RIBA_HAEIN GTP cyclohydrolase-2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ribA PE=3 SV=2 286 444 7.0E-39
sp|A5UG14|RIBA_HAEIG GTP cyclohydrolase-2 OS=Haemophilus influenzae (strain PittGG) GN=ribA PE=3 SV=1 286 444 7.0E-39
sp|Q4QNX8|RIBA_HAEI8 GTP cyclohydrolase-2 OS=Haemophilus influenzae (strain 86-028NP) GN=ribA PE=3 SV=2 286 444 7.0E-39
sp|Q2SA07|RIBA_HAHCH GTP cyclohydrolase-2 OS=Hahella chejuensis (strain KCTC 2396) GN=ribA PE=3 SV=1 286 446 2.0E-38
sp|Q65SC0|RIBA_MANSM GTP cyclohydrolase-2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=ribA PE=3 SV=1 286 444 2.0E-38
sp|A6VPG3|RIBA_ACTSZ GTP cyclohydrolase-2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=ribA PE=3 SV=1 286 429 3.0E-38
sp|B0UUP7|RIBA_HISS2 GTP cyclohydrolase-2 OS=Histophilus somni (strain 2336) GN=ribA PE=3 SV=1 286 444 3.0E-38
sp|Q0I4A3|RIBA_HAES1 GTP cyclohydrolase-2 OS=Haemophilus somnus (strain 129Pt) GN=ribA PE=3 SV=1 286 444 3.0E-38
sp|B2U0G9|RIBA_SHIB3 GTP cyclohydrolase-2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ribA PE=3 SV=1 286 444 5.0E-38
sp|Q3Z127|RIBA_SHISS GTP cyclohydrolase-2 OS=Shigella sonnei (strain Ss046) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|P0A7I9|RIBA_SHIFL GTP cyclohydrolase-2 OS=Shigella flexneri GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|Q0T5C0|RIBA_SHIF8 GTP cyclohydrolase-2 OS=Shigella flexneri serotype 5b (strain 8401) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|Q31ZX1|RIBA_SHIBS GTP cyclohydrolase-2 OS=Shigella boydii serotype 4 (strain Sb227) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|B1LH12|RIBA_ECOSM GTP cyclohydrolase-2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|B6I9Z2|RIBA_ECOSE GTP cyclohydrolase-2 OS=Escherichia coli (strain SE11) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|B7N493|RIBA_ECOLU GTP cyclohydrolase-2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|P0A7I7|RIBA_ECOLI GTP cyclohydrolase-2 OS=Escherichia coli (strain K12) GN=ribA PE=1 SV=1 286 444 7.0E-38
sp|B1ITH7|RIBA_ECOLC GTP cyclohydrolase-2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|A7ZZL5|RIBA_ECOHS GTP cyclohydrolase-2 OS=Escherichia coli O9:H4 (strain HS) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|B1XBM8|RIBA_ECODH GTP cyclohydrolase-2 OS=Escherichia coli (strain K12 / DH10B) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|C4ZTX2|RIBA_ECOBW GTP cyclohydrolase-2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|B7LY36|RIBA_ECO8A GTP cyclohydrolase-2 OS=Escherichia coli O8 (strain IAI1) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|B7NVQ1|RIBA_ECO7I GTP cyclohydrolase-2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|B5YZQ8|RIBA_ECO5E GTP cyclohydrolase-2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|P0A7I8|RIBA_ECO57 GTP cyclohydrolase-2 OS=Escherichia coli O157:H7 GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|B7L4B3|RIBA_ECO55 GTP cyclohydrolase-2 OS=Escherichia coli (strain 55989 / EAEC) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|B7UR85|RIBA_ECO27 GTP cyclohydrolase-2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|A7ZL97|RIBA_ECO24 GTP cyclohydrolase-2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ribA PE=3 SV=1 286 444 7.0E-38
sp|Q32GQ6|RIBA_SHIDS GTP cyclohydrolase-2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ribA PE=3 SV=1 286 444 8.0E-38
sp|B4EW08|RIBA_PROMH GTP cyclohydrolase-2 OS=Proteus mirabilis (strain HI4320) GN=ribA PE=3 SV=1 286 444 1.0E-37
sp|Q8FHU5|RIBA_ECOL6 GTP cyclohydrolase-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ribA PE=3 SV=2 286 444 1.0E-37
sp|Q0TI88|RIBA_ECOL5 GTP cyclohydrolase-2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ribA PE=3 SV=1 286 444 1.0E-37
sp|B7MUB9|RIBA_ECO81 GTP cyclohydrolase-2 OS=Escherichia coli O81 (strain ED1a) GN=ribA PE=3 SV=1 286 444 1.0E-37
sp|B7MLV3|RIBA_ECO45 GTP cyclohydrolase-2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ribA PE=3 SV=1 286 444 1.0E-37
sp|B3H0P8|RIBBA_ACTP7 Riboflavin biosynthesis protein RibBA OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ribBA PE=3 SV=1 286 430 2.0E-37
sp|P50855|RIBBA_ACTPL Riboflavin biosynthesis protein RibBA OS=Actinobacillus pleuropneumoniae GN=ribBA PE=3 SV=1 286 430 2.0E-37
sp|A3MZA2|RIBBA_ACTP2 Riboflavin biosynthesis protein RibBA OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ribBA PE=3 SV=1 286 430 2.0E-37
sp|B0BTN8|RIBBA_ACTPJ Riboflavin biosynthesis protein RibBA OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ribBA PE=3 SV=1 286 430 2.0E-37
sp|Q21F24|RIBA_SACD2 GTP cyclohydrolase-2 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ribA PE=3 SV=1 257 428 3.0E-37
sp|C5D3N0|RIBBA_GEOSW Riboflavin biosynthesis protein RibBA OS=Geobacillus sp. (strain WCH70) GN=ribBA PE=3 SV=1 277 439 4.0E-37
sp|P66030|RIBA_SALTY GTP cyclohydrolase-2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ribA PE=3 SV=1 286 444 4.0E-37
sp|P66031|RIBA_SALTI GTP cyclohydrolase-2 OS=Salmonella typhi GN=ribA PE=3 SV=1 286 444 4.0E-37
sp|Q5PCY8|RIBA_SALPA GTP cyclohydrolase-2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ribA PE=3 SV=1 286 444 4.0E-37
sp|Q57NU9|RIBA_SALCH GTP cyclohydrolase-2 OS=Salmonella choleraesuis (strain SC-B67) GN=ribA PE=3 SV=1 286 444 4.0E-37
sp|C3K2R5|RIBA_PSEFS GTP cyclohydrolase-2 OS=Pseudomonas fluorescens (strain SBW25) GN=ribA PE=3 SV=1 284 459 6.0E-37
sp|A6V055|RIBA_PSEA7 GTP cyclohydrolase-2 OS=Pseudomonas aeruginosa (strain PA7) GN=ribA PE=3 SV=1 284 446 8.0E-37
sp|Q9HWY1|RIBA_PSEAE GTP cyclohydrolase-2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ribA PE=3 SV=1 284 446 1.0E-36
sp|B7V7R1|RIBA_PSEA8 GTP cyclohydrolase-2 OS=Pseudomonas aeruginosa (strain LESB58) GN=ribA PE=3 SV=1 284 446 1.0E-36
sp|B7LS01|RIBA_ESCF3 GTP cyclohydrolase-2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ribA PE=3 SV=1 286 444 2.0E-36
sp|Q02SL4|RIBA_PSEAB GTP cyclohydrolase-2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ribA PE=3 SV=1 284 446 2.0E-36
sp|A8AG83|RIBA_CITK8 GTP cyclohydrolase-2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ribA PE=3 SV=1 286 444 3.0E-36
sp|C1DLI3|RIBA_AZOVD GTP cyclohydrolase-2 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ribA PE=3 SV=1 284 446 3.0E-36
sp|A7MMF7|RIBA_CROS8 GTP cyclohydrolase-2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ribA PE=3 SV=1 286 444 3.0E-36
sp|A1KU62|RIBA_NEIMF GTP cyclohydrolase-2 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ribA PE=3 SV=1 286 429 3.0E-36
sp|Q9JZ78|RIBA_NEIMB GTP cyclohydrolase-2 OS=Neisseria meningitidis serogroup B (strain MC58) GN=ribA PE=3 SV=1 286 429 3.0E-36
sp|A9LZD5|RIBA_NEIM0 GTP cyclohydrolase-2 OS=Neisseria meningitidis serogroup C (strain 053442) GN=ribA PE=3 SV=1 286 429 3.0E-36
sp|Q66AI6|RIBA_YERPS GTP cyclohydrolase-2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ribA PE=3 SV=1 286 444 4.0E-36
sp|Q8ZEF0|RIBA_YERPE GTP cyclohydrolase-2 OS=Yersinia pestis GN=ribA PE=3 SV=1 286 444 4.0E-36
sp|Q889Q3|RIBA_PSESM GTP cyclohydrolase-2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ribA PE=3 SV=1 284 459 6.0E-36
sp|A4WAY6|RIBA_ENT38 GTP cyclohydrolase-2 OS=Enterobacter sp. (strain 638) GN=ribA PE=3 SV=1 286 444 7.0E-36
sp|A3D367|RIBA_SHEB5 GTP cyclohydrolase-2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ribA PE=3 SV=1 263 429 8.0E-36
sp|A6KWQ7|RIBBA_BACV8 Riboflavin biosynthesis protein RibBA OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=ribBA PE=3 SV=1 286 437 1.0E-35
sp|Q47WV5|RIBA_COLP3 GTP cyclohydrolase-2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ribA PE=3 SV=1 286 444 2.0E-35
sp|C4K8Q4|RIBA_HAMD5 GTP cyclohydrolase-2 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=ribA PE=3 SV=1 284 433 2.0E-35
sp|P17620|RIBBA_BACSU Riboflavin biosynthesis protein RibBA OS=Bacillus subtilis (strain 168) GN=ribBA PE=3 SV=1 286 445 2.0E-35
sp|A9KXC4|RIBA_SHEB9 GTP cyclohydrolase-2 OS=Shewanella baltica (strain OS195) GN=ribA PE=3 SV=1 263 429 2.0E-35
sp|A6WLV9|RIBA_SHEB8 GTP cyclohydrolase-2 OS=Shewanella baltica (strain OS185) GN=ribA PE=3 SV=1 263 429 2.0E-35
sp|B8EF62|RIBA_SHEB2 GTP cyclohydrolase-2 OS=Shewanella baltica (strain OS223) GN=ribA PE=3 SV=1 263 429 2.0E-35
sp|Q9JU99|RIBA_NEIMA GTP cyclohydrolase-2 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ribA PE=3 SV=1 286 429 2.0E-35
sp|Q5F7N6|RIBA_NEIG1 GTP cyclohydrolase-2 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ribA PE=3 SV=1 286 429 2.0E-35
sp|B5XS13|RIBA_KLEP3 GTP cyclohydrolase-2 OS=Klebsiella pneumoniae (strain 342) GN=ribA PE=3 SV=1 286 444 2.0E-35
sp|A6T7Y5|RIBA_KLEP7 GTP cyclohydrolase-2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ribA PE=3 SV=1 286 444 2.0E-35
sp|C5BS80|RIBA_TERTT GTP cyclohydrolase-2 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ribA PE=3 SV=1 286 446 3.0E-35
sp|A1S528|RIBA_SHEAM GTP cyclohydrolase-2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ribA PE=3 SV=1 284 429 4.0E-35
sp|Q3B2I6|RIBBA_CHLL7 Riboflavin biosynthesis protein RibBA OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ribBA PE=3 SV=1 286 429 5.0E-35
sp|A6VWW9|RIBA_MARMS GTP cyclohydrolase-2 OS=Marinomonas sp. (strain MWYL1) GN=ribA PE=3 SV=1 285 444 5.0E-35
sp|P43525|RIBA_AZOBR GTP cyclohydrolase-2 OS=Azospirillum brasilense GN=ribA PE=3 SV=1 260 444 5.0E-35
sp|A8FTP1|RIBA_SHESH GTP cyclohydrolase-2 OS=Shewanella sediminis (strain HAW-EB3) GN=ribA PE=3 SV=1 261 429 6.0E-35
sp|B4S5Y8|RIBBA_PROA2 Riboflavin biosynthesis protein RibBA OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=ribBA PE=3 SV=1 286 429 6.0E-35
sp|A4SFY4|RIBBA_CHLPM Riboflavin biosynthesis protein RibBA OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=ribBA PE=3 SV=1 286 429 6.0E-35
sp|P51695|RIBBA_BACAM Riboflavin biosynthesis protein RibBA OS=Bacillus amyloliquefaciens GN=ribBA PE=3 SV=1 275 445 7.0E-35
sp|B4SE30|RIBBA_PELPB Riboflavin biosynthesis protein RibBA OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ribBA PE=3 SV=1 286 444 8.0E-35
sp|P74104|RIBBA_SYNY3 Riboflavin biosynthesis protein RibBA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ribBA PE=3 SV=1 252 444 1.0E-34
sp|B0VQB7|RIBA_ACIBS GTP cyclohydrolase-2 OS=Acinetobacter baumannii (strain SDF) GN=ribA PE=3 SV=1 286 429 1.0E-34
sp|A8H5U9|RIBA_SHEPA GTP cyclohydrolase-2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ribA PE=3 SV=1 263 429 1.0E-34
sp|A0KYF8|RIBA_SHESA GTP cyclohydrolase-2 OS=Shewanella sp. (strain ANA-3) GN=ribA PE=3 SV=1 284 429 1.0E-34
sp|Q7VR05|RIBA_BLOFL GTP cyclohydrolase-2 OS=Blochmannia floridanus GN=ribA PE=3 SV=1 286 430 1.0E-34
sp|B0V709|RIBA_ACIBY GTP cyclohydrolase-2 OS=Acinetobacter baumannii (strain AYE) GN=ribA PE=3 SV=1 286 429 1.0E-34
sp|A3M9B0|RIBA_ACIBT GTP cyclohydrolase-2 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=ribA PE=3 SV=2 286 429 1.0E-34
sp|B2HZQ0|RIBA_ACIBC GTP cyclohydrolase-2 OS=Acinetobacter baumannii (strain ACICU) GN=ribA PE=3 SV=1 286 429 1.0E-34
sp|B7GVX4|RIBA_ACIB3 GTP cyclohydrolase-2 OS=Acinetobacter baumannii (strain AB307-0294) GN=ribA PE=3 SV=1 286 429 1.0E-34
sp|B7IA66|RIBA_ACIB5 GTP cyclohydrolase-2 OS=Acinetobacter baumannii (strain AB0057) GN=ribA PE=3 SV=1 286 429 2.0E-34
sp|B0TL40|RIBA_SHEHH GTP cyclohydrolase-2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=ribA PE=3 SV=1 263 429 2.0E-34
sp|Q0AXM5|RIBBA_SYNWW Riboflavin biosynthesis protein RibBA OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=ribBA PE=3 SV=1 286 445 2.0E-34
sp|A7Z675|RIBBA_BACMF Riboflavin biosynthesis protein RibBA OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ribBA PE=3 SV=1 252 445 2.0E-34
sp|B8CQ07|RIBA_SHEPW GTP cyclohydrolase-2 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ribA PE=3 SV=1 263 429 2.0E-34
sp|Q0HTR2|RIBA_SHESR GTP cyclohydrolase-2 OS=Shewanella sp. (strain MR-7) GN=ribA PE=3 SV=1 284 429 2.0E-34
sp|Q0HHF8|RIBA_SHESM GTP cyclohydrolase-2 OS=Shewanella sp. (strain MR-4) GN=ribA PE=3 SV=1 274 429 2.0E-34
sp|Q6D5U5|RIBA_PECAS GTP cyclohydrolase-2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ribA PE=3 SV=1 286 430 2.0E-34
sp|Q88QH1|RIBA_PSEPK GTP cyclohydrolase-2 OS=Pseudomonas putida (strain KT2440) GN=ribA PE=3 SV=1 286 459 2.0E-34
sp|A5VXW5|RIBA_PSEP1 GTP cyclohydrolase-2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ribA PE=3 SV=1 286 459 2.0E-34
sp|A3QFR4|RIBA_SHELP GTP cyclohydrolase-2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ribA PE=3 SV=1 286 429 2.0E-34
sp|Q8EDD1|RIBA_SHEON GTP cyclohydrolase-2 OS=Shewanella oneidensis (strain MR-1) GN=ribA PE=3 SV=1 286 429 3.0E-34
sp|A1RL35|RIBA_SHESW GTP cyclohydrolase-2 OS=Shewanella sp. (strain W3-18-1) GN=ribA PE=3 SV=1 263 429 3.0E-34
sp|A4Y5N5|RIBA_SHEPC GTP cyclohydrolase-2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ribA PE=3 SV=1 263 429 3.0E-34
sp|A7GSD5|RIBBA_BACCN Riboflavin biosynthesis protein RibBA OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ribBA PE=3 SV=1 286 445 4.0E-34
sp|A0KJ91|RIBA_AERHH GTP cyclohydrolase-2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ribA PE=3 SV=1 286 429 4.0E-34
sp|Q818X6|RIBBA_BACCR Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ribBA PE=3 SV=1 286 445 5.0E-34
sp|A6LHN0|RIBBA_PARD8 Riboflavin biosynthesis protein RibBA OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ribBA PE=3 SV=1 286 429 5.0E-34
sp|B0KL75|RIBA_PSEPG GTP cyclohydrolase-2 OS=Pseudomonas putida (strain GB-1) GN=ribA PE=3 SV=1 286 459 5.0E-34
sp|Q6L1J7|RIBA_PICTO GTP cyclohydrolase-2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=ribA PE=3 SV=1 287 430 5.0E-34
sp|C0ZKW2|RIBBA_BREBN Riboflavin biosynthesis protein RibBA OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ribBA PE=3 SV=1 286 444 5.0E-34
sp|B7IWM5|RIBBA_BACC2 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain G9842) GN=ribBA PE=3 SV=1 286 445 5.0E-34
sp|Q5WH08|RIBBA_BACSK Riboflavin biosynthesis protein RibBA OS=Bacillus clausii (strain KSM-K16) GN=ribBA PE=3 SV=1 286 429 7.0E-34
sp|B7HAY4|RIBBA_BACC4 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain B4264) GN=ribBA PE=3 SV=1 286 445 7.0E-34
sp|B0KAI2|RIBBA_THEP3 Riboflavin biosynthesis protein RibBA OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=ribBA PE=3 SV=1 286 429 7.0E-34
sp|B0K0Y9|RIBBA_THEPX Riboflavin biosynthesis protein RibBA OS=Thermoanaerobacter sp. (strain X514) GN=ribBA PE=3 SV=1 286 437 7.0E-34
sp|Q9FN89|RIBA3_ARATH Monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic OS=Arabidopsis thaliana GN=RIBA3 PE=1 SV=1 286 444 8.0E-34
sp|B1KLM0|RIBA_SHEWM GTP cyclohydrolase-2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ribA PE=3 SV=1 263 429 8.0E-34
sp|P57359|RIBA_BUCAI GTP cyclohydrolase-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ribA PE=3 SV=1 286 432 9.0E-34
sp|B7JLW6|RIBBA_BACC0 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain AH820) GN=ribBA PE=3 SV=1 286 429 1.0E-33
sp|B1J3G0|RIBA_PSEPW GTP cyclohydrolase-2 OS=Pseudomonas putida (strain W619) GN=ribA PE=3 SV=1 286 444 1.0E-33
sp|Q635H0|RIBBA_BACCZ Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain ZK / E33L) GN=ribBA PE=3 SV=1 286 429 1.0E-33
sp|Q6L506|RIBA3_ORYSJ Probable monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic OS=Oryza sativa subsp. japonica GN=RIBA3 PE=2 SV=1 286 444 1.0E-33
sp|Q6HE54|RIBBA_BACHK Riboflavin biosynthesis protein RibBA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ribBA PE=3 SV=1 286 429 1.0E-33
sp|C1EQY5|RIBBA_BACC3 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain 03BB102) GN=ribBA PE=3 SV=1 286 429 1.0E-33
sp|Q81MB6|RIBBA_BACAN Riboflavin biosynthesis protein RibBA OS=Bacillus anthracis GN=ribBA PE=3 SV=1 286 429 1.0E-33
sp|A0RIB3|RIBBA_BACAH Riboflavin biosynthesis protein RibBA OS=Bacillus thuringiensis (strain Al Hakam) GN=ribBA PE=3 SV=1 286 429 1.0E-33
sp|C3LIX7|RIBBA_BACAC Riboflavin biosynthesis protein RibBA OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ribBA PE=3 SV=1 286 429 1.0E-33
sp|C3P7P7|RIBBA_BACAA Riboflavin biosynthesis protein RibBA OS=Bacillus anthracis (strain A0248) GN=ribBA PE=3 SV=1 286 429 1.0E-33
sp|Q7MGG3|RIBXA_VIBVY Riboflavin biosynthesis protein VVA0006 OS=Vibrio vulnificus (strain YJ016) GN=VVA0006 PE=1 SV=1 284 429 2.0E-33
sp|Q97B83|RIBA_THEVO GTP cyclohydrolase-2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=ribA PE=3 SV=1 287 444 2.0E-33
sp|A7I3X0|RIBA_CAMHC GTP cyclohydrolase-2 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=ribA PE=3 SV=1 287 450 2.0E-33
sp|Q62BG3|RIBA_BURMA GTP cyclohydrolase-2 OS=Burkholderia mallei (strain ATCC 23344) GN=ribA PE=3 SV=1 283 445 2.0E-33
sp|B2UT29|RIBA_HELPS GTP cyclohydrolase-2 OS=Helicobacter pylori (strain Shi470) GN=ribA PE=3 SV=1 268 418 2.0E-33
sp|Q080N2|RIBA_SHEFN GTP cyclohydrolase-2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=ribA PE=3 SV=1 178 429 2.0E-33
sp|Q1LTG5|RIBA_BAUCH GTP cyclohydrolase-2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=ribA PE=3 SV=1 286 430 2.0E-33
sp|A9VG50|RIBBA_BACWK Riboflavin biosynthesis protein RibBA OS=Bacillus weihenstephanensis (strain KBAB4) GN=ribBA PE=3 SV=1 286 429 3.0E-33
sp|B9IWX4|RIBBA_BACCQ Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain Q1) GN=ribBA PE=3 SV=1 286 429 3.0E-33
sp|B7HNM8|RIBBA_BACC7 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain AH187) GN=ribBA PE=3 SV=1 286 429 3.0E-33
sp|Q731I5|RIBBA_BACC1 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ribBA PE=3 SV=1 286 429 3.0E-33
sp|Q7MWK9|RIBBA_PORGI Riboflavin biosynthesis protein RibBA OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ribBA PE=3 SV=1 286 429 3.0E-33
sp|B2RIG7|RIBBA_PORG3 Riboflavin biosynthesis protein RibBA OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ribBA PE=3 SV=1 286 429 3.0E-33
sp|Q1IFL5|RIBA_PSEE4 GTP cyclohydrolase-2 OS=Pseudomonas entomophila (strain L48) GN=ribA PE=3 SV=1 286 429 3.0E-33
sp|Q8A528|RIBBA_BACTN Riboflavin biosynthesis protein RibBA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=ribBA PE=3 SV=1 286 437 5.0E-33
sp|Q12P94|RIBA_SHEDO GTP cyclohydrolase-2 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ribA PE=3 SV=1 284 429 5.0E-33
sp|Q8K9Q0|RIBA_BUCAP GTP cyclohydrolase-2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ribA PE=3 SV=1 286 444 6.0E-33
sp|Q6F7N4|RIBA_ACIAD GTP cyclohydrolase-2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ribA PE=3 SV=1 286 429 7.0E-33
sp|Q8D2J0|RIBA_WIGBR GTP cyclohydrolase-2 OS=Wigglesworthia glossinidia brevipalpis GN=ribA PE=3 SV=1 286 433 1.0E-32
sp|A0RR75|RIBA_CAMFF GTP cyclohydrolase-2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=ribA PE=3 SV=1 278 444 2.0E-32
sp|O84736|RIBBA_CHLTR Riboflavin biosynthesis protein RibBA OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=ribBA PE=3 SV=1 287 429 2.0E-32
sp|C0ZZE5|RIBBA_RHOE4 Riboflavin biosynthesis protein RibBA OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ribBA PE=3 SV=1 286 433 4.0E-32
sp|O08315|RIBA_HELPY GTP cyclohydrolase-2 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ribA PE=1 SV=2 268 418 5.0E-32
sp|B6JM32|RIBA_HELP2 GTP cyclohydrolase-2 OS=Helicobacter pylori (strain P12) GN=ribA PE=3 SV=1 268 418 5.0E-32
sp|Q5YTP3|RIBBA_NOCFA Riboflavin biosynthesis protein RibBA OS=Nocardia farcinica (strain IFM 10152) GN=ribBA PE=3 SV=1 286 429 5.0E-32
sp|Q7VK48|RIBA_HELHP GTP cyclohydrolase-2 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ribA PE=3 SV=1 254 416 6.0E-32
sp|Q492N9|RIBA_BLOPB GTP cyclohydrolase-2 OS=Blochmannia pennsylvanicus (strain BPEN) GN=ribA PE=3 SV=1 286 430 6.0E-32
sp|C4LE64|RIBA_TOLAT GTP cyclohydrolase-2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ribA PE=3 SV=1 286 429 6.0E-32
sp|Q1CT68|RIBA_HELPH GTP cyclohydrolase-2 OS=Helicobacter pylori (strain HPAG1) GN=ribA PE=3 SV=1 268 418 7.0E-32
sp|P59555|RIBA_BUCBP GTP cyclohydrolase-2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ribA PE=3 SV=1 284 497 8.0E-32
sp|Q9PLJ5|RIBBA_CHLMU Riboflavin biosynthesis protein RibBA OS=Chlamydia muridarum (strain MoPn / Nigg) GN=ribBA PE=3 SV=1 287 437 1.0E-31
sp|O68248|RIBA_SULMU GTP cyclohydrolase-2 (Fragment) OS=Sulfurospirillum multivorans GN=ribA PE=3 SV=1 290 436 1.0E-31
sp|Q0S0K2|RIBBA_RHOJR Riboflavin biosynthesis protein RibBA OS=Rhodococcus jostii (strain RHA1) GN=ribBA PE=3 SV=1 286 433 1.0E-31
sp|Q6Z234|RIBA1_ORYSJ Probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic OS=Oryza sativa subsp. japonica GN=RIBA1 PE=2 SV=1 286 445 2.0E-31
sp|Q17XC9|RIBA_HELAH GTP cyclohydrolase-2 OS=Helicobacter acinonychis (strain Sheeba) GN=ribA PE=3 SV=1 268 418 2.0E-31
sp|Q0E079|RIBA2_ORYSJ Probable bifunctional riboflavin biosynthesis protein RIBA 2, chloroplastic OS=Oryza sativa subsp. japonica GN=RIBA2 PE=2 SV=1 286 439 2.0E-31
sp|A0QI09|RIBBA_MYCA1 Riboflavin biosynthesis protein RibBA OS=Mycobacterium avium (strain 104) GN=ribBA PE=3 SV=1 286 433 2.0E-31
sp|Q9ZL42|RIBA_HELPJ GTP cyclohydrolase-2 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ribA PE=3 SV=1 273 418 3.0E-31
sp|O88011|RIBA_STRCO GTP cyclohydrolase-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ribA PE=3 SV=1 286 430 3.0E-31
sp|B1MCA4|RIBBA_MYCA9 Riboflavin biosynthesis protein RibBA OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=ribBA PE=3 SV=1 286 449 3.0E-31
sp|Q8NQ52|RIBBA_CORGL Riboflavin biosynthesis protein RibBA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ribBA PE=3 SV=1 286 498 3.0E-31
sp|A4QEG9|RIBBA_CORGB Riboflavin biosynthesis protein RibBA OS=Corynebacterium glutamicum (strain R) GN=ribBA PE=3 SV=1 286 498 3.0E-31
sp|O24752|RIBBA_CORAM Riboflavin biosynthesis protein RibBA OS=Corynebacterium ammoniagenes GN=ribBA PE=3 SV=1 286 429 4.0E-31
sp|B2HP67|RIBBA_MYCMM Riboflavin biosynthesis protein RibBA OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=ribBA PE=3 SV=1 286 433 6.0E-31
sp|Q11WK6|RIBBA_CYTH3 Riboflavin biosynthesis protein RibBA OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ribBA PE=3 SV=1 286 443 7.0E-31
sp|P47924|RIBA1_ARATH Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic OS=Arabidopsis thaliana GN=RIBA1 PE=1 SV=2 286 444 8.0E-31
sp|Q741F1|RIBBA_MYCPA Riboflavin biosynthesis protein RibBA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ribBA PE=3 SV=1 286 433 1.0E-30
sp|A0PPL6|RIBBA_MYCUA Riboflavin biosynthesis protein RibBA OS=Mycobacterium ulcerans (strain Agy99) GN=ribBA PE=3 SV=1 286 433 1.0E-30
sp|P9WHF1|RIBBA_MYCTU Riboflavin biosynthesis protein RibBA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ribBA PE=1 SV=1 286 433 1.0E-30
sp|P9WHF0|RIBBA_MYCTO Riboflavin biosynthesis protein RibBA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ribBA PE=3 SV=1 286 433 1.0E-30
sp|A5U2B7|RIBBA_MYCTA Riboflavin biosynthesis protein RibBA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ribBA PE=1 SV=1 286 433 1.0E-30
sp|C1AN60|RIBBA_MYCBT Riboflavin biosynthesis protein RibBA OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ribBA PE=3 SV=1 286 433 1.0E-30
sp|A1KIK4|RIBBA_MYCBP Riboflavin biosynthesis protein RibBA OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ribBA PE=3 SV=1 286 433 1.0E-30
sp|P0A5V1|RIBBA_MYCBO Riboflavin biosynthesis protein RibBA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ribBA PE=3 SV=1 286 433 1.0E-30
sp|Q4L7B1|RIBBA_STAHJ Riboflavin biosynthesis protein RibBA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ribBA PE=3 SV=1 287 444 2.0E-30
sp|Q64YT3|RIBBA_BACFR Riboflavin biosynthesis protein RibBA OS=Bacteroides fragilis (strain YCH46) GN=ribBA PE=3 SV=1 286 445 2.0E-30
sp|Q5LHT1|RIBBA_BACFN Riboflavin biosynthesis protein RibBA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=ribBA PE=3 SV=1 286 445 2.0E-30
sp|A1SSA8|RIBA_PSYIN GTP cyclohydrolase-2 OS=Psychromonas ingrahamii (strain 37) GN=ribA PE=3 SV=1 283 423 2.0E-30
sp|Q9Z734|RIBBA_CHLPN Riboflavin biosynthesis protein RibBA OS=Chlamydia pneumoniae GN=ribBA PE=3 SV=1 286 497 4.0E-30
sp|A4X639|RIBBA_SALTO Riboflavin biosynthesis protein RibBA OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=ribBA PE=3 SV=1 286 446 4.0E-30
sp|O29766|RIBA_ARCFU GTP cyclohydrolase-2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ribA PE=3 SV=1 286 424 4.0E-30
sp|A1T8K1|RIBBA_MYCVP Riboflavin biosynthesis protein RibBA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ribBA PE=3 SV=1 286 433 4.0E-30
sp|A4TC13|RIBBA_MYCGI Riboflavin biosynthesis protein RibBA OS=Mycobacterium gilvum (strain PYR-GCK) GN=ribBA PE=3 SV=1 286 433 7.0E-30
sp|A8LY38|RIBBA_SALAI Riboflavin biosynthesis protein RibBA OS=Salinispora arenicola (strain CNS-205) GN=ribBA PE=3 SV=1 286 429 9.0E-30
sp|Q5HF07|RIBBA_STAAC Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain COL) GN=ribBA PE=3 SV=1 287 444 2.0E-29
sp|Q9KSJ3|RIBA_VIBCH GTP cyclohydrolase-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ribA PE=3 SV=2 283 441 2.0E-29
sp|Q8NW14|RIBBA_STAAW Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain MW2) GN=ribBA PE=3 SV=1 287 444 2.0E-29
sp|Q6G8G1|RIBBA_STAAS Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain MSSA476) GN=ribBA PE=3 SV=1 287 444 2.0E-29
sp|Q6GFT5|RIBBA_STAAR Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain MRSA252) GN=ribBA PE=3 SV=1 287 444 2.0E-29
sp|Q7A511|RIBBA_STAAN Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain N315) GN=ribBA PE=3 SV=1 287 445 3.0E-29
sp|Q99TA0|RIBBA_STAAM Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ribBA PE=3 SV=1 287 445 3.0E-29
sp|Q8CNU2|RIBBA_STAES Riboflavin biosynthesis protein RibBA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ribBA PE=3 SV=1 265 444 3.0E-29
sp|Q49YJ7|RIBBA_STAS1 Riboflavin biosynthesis protein RibBA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ribBA PE=3 SV=1 287 444 4.0E-29
sp|Q5HNE3|RIBBA_STAEQ Riboflavin biosynthesis protein RibBA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ribBA PE=3 SV=1 285 444 5.0E-29
sp|Q9X2E6|RIBBA_THEMA Riboflavin biosynthesis protein RibBA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ribBA PE=3 SV=1 231 455 1.0E-28
sp|O66679|RIBBA_AQUAE Riboflavin biosynthesis protein RibBA OS=Aquifex aeolicus (strain VF5) GN=ribBA PE=3 SV=1 286 429 2.0E-28
sp|Q87NE7|RIBA_VIBPA GTP cyclohydrolase-2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ribA PE=3 SV=1 285 425 4.0E-28
sp|Q9PBZ3|RIBA_XYLFA GTP cyclohydrolase-2 OS=Xylella fastidiosa (strain 9a5c) GN=ribA PE=3 SV=1 287 469 4.0E-28
sp|B5FDS3|RIBA_VIBFM GTP cyclohydrolase-2 OS=Vibrio fischeri (strain MJ11) GN=ribA PE=3 SV=1 285 444 6.0E-28
sp|Q8DAG7|RIBA_VIBVU GTP cyclohydrolase-2 OS=Vibrio vulnificus (strain CMCP6) GN=ribA PE=3 SV=1 283 425 9.0E-28
sp|Q87D69|RIBA_XYLFT GTP cyclohydrolase-2 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ribA PE=3 SV=1 287 469 4.0E-27
sp|B1H0I0|RIBBA_UNCTG Riboflavin biosynthesis protein RibBA OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ribBA PE=3 SV=1 286 429 4.0E-27
sp|P51618|RIBA_PHOPO GTP cyclohydrolase-2 OS=Photobacterium phosphoreum GN=ribA PE=3 SV=1 284 425 5.0E-27
sp|B6ENI2|RIBA_ALISL GTP cyclohydrolase-2 OS=Aliivibrio salmonicida (strain LFI1238) GN=ribA PE=3 SV=1 283 425 6.0E-27
sp|Q5E5L2|RIBA_VIBF1 GTP cyclohydrolase-2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ribA PE=3 SV=1 285 444 4.0E-26
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|074210
MGALHDSSSAVDASDLALLDILTAPTRPTPRSLPRRDAVLDPLLIAAAAASGPHVTRNHYHHDFFPGVMVPRAES
AWDWTKWTGEDASHKTERKRLAYVSKQAPRRQRLAAANNEETKENDVPYHTDALTPVDNVPHVSKKRRASLVSAQ
STSAEENTYSTPDTLSSSKQLTNVKAEVEVKCMARTRIPTPHGPAFLHLYHNNHDKKEHLAIIIDPAQLSENSTP
APPIRSHSLDAVWDKNETEMDRITRGAYIGRLSATSHHASDPSDPARPSLPVNTNVIPAPLIRIHSECFTGETVG
SMRCDCGEQLDEAIRQIFQPVSVPSPDPSSKPITIPGRGAVIYLRQEGRGIGLLSKIRAYNLQDLGHDTVTANLM
LGYQADERGYEIAGAILRDLGLGSANGVRVLTNNPDKVEALKREGVTVVEHIPMIPRSWQHRKHQMDQKLGDQDK
DVLTQRQKEEKERMAGATLIGGGAVHGEDLDKYLRTKVLRMGHMLPLWLEDTAPDSSVY*
Coding >AgabiH97|074210
ATGGGCGCCCTTCACGACTCCTCCAGCGCCGTCGATGCTTCGGATCTCGCTCTCCTCGACATCCTCACCGCCCCC
ACTCGTCCTACCCCACGTTCCCTTCCACGCAGAGACGCCGTTCTCGATCCTCTTCTCATCGCTGCTGCCGCGGCA
TCGGGCCCCCACGTTACTCGCAATCACTATCATCACGACTTTTTTCCCGGCGTCATGGTCCCCCGAGCAGAGTCC
GCTTGGGATTGGACCAAATGGACTGGCGAAGACGCTTCTCACAAGACGGAAAGAAAGCGCCTCGCATACGTGAGC
AAGCAGGCGCCTCGCCGCCAACGACTGGCTGCCGCAAACAATGAAGAGACTAAGGAAAACGACGTTCCGTATCAC
ACGGATGCTCTAACGCCGGTTGACAATGTTCCACACGTTTCAAAGAAGCGCCGGGCGTCCCTCGTTTCTGCGCAA
TCTACTTCTGCCGAGGAAAATACGTATTCCACCCCAGACACACTCTCATCGTCCAAGCAGCTGACCAACGTGAAG
GCTGAAGTTGAAGTCAAGTGCATGGCACGTACCCGTATACCGACACCACATGGTCCCGCATTTCTTCACTTGTAT
CATAATAATCATGACAAAAAGGAACATCTCGCAATCATCATAGATCCTGCCCAATTATCAGAAAATTCAACACCA
GCTCCTCCTATCCGCTCTCATTCACTCGATGCTGTCTGGGATAAAAATGAGACCGAAATGGATCGTATCACACGA
GGAGCCTATATAGGTCGCTTATCTGCTACATCGCATCATGCTTCTGATCCGTCAGATCCCGCCAGACCGTCCCTT
CCGGTCAACACTAATGTCATTCCCGCGCCCTTGATCCGCATTCACTCGGAATGCTTCACTGGAGAAACAGTTGGC
AGTATGCGCTGCGACTGTGGCGAGCAGTTAGATGAGGCGATCCGTCAAATATTCCAACCTGTCTCCGTCCCATCG
CCCGACCCTTCATCAAAACCCATCACTATACCCGGTCGCGGCGCAGTCATATATCTCCGACAAGAGGGACGAGGT
ATAGGTTTACTTTCTAAAATTCGTGCCTATAATCTTCAAGACTTGGGCCATGACACCGTCACTGCAAATCTTATG
CTCGGTTATCAGGCAGATGAACGAGGCTACGAGATTGCTGGGGCCATTCTCCGCGACCTGGGACTAGGCTCAGCA
AACGGAGTACGAGTGCTAACAAATAACCCTGACAAGGTCGAGGCCTTGAAGAGAGAAGGAGTTACAGTAGTCGAG
CACATTCCCATGATTCCACGGAGTTGGCAACATCGTAAACATCAGATGGATCAGAAGTTGGGGGATCAGGATAAG
GATGTGTTAACGCAGCGGCAAAAGGAAGAGAAGGAAAGGATGGCTGGTGCCACGCTCATTGGTGGTGGTGCTGTC
CATGGGGAAGACCTTGATAAATATTTGCGGACGAAAGTTTTACGGATGGGACATATGCTACCCCTCTGGCTGGAA
GATACCGCACCTGATTCATCTGTTTATTGA
Transcript >AgabiH97|074210
ATGGGCGCCCTTCACGACTCCTCCAGCGCCGTCGATGCTTCGGATCTCGCTCTCCTCGACATCCTCACCGCCCCC
ACTCGTCCTACCCCACGTTCCCTTCCACGCAGAGACGCCGTTCTCGATCCTCTTCTCATCGCTGCTGCCGCGGCA
TCGGGCCCCCACGTTACTCGCAATCACTATCATCACGACTTTTTTCCCGGCGTCATGGTCCCCCGAGCAGAGTCC
GCTTGGGATTGGACCAAATGGACTGGCGAAGACGCTTCTCACAAGACGGAAAGAAAGCGCCTCGCATACGTGAGC
AAGCAGGCGCCTCGCCGCCAACGACTGGCTGCCGCAAACAATGAAGAGACTAAGGAAAACGACGTTCCGTATCAC
ACGGATGCTCTAACGCCGGTTGACAATGTTCCACACGTTTCAAAGAAGCGCCGGGCGTCCCTCGTTTCTGCGCAA
TCTACTTCTGCCGAGGAAAATACGTATTCCACCCCAGACACACTCTCATCGTCCAAGCAGCTGACCAACGTGAAG
GCTGAAGTTGAAGTCAAGTGCATGGCACGTACCCGTATACCGACACCACATGGTCCCGCATTTCTTCACTTGTAT
CATAATAATCATGACAAAAAGGAACATCTCGCAATCATCATAGATCCTGCCCAATTATCAGAAAATTCAACACCA
GCTCCTCCTATCCGCTCTCATTCACTCGATGCTGTCTGGGATAAAAATGAGACCGAAATGGATCGTATCACACGA
GGAGCCTATATAGGTCGCTTATCTGCTACATCGCATCATGCTTCTGATCCGTCAGATCCCGCCAGACCGTCCCTT
CCGGTCAACACTAATGTCATTCCCGCGCCCTTGATCCGCATTCACTCGGAATGCTTCACTGGAGAAACAGTTGGC
AGTATGCGCTGCGACTGTGGCGAGCAGTTAGATGAGGCGATCCGTCAAATATTCCAACCTGTCTCCGTCCCATCG
CCCGACCCTTCATCAAAACCCATCACTATACCCGGTCGCGGCGCAGTCATATATCTCCGACAAGAGGGACGAGGT
ATAGGTTTACTTTCTAAAATTCGTGCCTATAATCTTCAAGACTTGGGCCATGACACCGTCACTGCAAATCTTATG
CTCGGTTATCAGGCAGATGAACGAGGCTACGAGATTGCTGGGGCCATTCTCCGCGACCTGGGACTAGGCTCAGCA
AACGGAGTACGAGTGCTAACAAATAACCCTGACAAGGTCGAGGCCTTGAAGAGAGAAGGAGTTACAGTAGTCGAG
CACATTCCCATGATTCCACGGAGTTGGCAACATCGTAAACATCAGATGGATCAGAAGTTGGGGGATCAGGATAAG
GATGTGTTAACGCAGCGGCAAAAGGAAGAGAAGGAAAGGATGGCTGGTGCCACGCTCATTGGTGGTGGTGCTGTC
CATGGGGAAGACCTTGATAAATATTTGCGGACGAAAGTTTTACGGATGGGACATATGCTACCCCTCTGGCTGGAA
GATACCGCACCTGATTCATCTGTTTATTGA
Gene >AgabiH97|074210
ATGGGCGCCCTTCACGACTCCTCCAGCGCCGTCGATGCTTCGGATCTCGCTCTCCTCGACATCCTCACCGCCCCC
ACTCGTCCTACCCCACGTTCCCTTCCACGCAGAGACGCCGTTCTCGATCCTCTTCTCATCGCTGCTGCCGCGGCA
TCGGGCCCCCACGTTACTCGCAATCACTATCATCACGACTTTTTTCCCGGCGTCATGGTCCCCCGAGCAGAGTCC
GCTTGGGATTGGACCAAATGGACTGGCGAAGACGCTTCTCACAAGACGGAAAGAAAGCGCCTCGCATACGTGAGC
AAGCAGGCGCCTCGCCGCCAACGACTGGCTGCCGCAAACAATGAAGAGACTAAGGAAAACGACGTTCCGTATCAC
ACGGATGCTCTAACGCCGGTTGACAATGTTCCACACGTTTCAAAGAAGCGCCGGGCGTCCCTCGTTTCTGCGCAA
TCTACTTCTGCCGAGGAAAATACGTATTCCACCCCAGACACACTCTCATCGTCCAAGCAGCTGACCAACGTGAAG
GCTGAAGTTGAAGTCAAGTGCATGGCACGTACCCGTATACCGACACCACATGGTCCCGCATTTCTTCACTTGTAT
CATAATAATCATGACAAAAAGGAACATCTCGCAATCATCATAGATCCTGCCCAATTATCAGAAAATTCAACACCA
GCTCCTCCTATCCGCTCTCATTCACTCGATGCTGTCTGGGATAAAAATGAGACCGAAATGGATCGTATCACACGA
GGAGCCTATATAGGTCGCTTATCTGCTACATCGCATCATGCTTCTGATCCGTCAGATCCCGCCAGACCGTCCCTT
CCGGTCAACACTAATGTCATTCCCGCGCCCTTGATCCGCATTCACTCGGAATGCTTCACTGGAGAAACAGTTGGC
AGTATGCGCTGCGACTGTGGCGAGCAGTTAGATGAGGCGATCCGTCAAATATTCCAACCTGTCTCCGTCCCATCG
CCCGACCCTTCATCAAAACCCATCACTATACCCGGTCGCGGCGCAGTCATATATCTCCGACAAGAGGGACGAGGT
ATAGGTTTACTTTCTAAAATTCGTGCCTATAATCTTCAAGACTTGGGCCATGACACCGTCACTGCAAATCTTATG
CTCGGTTATCAGGCAGATGAACGAGGCTACGAGATTGCTGGGGCCATTCTCCGCGACCTGGGACTAGGCTCAGCA
AACGGAGTACGAGTGCTAACAAATAACCCTGACAAGGTCGAGGCCTTGAAGAGAGAAGGAGTTACAGTAGTCGAG
CACATTCCCATGATTCCACGGAGTTGGCAACATCGTAAACATCAGATGGATCAGAAGTTGGGGGATCAGGATAAG
GATGTGTTAACGCAGCGGCAAAAGGAAGAGAAGGAAAGGATGGCTGGTGCCACGCTCATTGGTGGTGGTGCTGTC
CATGGGGAAGACCTTGATAAATATTTGCGGACGAAAGTTTTACGGATGGGACATATGCTACCCCTCTGGCTGGAA
GATACCGCACCTGATTCATCTGTTTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail