Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|073970
Gene name
Locationscaffold_4:2043360..2044302
Strand+
Gene length (bp)942
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus 4.4E-19 16 93
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 1.7E-14 149 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78768|VTI1_SCHPO Vesicle transport v-SNARE protein vti1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vti1 PE=2 SV=2 9 215 8.0E-31
sp|Q9LVP9|VTI13_ARATH Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana GN=VTI13 PE=2 SV=1 9 235 5.0E-23
sp|Q9SEL5|VTI12_ARATH Vesicle transport v-SNARE 12 OS=Arabidopsis thaliana GN=VTI12 PE=1 SV=3 8 235 7.0E-23
sp|Q04338|VTI1_YEAST t-SNARE VTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTI1 PE=1 SV=3 6 216 1.0E-21
sp|O89116|VTI1A_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1A OS=Mus musculus GN=Vti1a PE=1 SV=1 9 233 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78768|VTI1_SCHPO Vesicle transport v-SNARE protein vti1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vti1 PE=2 SV=2 9 215 8.0E-31
sp|Q9LVP9|VTI13_ARATH Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana GN=VTI13 PE=2 SV=1 9 235 5.0E-23
sp|Q9SEL5|VTI12_ARATH Vesicle transport v-SNARE 12 OS=Arabidopsis thaliana GN=VTI12 PE=1 SV=3 8 235 7.0E-23
sp|Q04338|VTI1_YEAST t-SNARE VTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTI1 PE=1 SV=3 6 216 1.0E-21
sp|O89116|VTI1A_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1A OS=Mus musculus GN=Vti1a PE=1 SV=1 9 233 2.0E-19
sp|Q96AJ9|VTI1A_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1A OS=Homo sapiens GN=VTI1A PE=1 SV=2 9 228 2.0E-18
sp|Q9JI51|VTI1A_RAT Vesicle transport through interaction with t-SNAREs homolog 1A OS=Rattus norvegicus GN=Vti1a PE=1 SV=1 6 231 3.0E-18
sp|Q54CK6|VTI1A_DICDI Vesicle transport through interaction with t-SNAREs homolog 1A OS=Dictyostelium discoideum GN=vti1A PE=1 SV=1 8 208 2.0E-15
sp|Q9SEL6|VTI11_ARATH Vesicle transport v-SNARE 11 OS=Arabidopsis thaliana GN=VTI11 PE=1 SV=2 8 212 3.0E-13
sp|P58200|VTI1B_RAT Vesicle transport through interaction with t-SNAREs homolog 1B OS=Rattus norvegicus GN=Vti1b PE=1 SV=2 9 234 5.0E-12
sp|O88384|VTI1B_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1B OS=Mus musculus GN=Vti1b PE=1 SV=1 9 234 8.0E-12
sp|Q2KIU0|VTI1B_BOVIN Vesicle transport through interaction with t-SNAREs homolog 1B OS=Bos taurus GN=VTI1B PE=2 SV=1 10 230 3.0E-10
sp|Q9UEU0|VTI1B_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1B OS=Homo sapiens GN=VTI1B PE=1 SV=3 4 208 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0016020 membrane Yes
GO:0015031 protein transport No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0071705 nitrogen compound transport No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0070727 cellular macromolecule localization No
GO:0008150 biological_process No
GO:0045184 establishment of protein localization No
GO:0051641 cellular localization No
GO:0006810 transport No
GO:0008104 protein localization No
GO:0071702 organic substance transport No
GO:0033036 macromolecule localization No
GO:0046907 intracellular transport No
GO:0009987 cellular process No
GO:0051649 establishment of localization in cell No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 213 231 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|073970
MDTSPTALFESYEQDFLQFIEGIKDKLEGNGKNEIGEHRDATLRRVEMDLDEADEMVSQMEIEIQGIPQSLRTTY
LSRLKSAKSSLSIYKKSLIDTRTSLARAELFSKSPNSSSSSPDNNGGNGYYNSDDPYSDRSRLLSGTNILEDGTK
RLQESQRIALETEEQGAGILRDLRGQREQIENSRGTLWRADAAVDRASSKLKTMIRRMYQQRAVTYSIIAVLVLL
VIIIVWEKLSG*
Coding >AgabiH97|073970
ATGGACACCTCACCCACTGCCCTCTTCGAATCCTACGAACAAGACTTTCTCCAATTCATCGAAGGTATAAAAGAT
AAACTCGAAGGAAACGGAAAGAATGAAATTGGCGAACATCGAGATGCCACTTTACGAAGAGTAGAAATGGATCTC
GACGAAGCCGACGAAATGGTCTCTCAAATGGAAATCGAAATCCAAGGAATCCCTCAATCCCTCCGAACAACCTAC
CTCTCCCGTCTCAAATCCGCCAAATCCTCTTTATCAATCTACAAAAAATCTTTAATCGACACTCGCACCTCTTTA
GCCCGCGCAGAACTCTTTTCCAAATCCCCTAATTCTTCTTCTTCCTCCCCAGACAATAATGGCGGAAACGGGTAT
TACAATTCTGACGACCCGTATTCTGATCGGTCGAGATTACTTTCTGGTACGAATATACTTGAAGATGGGACCAAA
CGATTACAAGAGTCTCAACGAATTGCACTTGAGACTGAAGAGCAAGGTGCCGGTATCTTGAGAGATTTGAGAGGT
CAAAGAGAACAAATTGAGAACTCCAGAGGGACGTTATGGAGAGCAGATGCAGCTGTTGACAGAGCATCAAGTAAA
CTCAAGACGATGATTCGGAGGATGTATCAGCAGCGTGCGGTCACATACTCCATCATAGCTGTTCTCGTGCTCCTC
GTCATCATCATCGTTTGGGAGAAACTCAGCGGATGA
Transcript >AgabiH97|073970
ATGGACACCTCACCCACTGCCCTCTTCGAATCCTACGAACAAGACTTTCTCCAATTCATCGAAGGTATAAAAGAT
AAACTCGAAGGAAACGGAAAGAATGAAATTGGCGAACATCGAGATGCCACTTTACGAAGAGTAGAAATGGATCTC
GACGAAGCCGACGAAATGGTCTCTCAAATGGAAATCGAAATCCAAGGAATCCCTCAATCCCTCCGAACAACCTAC
CTCTCCCGTCTCAAATCCGCCAAATCCTCTTTATCAATCTACAAAAAATCTTTAATCGACACTCGCACCTCTTTA
GCCCGCGCAGAACTCTTTTCCAAATCCCCTAATTCTTCTTCTTCCTCCCCAGACAATAATGGCGGAAACGGGTAT
TACAATTCTGACGACCCGTATTCTGATCGGTCGAGATTACTTTCTGGTACGAATATACTTGAAGATGGGACCAAA
CGATTACAAGAGTCTCAACGAATTGCACTTGAGACTGAAGAGCAAGGTGCCGGTATCTTGAGAGATTTGAGAGGT
CAAAGAGAACAAATTGAGAACTCCAGAGGGACGTTATGGAGAGCAGATGCAGCTGTTGACAGAGCATCAAGTAAA
CTCAAGACGATGATTCGGAGGATGTATCAGCAGCGTGCGGTCACATACTCCATCATAGCTGTTCTCGTGCTCCTC
GTCATCATCATCGTTTGGGAGAAACTCAGCGGATGA
Gene >AgabiH97|073970
ATGGACACCTCACCCACTGCCCTCTTCGAATCCTACGAACAAGACTTTCTCCAATTCATCGAAGGTATAAAAGAT
AAACTCGAAGGAAACGGAAAGAATGAAATTGGCGGTACGTTTAAAACCCATAACATTTAATTATTCAGCGCTTAT
TTTTGTGTTGCATAGAACATCGAGATGCCACTTTACGAAGAGTAGAAATGGATCTCGACGAAGCCGACGAAATGG
TTAGTAGCAAAACACCTTTCCACATTTCCAGTTAATCATTTTAACATATCCCTCAACAGGTCTCTCAAATGGAAA
TCGAAATCCAAGGAATCCCTCAATCCCTCCGAACAACCTACCTCTCCCGTCTCAAATCCGCCAAATCCTCTTTAT
CAATCTACAAAAAATCTTTAATCGACACTCGCACCTCTTTAGCCCGCGCAGAACTCTTTTCCAAATCCCCTAATT
CTTCTTCTTCCTCCCCAGACAATAATGGCGGAAACGGGTATTACAATTCTGACGACCCGTATTCTGATCGGTCGA
GATTACTTTCTGGTACGAATATACTTGAAGATGGGACCAAACGATTACAAGAGTCTCAACGAATTGCACTTGAGA
CTGAAGAGCAAGGTGCCGGTATCTTGAGAGATTTGAGAGGTCAAAGAGAACAAATTGAGAACTCCAGAGGGACGG
TAAGTCATTACTACACCCGCACGTAATTTCTATACTCATATCATTTCCAAAAAGTTATGGAGAGCAGATGCAGCT
GTTGACAGAGCATCAAGTAAACTCAAGACGATGATTCGGAGGTCAGAACACAGCTCACTCCCTGCCCCATTATTT
TGTTGTTGAAACATAACATCTCACAGGATGTATCAGCAGCGTGCGGTCACATACTCCATCATAGCTGTTCTCGTG
CTCCTCGTCATCATCATCGTTTGGGAGAAACTCAGCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail