Protein ID | AgabiH97|073750 |
Gene name | |
Location | scaffold_4:2005437..2007571 |
Strand | + |
Gene length (bp) | 2134 |
Transcript length (bp) | 1803 |
Coding sequence length (bp) | 1803 |
Protein length (aa) | 601 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01808 | AICARFT_IMPCHas | AICARFT/IMPCHase bienzyme | 1.5E-91 | 134 | 468 |
PF02142 | MGS | MGS-like domain | 2.2E-24 | 16 | 129 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P54113|PUR91_YEAST | Bifunctional purine biosynthesis protein ADE16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE16 PE=1 SV=1 | 6 | 600 | 0.0E+00 |
sp|P38009|PUR92_YEAST | Bifunctional purine biosynthesis protein ADE17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE17 PE=1 SV=2 | 6 | 600 | 0.0E+00 |
sp|O74928|PUR9_SCHPO | Bifunctional purine biosynthesis protein ade10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade10 PE=2 SV=1 | 6 | 600 | 0.0E+00 |
sp|Q9CWJ9|PUR9_MOUSE | Bifunctional purine biosynthesis protein PURH OS=Mus musculus GN=Atic PE=1 SV=2 | 2 | 600 | 0.0E+00 |
sp|O35567|PUR9_RAT | Bifunctional purine biosynthesis protein PURH OS=Rattus norvegicus GN=Atic PE=1 SV=2 | 4 | 600 | 0.0E+00 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P54113|PUR91_YEAST | Bifunctional purine biosynthesis protein ADE16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE16 PE=1 SV=1 | 6 | 600 | 0.0E+00 |
sp|P38009|PUR92_YEAST | Bifunctional purine biosynthesis protein ADE17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE17 PE=1 SV=2 | 6 | 600 | 0.0E+00 |
sp|O74928|PUR9_SCHPO | Bifunctional purine biosynthesis protein ade10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade10 PE=2 SV=1 | 6 | 600 | 0.0E+00 |
sp|Q9CWJ9|PUR9_MOUSE | Bifunctional purine biosynthesis protein PURH OS=Mus musculus GN=Atic PE=1 SV=2 | 2 | 600 | 0.0E+00 |
sp|O35567|PUR9_RAT | Bifunctional purine biosynthesis protein PURH OS=Rattus norvegicus GN=Atic PE=1 SV=2 | 4 | 600 | 0.0E+00 |
sp|Q5R5C2|PUR9_PONAB | Bifunctional purine biosynthesis protein PURH OS=Pongo abelii GN=ATIC PE=2 SV=1 | 2 | 600 | 0.0E+00 |
sp|P31939|PUR9_HUMAN | Bifunctional purine biosynthesis protein PURH OS=Homo sapiens GN=ATIC PE=1 SV=3 | 2 | 600 | 0.0E+00 |
sp|Q0VCK0|PUR9_BOVIN | Bifunctional purine biosynthesis protein PURH OS=Bos taurus GN=ATIC PE=2 SV=1 | 2 | 600 | 0.0E+00 |
sp|P31335|PUR9_CHICK | Bifunctional purine biosynthesis protein PURH OS=Gallus gallus GN=ATIC PE=1 SV=1 | 3 | 600 | 0.0E+00 |
sp|A4WWQ0|PUR9_RHOS5 | Bifunctional purine biosynthesis protein PurH OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=purH PE=3 SV=1 | 1 | 600 | 5.0E-93 |
sp|B9KP36|PUR9_RHOSK | Bifunctional purine biosynthesis protein PurH OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=purH PE=3 SV=1 | 1 | 600 | 6.0E-93 |
sp|Q3IYU8|PUR9_RHOS4 | Bifunctional purine biosynthesis protein PurH OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=purH PE=3 SV=1 | 1 | 600 | 6.0E-93 |
sp|A3PNE9|PUR9_RHOS1 | Bifunctional purine biosynthesis protein PurH OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=purH PE=3 SV=1 | 1 | 600 | 6.0E-93 |
sp|Q7N954|PUR9_PHOLL | Bifunctional purine biosynthesis protein PurH OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=purH PE=3 SV=1 | 2 | 600 | 4.0E-92 |
sp|Q8DIN5|PUR9_THEEB | Bifunctional purine biosynthesis protein PurH OS=Thermosynechococcus elongatus (strain BP-1) GN=purH PE=3 SV=1 | 5 | 466 | 3.0E-91 |
sp|B4TQL6|PUR9_SALSV | Bifunctional purine biosynthesis protein PurH OS=Salmonella schwarzengrund (strain CVM19633) GN=purH PE=3 SV=1 | 2 | 600 | 8.0E-91 |
sp|A4TS14|PUR9_YERPP | Bifunctional purine biosynthesis protein PurH OS=Yersinia pestis (strain Pestoides F) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-90 |
sp|Q1CN60|PUR9_YERPN | Bifunctional purine biosynthesis protein PurH OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-90 |
sp|A9R8E1|PUR9_YERPG | Bifunctional purine biosynthesis protein PurH OS=Yersinia pestis bv. Antiqua (strain Angola) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-90 |
sp|Q8ZAR3|PUR9_YERPE | Bifunctional purine biosynthesis protein PurH OS=Yersinia pestis GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-90 |
sp|Q1C1V9|PUR9_YERPA | Bifunctional purine biosynthesis protein PurH OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-90 |
sp|A7FNG6|PUR9_YERP3 | Bifunctional purine biosynthesis protein PurH OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-90 |
sp|B1JJL6|PUR9_YERPY | Bifunctional purine biosynthesis protein PurH OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-90 |
sp|Q66FN5|PUR9_YERPS | Bifunctional purine biosynthesis protein PurH OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-90 |
sp|B2K130|PUR9_YERPB | Bifunctional purine biosynthesis protein PurH OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-90 |
sp|Q16CE0|PUR9_ROSDO | Bifunctional purine biosynthesis protein PurH OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-90 |
sp|B4T108|PUR9_SALNS | Bifunctional purine biosynthesis protein PurH OS=Salmonella newport (strain SL254) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-90 |
sp|A8G8G3|PUR9_SERP5 | Bifunctional purine biosynthesis protein PurH OS=Serratia proteamaculans (strain 568) GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-90 |
sp|A9N0L8|PUR9_SALPB | Bifunctional purine biosynthesis protein PurH OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=purH PE=3 SV=1 | 2 | 600 | 4.0E-90 |
sp|P26978|PUR9_SALTY | Bifunctional purine biosynthesis protein PurH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=purH PE=3 SV=2 | 2 | 600 | 4.0E-90 |
sp|A1JIJ7|PUR9_YERE8 | Bifunctional purine biosynthesis protein PurH OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=purH PE=3 SV=1 | 2 | 600 | 4.0E-90 |
sp|B4TDF3|PUR9_SALHS | Bifunctional purine biosynthesis protein PurH OS=Salmonella heidelberg (strain SL476) GN=purH PE=3 SV=1 | 2 | 600 | 6.0E-90 |
sp|A1S2J9|PUR9_SHEAM | Bifunctional purine biosynthesis protein PurH OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=purH PE=3 SV=1 | 2 | 600 | 6.0E-90 |
sp|Q8Z335|PUR9_SALTI | Bifunctional purine biosynthesis protein PurH OS=Salmonella typhi GN=purH PE=3 SV=1 | 2 | 600 | 7.0E-90 |
sp|B5BJS5|PUR9_SALPK | Bifunctional purine biosynthesis protein PurH OS=Salmonella paratyphi A (strain AKU_12601) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-89 |
sp|Q5PKA9|PUR9_SALPA | Bifunctional purine biosynthesis protein PurH OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-89 |
sp|C6DHT5|PUR9_PECCP | Bifunctional purine biosynthesis protein PurH OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-89 |
sp|B5F1I9|PUR9_SALA4 | Bifunctional purine biosynthesis protein PurH OS=Salmonella agona (strain SL483) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-89 |
sp|Q3YUX8|PUR9_SHISS | Bifunctional purine biosynthesis protein PurH OS=Shigella sonnei (strain Ss046) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-89 |
sp|Q83IR9|PUR9_SHIFL | Bifunctional purine biosynthesis protein PurH OS=Shigella flexneri GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-89 |
sp|Q0SXZ4|PUR9_SHIF8 | Bifunctional purine biosynthesis protein PurH OS=Shigella flexneri serotype 5b (strain 8401) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-89 |
sp|Q32AH9|PUR9_SHIDS | Bifunctional purine biosynthesis protein PurH OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-89 |
sp|Q31TZ1|PUR9_SHIBS | Bifunctional purine biosynthesis protein PurH OS=Shigella boydii serotype 4 (strain Sb227) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-89 |
sp|B2TWJ3|PUR9_SHIB3 | Bifunctional purine biosynthesis protein PurH OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-89 |
sp|B6I5L8|PUR9_ECOSE | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain SE11) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-89 |
sp|B7M7R5|PUR9_ECO8A | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O8 (strain IAI1) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-89 |
sp|Q6DAL2|PUR9_PECAS | Bifunctional purine biosynthesis protein PurH OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-89 |
sp|B5Z0A3|PUR9_ECO5E | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-89 |
sp|Q8X611|PUR9_ECO57 | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O157:H7 GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-89 |
sp|P15639|PUR9_ECOLI | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain K12) GN=purH PE=1 SV=1 | 2 | 600 | 3.0E-89 |
sp|B1IUP1|PUR9_ECOLC | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-89 |
sp|B1XC09|PUR9_ECODH | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain K12 / DH10B) GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-89 |
sp|C5A0U7|PUR9_ECOBW | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-89 |
sp|B7LAV3|PUR9_ECO55 | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain 55989 / EAEC) GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-89 |
sp|Q2NWQ7|PUR9_SODGM | Bifunctional purine biosynthesis protein PurH OS=Sodalis glossinidius (strain morsitans) GN=purH PE=3 SV=1 | 2 | 600 | 4.0E-89 |
sp|B7LUJ6|PUR9_ESCF3 | Bifunctional purine biosynthesis protein PurH OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=purH PE=3 SV=1 | 2 | 600 | 4.0E-89 |
sp|B5XYD2|PUR9_KLEP3 | Bifunctional purine biosynthesis protein PurH OS=Klebsiella pneumoniae (strain 342) GN=purH PE=3 SV=1 | 2 | 600 | 5.0E-89 |
sp|A8AKS0|PUR9_CITK8 | Bifunctional purine biosynthesis protein PurH OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=purH PE=3 SV=1 | 2 | 600 | 6.0E-89 |
sp|A8A7A6|PUR9_ECOHS | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O9:H4 (strain HS) GN=purH PE=3 SV=1 | 2 | 600 | 8.0E-89 |
sp|B7MRD0|PUR9_ECO81 | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O81 (strain ED1a) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-88 |
sp|B7NFU7|PUR9_ECOLU | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-88 |
sp|Q0TA59|PUR9_ECOL5 | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-88 |
sp|A6TGR3|PUR9_KLEP7 | Bifunctional purine biosynthesis protein PurH OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-88 |
sp|B5FQM1|PUR9_SALDC | Bifunctional purine biosynthesis protein PurH OS=Salmonella dublin (strain CT_02021853) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-88 |
sp|Q74FJ9|PUR9_GEOSL | Bifunctional purine biosynthesis protein PurH OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=purH PE=3 SV=1 | 6 | 493 | 2.0E-88 |
sp|Q1R5X1|PUR9_ECOUT | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain UTI89 / UPEC) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-88 |
sp|A1AIH7|PUR9_ECOK1 | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O1:K1 / APEC GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-88 |
sp|B7MIZ2|PUR9_ECO45 | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-88 |
sp|B7NRT9|PUR9_ECO7I | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-88 |
sp|B5RFH8|PUR9_SALG2 | Bifunctional purine biosynthesis protein PurH OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=purH PE=3 SV=1 | 2 | 600 | 4.0E-88 |
sp|B5QYG1|PUR9_SALEP | Bifunctional purine biosynthesis protein PurH OS=Salmonella enteritidis PT4 (strain P125109) GN=purH PE=3 SV=1 | 2 | 600 | 4.0E-88 |
sp|A7MJ89|PUR9_CROS8 | Bifunctional purine biosynthesis protein PurH OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=purH PE=3 SV=1 | 2 | 600 | 5.0E-88 |
sp|Q1GKJ2|PUR9_RUEST | Bifunctional purine biosynthesis protein PurH OS=Ruegeria sp. (strain TM1040) GN=purH PE=3 SV=1 | 2 | 600 | 6.0E-88 |
sp|C0Q2T8|PUR9_SALPC | Bifunctional purine biosynthesis protein PurH OS=Salmonella paratyphi C (strain RKS4594) GN=purH PE=3 SV=1 | 2 | 600 | 8.0E-88 |
sp|B1LPG6|PUR9_ECOSM | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=purH PE=3 SV=1 | 2 | 600 | 9.0E-88 |
sp|B7UPG1|PUR9_ECO27 | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-87 |
sp|A8LMD0|PUR9_DINSH | Bifunctional purine biosynthesis protein PurH OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=purH PE=3 SV=1 | 1 | 600 | 1.0E-87 |
sp|A7ZUM3|PUR9_ECO24 | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-87 |
sp|B4S133|PUR9_ALTMD | Bifunctional purine biosynthesis protein PurH OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-87 |
sp|Q8FB68|PUR9_ECOL6 | Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-87 |
sp|Q8YSJ2|PUR9_NOSS1 | Bifunctional purine biosynthesis protein PurH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=purH PE=3 SV=1 | 5 | 466 | 4.0E-87 |
sp|B7K3N8|PUR9_CYAP8 | Bifunctional purine biosynthesis protein PurH OS=Cyanothece sp. (strain PCC 8801) GN=purH PE=3 SV=1 | 5 | 466 | 4.0E-87 |
sp|Q116T4|PUR9_TRIEI | Bifunctional purine biosynthesis protein PurH OS=Trichodesmium erythraeum (strain IMS101) GN=purH PE=3 SV=1 | 3 | 466 | 6.0E-87 |
sp|A9MHC3|PUR9_SALAR | Bifunctional purine biosynthesis protein PurH OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=purH PE=3 SV=1 | 6 | 600 | 7.0E-87 |
sp|A9GIT1|PUR9_SORC5 | Bifunctional purine biosynthesis protein PurH OS=Sorangium cellulosum (strain So ce56) GN=purH PE=3 SV=1 | 6 | 469 | 9.0E-87 |
sp|B2IX54|PUR9_NOSP7 | Bifunctional purine biosynthesis protein PurH OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=purH PE=3 SV=1 | 4 | 466 | 9.0E-87 |
sp|Q3JC90|PUR9_NITOC | Bifunctional purine biosynthesis protein PurH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=purH PE=3 SV=1 | 6 | 496 | 9.0E-87 |
sp|Q8Y232|PUR9_RALSO | Bifunctional purine biosynthesis protein PurH OS=Ralstonia solanacearum (strain GMI1000) GN=purH PE=3 SV=1 | 6 | 600 | 1.0E-86 |
sp|A0LDB0|PUR9_MAGMM | Bifunctional purine biosynthesis protein PurH OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=purH PE=3 SV=1 | 6 | 600 | 2.0E-86 |
sp|Q3M6G3|PUR9_ANAVT | Bifunctional purine biosynthesis protein PurH OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=purH PE=3 SV=1 | 5 | 466 | 2.0E-86 |
sp|Q3AN13|PUR9_SYNSC | Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9605) GN=purH PE=3 SV=1 | 5 | 466 | 3.0E-86 |
sp|Q8PD47|PUR9_XANCP | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=purH PE=3 SV=1 | 1 | 471 | 3.0E-86 |
sp|B0RN27|PUR9_XANCB | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas campestris pv. campestris (strain B100) GN=purH PE=3 SV=1 | 1 | 471 | 3.0E-86 |
sp|Q4UZD2|PUR9_XANC8 | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas campestris pv. campestris (strain 8004) GN=purH PE=3 SV=1 | 1 | 471 | 3.0E-86 |
sp|Q0AW31|PUR9_SYNWW | Bifunctional purine biosynthesis protein PurH OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=purH PE=3 SV=1 | 6 | 466 | 4.0E-86 |
sp|B2FJP9|PUR9_STRMK | Bifunctional purine biosynthesis protein PurH OS=Stenotrophomonas maltophilia (strain K279a) GN=purH PE=3 SV=1 | 1 | 469 | 5.0E-86 |
sp|Q98ES7|PUR9_RHILO | Bifunctional purine biosynthesis protein PurH OS=Rhizobium loti (strain MAFF303099) GN=purH PE=3 SV=1 | 1 | 600 | 7.0E-86 |
sp|B4SL92|PUR9_STRM5 | Bifunctional purine biosynthesis protein PurH OS=Stenotrophomonas maltophilia (strain R551-3) GN=purH PE=3 SV=1 | 1 | 469 | 1.0E-85 |
sp|A3NDF2|PUR9_BURP6 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 668) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-85 |
sp|A3NZ64|PUR9_BURP0 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 1106a) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-85 |
sp|A1V068|PUR9_BURMS | Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain SAVP1) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-85 |
sp|Q62HA6|PUR9_BURMA | Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain ATCC 23344) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-85 |
sp|A2S597|PUR9_BURM9 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain NCTC 10229) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-85 |
sp|A3MP76|PUR9_BURM7 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain NCTC 10247) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-85 |
sp|Q63QX8|PUR9_BURPS | Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain K96243) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-85 |
sp|Q3JNS8|PUR9_BURP1 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 1710b) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-85 |
sp|B2UFL5|PUR9_RALPJ | Bifunctional purine biosynthesis protein PurH OS=Ralstonia pickettii (strain 12J) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-85 |
sp|Q2SZ52|PUR9_BURTA | Bifunctional purine biosynthesis protein PurH OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=purH PE=3 SV=1 | 6 | 469 | 3.0E-85 |
sp|B6ENA8|PUR9_ALISL | Bifunctional purine biosynthesis protein PurH OS=Aliivibrio salmonicida (strain LFI1238) GN=purH PE=3 SV=1 | 2 | 600 | 6.0E-85 |
sp|B3QS62|PUR9_CHLT3 | Bifunctional purine biosynthesis protein PurH OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=purH PE=3 SV=1 | 6 | 466 | 6.0E-85 |
sp|A9AH70|PUR9_BURM1 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=purH PE=3 SV=1 | 6 | 469 | 8.0E-85 |
sp|Q1H4G7|PUR9_METFK | Bifunctional purine biosynthesis protein PurH OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=purH PE=3 SV=1 | 6 | 600 | 9.0E-85 |
sp|Q31II8|PUR9_THICR | Bifunctional purine biosynthesis protein PurH OS=Thiomicrospira crunogena (strain XCL-2) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-84 |
sp|Q0VMY5|PUR9_ALCBS | Bifunctional purine biosynthesis protein PurH OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=purH PE=3 SV=1 | 6 | 495 | 1.0E-84 |
sp|A1B5K8|PUR9_PARDP | Bifunctional purine biosynthesis protein PurH OS=Paracoccus denitrificans (strain Pd 1222) GN=purH PE=3 SV=1 | 1 | 600 | 2.0E-84 |
sp|A9WEK8|PUR9_CHLAA | Bifunctional purine biosynthesis protein PurH OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-84 |
sp|Q87KT0|PUR9_VIBPA | Bifunctional purine biosynthesis protein PurH OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purH PE=3 SV=1 | 2 | 600 | 3.0E-84 |
sp|Q2P866|PUR9_XANOM | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=purH PE=3 SV=1 | 1 | 496 | 7.0E-84 |
sp|A7MXG0|PUR9_VIBCB | Bifunctional purine biosynthesis protein PurH OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=purH PE=3 SV=1 | 2 | 600 | 7.0E-84 |
sp|B4EES4|PUR9_BURCJ | Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=purH PE=3 SV=1 | 6 | 469 | 7.0E-84 |
sp|C4LA41|PUR9_TOLAT | Bifunctional purine biosynthesis protein PurH OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=purH PE=3 SV=1 | 2 | 600 | 7.0E-84 |
sp|Q5H5H7|PUR9_XANOR | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=purH PE=3 SV=1 | 1 | 496 | 1.0E-83 |
sp|A7HSQ6|PUR9_PARL1 | Bifunctional purine biosynthesis protein PurH OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=purH PE=3 SV=1 | 6 | 600 | 1.0E-83 |
sp|B0UWT1|PUR9_HISS2 | Bifunctional purine biosynthesis protein PurH OS=Histophilus somni (strain 2336) GN=purH PE=3 SV=1 | 2 | 495 | 3.0E-83 |
sp|B0KBQ1|PUR9_THEP3 | Bifunctional purine biosynthesis protein PurH OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=purH PE=3 SV=1 | 6 | 600 | 3.0E-83 |
sp|B8HPG4|PUR9_CYAP4 | Bifunctional purine biosynthesis protein PurH OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=purH PE=3 SV=1 | 5 | 466 | 3.0E-83 |
sp|B7KGS0|PUR9_CYAP7 | Bifunctional purine biosynthesis protein PurH OS=Cyanothece sp. (strain PCC 7424) GN=purH PE=3 SV=1 | 4 | 466 | 3.0E-83 |
sp|Q8RC55|PUR9_CALS4 | Bifunctional purine biosynthesis protein PurH OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=purH PE=3 SV=1 | 6 | 600 | 3.0E-83 |
sp|Q5LN38|PUR9_RUEPO | Bifunctional purine biosynthesis protein PurH OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=purH PE=3 SV=1 | 2 | 469 | 3.0E-83 |
sp|Q13UC4|PUR9_BURXL | Bifunctional purine biosynthesis protein PurH OS=Burkholderia xenovorans (strain LB400) GN=purH PE=3 SV=1 | 6 | 469 | 4.0E-83 |
sp|B2SRB2|PUR9_XANOP | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=purH PE=3 SV=1 | 1 | 496 | 4.0E-83 |
sp|Q0IDE8|PUR9_SYNS3 | Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9311) GN=purH PE=3 SV=1 | 6 | 466 | 7.0E-83 |
sp|B0K3Q8|PUR9_THEPX | Bifunctional purine biosynthesis protein PurH OS=Thermoanaerobacter sp. (strain X514) GN=purH PE=3 SV=1 | 6 | 600 | 8.0E-83 |
sp|A4JBL5|PUR9_BURVG | Bifunctional purine biosynthesis protein PurH OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=purH PE=3 SV=1 | 6 | 469 | 9.0E-83 |
sp|C3LQN2|PUR9_VIBCM | Bifunctional purine biosynthesis protein PurH OS=Vibrio cholerae serotype O1 (strain M66-2) GN=purH PE=3 SV=1 | 2 | 600 | 9.0E-83 |
sp|Q9KV80|PUR9_VIBCH | Bifunctional purine biosynthesis protein PurH OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purH PE=3 SV=1 | 2 | 600 | 9.0E-83 |
sp|Q0I557|PUR9_HAES1 | Bifunctional purine biosynthesis protein PurH OS=Haemophilus somnus (strain 129Pt) GN=purH PE=3 SV=1 | 2 | 495 | 9.0E-83 |
sp|Q2RN46|PUR9_RHORT | Bifunctional purine biosynthesis protein PurH OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=purH PE=3 SV=1 | 1 | 600 | 1.0E-82 |
sp|A1AS76|PUR9_PELPD | Bifunctional purine biosynthesis protein PurH OS=Pelobacter propionicus (strain DSM 2379) GN=purH PE=3 SV=1 | 6 | 493 | 1.0E-82 |
sp|A5F3U8|PUR9_VIBC3 | Bifunctional purine biosynthesis protein PurH OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=purH PE=3 SV=1 | 2 | 600 | 1.0E-82 |
sp|Q0BI80|PUR9_BURCM | Bifunctional purine biosynthesis protein PurH OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=purH PE=3 SV=1 | 6 | 469 | 1.0E-82 |
sp|Q1D898|PUR9_MYXXD | Bifunctional purine biosynthesis protein PurH OS=Myxococcus xanthus (strain DK 1622) GN=purH PE=3 SV=1 | 5 | 600 | 1.0E-82 |
sp|B1JVV6|PUR9_BURCC | Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain MC0-3) GN=purH PE=3 SV=1 | 6 | 469 | 1.0E-82 |
sp|P57828|PUR9_PASMU | Bifunctional purine biosynthesis protein PurH OS=Pasteurella multocida (strain Pm70) GN=purH PE=3 SV=1 | 2 | 495 | 1.0E-82 |
sp|P74741|PUR9_SYNY3 | Bifunctional purine biosynthesis protein PurH OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purH PE=3 SV=2 | 4 | 466 | 1.0E-82 |
sp|A2CCK6|PUR9_PROM3 | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9303) GN=purH PE=3 SV=1 | 5 | 466 | 1.0E-82 |
sp|Q39RK1|PUR9_GEOMG | Bifunctional purine biosynthesis protein PurH OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=purH PE=3 SV=1 | 6 | 493 | 2.0E-82 |
sp|Q1BZ33|PUR9_BURCA | Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain AU 1054) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-82 |
sp|Q39JI8|PUR9_BURL3 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-82 |
sp|Q7TUM7|PUR9_PROMM | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9313) GN=purH PE=3 SV=1 | 5 | 466 | 2.0E-82 |
sp|Q1LRB3|PUR9_CUPMC | Bifunctional purine biosynthesis protein PurH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-82 |
sp|Q088G0|PUR9_SHEFN | Bifunctional purine biosynthesis protein PurH OS=Shewanella frigidimarina (strain NCIMB 400) GN=purH PE=3 SV=1 | 2 | 469 | 3.0E-82 |
sp|B2G5C2|PUR9_LACRJ | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus reuteri (strain JCM 1112) GN=purH PE=3 SV=1 | 6 | 600 | 3.0E-82 |
sp|A5VHU2|PUR9_LACRD | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus reuteri (strain DSM 20016) GN=purH PE=3 SV=1 | 6 | 600 | 3.0E-82 |
sp|B1YTE2|PUR9_BURA4 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia ambifaria (strain MC40-6) GN=purH PE=3 SV=1 | 6 | 469 | 3.0E-82 |
sp|A6WXV3|PUR9_OCHA4 | Bifunctional purine biosynthesis protein PurH OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=purH PE=3 SV=1 | 6 | 600 | 3.0E-82 |
sp|A0K4L7|PUR9_BURCH | Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain HI2424) GN=purH PE=3 SV=1 | 6 | 469 | 4.0E-82 |
sp|Q88U29|PUR9_LACPL | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=purH PE=3 SV=1 | 6 | 600 | 5.0E-82 |
sp|B1XS23|PUR9_POLNS | Bifunctional purine biosynthesis protein PurH OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=purH PE=3 SV=1 | 6 | 469 | 5.0E-82 |
sp|A0KGJ2|PUR9_AERHH | Bifunctional purine biosynthesis protein PurH OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=purH PE=3 SV=1 | 2 | 471 | 6.0E-82 |
sp|B0BZH9|PUR9_ACAM1 | Bifunctional purine biosynthesis protein PurH OS=Acaryochloris marina (strain MBIC 11017) GN=purH PE=3 SV=1 | 5 | 466 | 7.0E-82 |
sp|B7H4U0|PUR9_BACC4 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain B4264) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-81 |
sp|B7JM89|PUR9_BACC0 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain AH820) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-81 |
sp|Q81ZG8|PUR9_BACAN | Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-81 |
sp|C3L536|PUR9_BACAC | Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-81 |
sp|C3PBN4|PUR9_BACAA | Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis (strain A0248) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-81 |
sp|Q81IP9|PUR9_BACCR | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-81 |
sp|B2JGU1|PUR9_BURP8 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-81 |
sp|Q8PQ19|PUR9_XANAC | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas axonopodis pv. citri (strain 306) GN=purH PE=3 SV=1 | 1 | 471 | 2.0E-81 |
sp|B7HS36|PUR9_BACC7 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain AH187) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-81 |
sp|B9J1K9|PUR9_BACCQ | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain Q1) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-81 |
sp|C1EV67|PUR9_BACC3 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain 03BB102) GN=purH PE=3 SV=1 | 6 | 466 | 4.0E-81 |
sp|Q73EN1|PUR9_BACC1 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=purH PE=3 SV=1 | 6 | 466 | 4.0E-81 |
sp|B2SYJ7|PUR9_BURPP | Bifunctional purine biosynthesis protein PurH OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=purH PE=3 SV=1 | 6 | 469 | 4.0E-81 |
sp|Q87D58|PUR9_XYLFT | Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=purH PE=3 SV=1 | 1 | 600 | 5.0E-81 |
sp|B2I4L7|PUR9_XYLF2 | Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain M23) GN=purH PE=3 SV=1 | 1 | 600 | 5.0E-81 |
sp|Q475R4|PUR9_CUPPJ | Bifunctional purine biosynthesis protein PurH OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=purH PE=3 SV=1 | 6 | 469 | 5.0E-81 |
sp|Q3BY85|PUR9_XANC5 | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=purH PE=3 SV=1 | 1 | 471 | 5.0E-81 |
sp|A0R900|PUR9_BACAH | Bifunctional purine biosynthesis protein PurH OS=Bacillus thuringiensis (strain Al Hakam) GN=purH PE=3 SV=1 | 6 | 466 | 6.0E-81 |
sp|Q6HPA0|PUR9_BACHK | Bifunctional purine biosynthesis protein PurH OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=purH PE=3 SV=1 | 6 | 466 | 9.0E-81 |
sp|A4SR98|PUR9_AERS4 | Bifunctional purine biosynthesis protein PurH OS=Aeromonas salmonicida (strain A449) GN=purH PE=3 SV=1 | 2 | 471 | 1.0E-80 |
sp|Q89WU7|PUR9_BRADU | Bifunctional purine biosynthesis protein PurH OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=purH PE=3 SV=1 | 6 | 600 | 1.0E-80 |
sp|Q12IP4|PUR9_SHEDO | Bifunctional purine biosynthesis protein PurH OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=purH PE=3 SV=1 | 2 | 469 | 1.0E-80 |
sp|A9VRF5|PUR9_BACWK | Bifunctional purine biosynthesis protein PurH OS=Bacillus weihenstephanensis (strain KBAB4) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-80 |
sp|A4T025|PUR9_POLSQ | Bifunctional purine biosynthesis protein PurH OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=purH PE=3 SV=1 | 6 | 471 | 3.0E-80 |
sp|B7IUV7|PUR9_BACC2 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain G9842) GN=purH PE=3 SV=1 | 6 | 466 | 4.0E-80 |
sp|B8CTW4|PUR9_SHEPW | Bifunctional purine biosynthesis protein PurH OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=purH PE=3 SV=1 | 2 | 496 | 5.0E-80 |
sp|Q6G5S5|PUR9_BARHE | Bifunctional purine biosynthesis protein PurH OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=purH PE=3 SV=1 | 7 | 600 | 5.0E-80 |
sp|A1UR09|PUR9_BARBK | Bifunctional purine biosynthesis protein PurH OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=purH PE=3 SV=1 | 6 | 600 | 1.0E-79 |
sp|A8GZM3|PUR9_SHEPA | Bifunctional purine biosynthesis protein PurH OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=purH PE=3 SV=1 | 2 | 496 | 1.0E-79 |
sp|Q8EJM1|PUR9_SHEON | Bifunctional purine biosynthesis protein PurH OS=Shewanella oneidensis (strain MR-1) GN=purH PE=3 SV=1 | 2 | 469 | 1.0E-79 |
sp|Q3B083|PUR9_SYNS9 | Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9902) GN=purH PE=3 SV=1 | 5 | 466 | 1.0E-79 |
sp|B0TR91|PUR9_SHEHH | Bifunctional purine biosynthesis protein PurH OS=Shewanella halifaxensis (strain HAW-EB4) GN=purH PE=3 SV=1 | 2 | 496 | 2.0E-79 |
sp|Q9PC10|PUR9_XYLFA | Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain 9a5c) GN=purH PE=3 SV=2 | 1 | 469 | 2.0E-79 |
sp|A1SZJ2|PUR9_PSYIN | Bifunctional purine biosynthesis protein PurH OS=Psychromonas ingrahamii (strain 37) GN=purH PE=3 SV=1 | 2 | 600 | 2.0E-79 |
sp|P43852|PUR9_HAEIN | Bifunctional purine biosynthesis protein PurH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purH PE=3 SV=1 | 2 | 495 | 3.0E-79 |
sp|Q3A2D6|PUR9_PELCD | Bifunctional purine biosynthesis protein PurH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=purH PE=3 SV=1 | 6 | 496 | 3.0E-79 |
sp|Q63GS9|PUR9_BACCZ | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ZK / E33L) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-79 |
sp|B0TEC5|PUR9_HELMI | Bifunctional purine biosynthesis protein PurH OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=purH PE=3 SV=1 | 6 | 466 | 4.0E-79 |
sp|Q5FIV5|PUR9_LACAC | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=purH PE=3 SV=1 | 6 | 466 | 4.0E-79 |
sp|Q7MGT5|PUR9_VIBVY | Bifunctional purine biosynthesis protein PurH OS=Vibrio vulnificus (strain YJ016) GN=purH PE=3 SV=1 | 2 | 496 | 5.0E-79 |
sp|Q8DD06|PUR9_VIBVU | Bifunctional purine biosynthesis protein PurH OS=Vibrio vulnificus (strain CMCP6) GN=purH PE=3 SV=1 | 2 | 496 | 5.0E-79 |
sp|A4SDE6|PUR9_CHLPM | Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=purH PE=3 SV=1 | 6 | 522 | 5.0E-79 |
sp|B9M4Q6|PUR9_GEODF | Bifunctional purine biosynthesis protein PurH OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=purH PE=3 SV=1 | 6 | 493 | 8.0E-79 |
sp|B3E7F6|PUR9_GEOLS | Bifunctional purine biosynthesis protein PurH OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=purH PE=3 SV=1 | 6 | 512 | 8.0E-79 |
sp|A5GIF4|PUR9_SYNPW | Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain WH7803) GN=purH PE=3 SV=1 | 6 | 466 | 9.0E-79 |
sp|Q5E257|PUR9_VIBF1 | Bifunctional purine biosynthesis protein PurH OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=purH PE=3 SV=1 | 2 | 496 | 1.0E-78 |
sp|Q7TTX6|PUR9_SYNPX | Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain WH8102) GN=purH PE=3 SV=1 | 5 | 465 | 1.0E-78 |
sp|B0JL55|PUR9_MICAN | Bifunctional purine biosynthesis protein PurH OS=Microcystis aeruginosa (strain NIES-843) GN=purH PE=3 SV=1 | 4 | 466 | 1.0E-78 |
sp|A8FQD4|PUR9_SHESH | Bifunctional purine biosynthesis protein PurH OS=Shewanella sediminis (strain HAW-EB3) GN=purH PE=3 SV=1 | 2 | 469 | 1.0E-78 |
sp|O67775|PUR9_AQUAE | Bifunctional purine biosynthesis protein PurH OS=Aquifex aeolicus (strain VF5) GN=purH PE=3 SV=1 | 6 | 469 | 3.0E-78 |
sp|Q3IIC3|PUR9_PSEHT | Bifunctional purine biosynthesis protein PurH OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=purH PE=3 SV=1 | 2 | 469 | 3.0E-78 |
sp|Q7VDS0|PUR9_PROMA | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=purH PE=3 SV=1 | 5 | 466 | 4.0E-78 |
sp|Q7P0M1|PUR9_CHRVO | Bifunctional purine biosynthesis protein PurH OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=purH PE=3 SV=1 | 6 | 469 | 7.0E-78 |
sp|Q0KEC0|PUR9_CUPNH | Bifunctional purine biosynthesis protein PurH OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=purH PE=3 SV=1 | 6 | 469 | 7.0E-78 |
sp|A3QII0|PUR9_SHELP | Bifunctional purine biosynthesis protein PurH OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=purH PE=3 SV=1 | 2 | 469 | 8.0E-78 |
sp|B1KNA0|PUR9_SHEWM | Bifunctional purine biosynthesis protein PurH OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=purH PE=3 SV=1 | 2 | 469 | 9.0E-78 |
sp|Q3ATZ1|PUR9_CHLCH | Bifunctional purine biosynthesis protein PurH OS=Chlorobium chlorochromatii (strain CaD3) GN=purH PE=3 SV=1 | 6 | 522 | 1.0E-77 |
sp|Q67KG3|PUR9_SYMTH | Bifunctional purine biosynthesis protein PurH OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-77 |
sp|A4G1U6|PUR9_HERAR | Bifunctional purine biosynthesis protein PurH OS=Herminiimonas arsenicoxydans GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-77 |
sp|B5FC70|PUR9_VIBFM | Bifunctional purine biosynthesis protein PurH OS=Vibrio fischeri (strain MJ11) GN=purH PE=3 SV=1 | 2 | 496 | 2.0E-77 |
sp|A9BDN8|PUR9_PROM4 | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9211) GN=purH PE=3 SV=1 | 5 | 466 | 2.0E-77 |
sp|C5CL84|PUR9_VARPS | Bifunctional purine biosynthesis protein PurH OS=Variovorax paradoxus (strain S110) GN=purH PE=3 SV=1 | 4 | 471 | 3.0E-77 |
sp|A2C098|PUR9_PROM1 | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain NATL1A) GN=purH PE=3 SV=1 | 5 | 466 | 3.0E-77 |
sp|A7GKI2|PUR9_BACCN | Bifunctional purine biosynthesis protein PurH OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=purH PE=3 SV=1 | 6 | 466 | 4.0E-77 |
sp|A5G879|PUR9_GEOUR | Bifunctional purine biosynthesis protein PurH OS=Geobacter uraniireducens (strain Rf4) GN=purH PE=3 SV=1 | 6 | 493 | 4.0E-77 |
sp|Q46HA8|PUR9_PROMT | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain NATL2A) GN=purH PE=3 SV=1 | 5 | 466 | 6.0E-77 |
sp|A3DEU9|PUR9_CLOTH | Bifunctional purine biosynthesis protein PurH OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=purH PE=3 SV=1 | 6 | 466 | 6.0E-77 |
sp|Q31R91|PUR9_SYNE7 | Bifunctional purine biosynthesis protein PurH OS=Synechococcus elongatus (strain PCC 7942) GN=purH PE=3 SV=1 | 1 | 466 | 7.0E-77 |
sp|A6TLS7|PUR9_ALKMQ | Bifunctional purine biosynthesis protein PurH OS=Alkaliphilus metalliredigens (strain QYMF) GN=purH PE=3 SV=1 | 6 | 460 | 1.0E-76 |
sp|B3ELV3|PUR9_CHLPB | Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeobacteroides (strain BS1) GN=purH PE=3 SV=1 | 6 | 469 | 1.0E-76 |
sp|B7VM57|PUR9_VIBTL | Bifunctional purine biosynthesis protein PurH OS=Vibrio tasmaniensis (strain LGP32) GN=purH PE=3 SV=1 | 2 | 496 | 1.0E-76 |
sp|B5EBF9|PUR9_GEOBB | Bifunctional purine biosynthesis protein PurH OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=purH PE=3 SV=1 | 6 | 493 | 2.0E-76 |
sp|B2AH76|PUR9_CUPTR | Bifunctional purine biosynthesis protein PurH OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-76 |
sp|C6E5Z3|PUR9_GEOSM | Bifunctional purine biosynthesis protein PurH OS=Geobacter sp. (strain M21) GN=purH PE=3 SV=1 | 6 | 493 | 2.0E-76 |
sp|B7GFU2|PUR9_ANOFW | Bifunctional purine biosynthesis protein PurH OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-76 |
sp|Q9JUQ8|PUR9_NEIMA | Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-76 |
sp|B4SDT6|PUR9_PELPB | Bifunctional purine biosynthesis protein PurH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=purH PE=3 SV=1 | 6 | 522 | 2.0E-76 |
sp|A1BE85|PUR9_CHLPD | Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeobacteroides (strain DSM 266) GN=purH PE=3 SV=1 | 6 | 522 | 6.0E-76 |
sp|A6SUQ1|PUR9_JANMA | Bifunctional purine biosynthesis protein PurH OS=Janthinobacterium sp. (strain Marseille) GN=purH PE=3 SV=1 | 6 | 469 | 6.0E-76 |
sp|C1DLJ1|PUR9_AZOVD | Bifunctional purine biosynthesis protein PurH OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=purH PE=3 SV=1 | 1 | 512 | 6.0E-76 |
sp|B0U7A0|PUR9_XYLFM | Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain M12) GN=purH PE=3 SV=1 | 1 | 469 | 6.0E-76 |
sp|B2VG81|PUR9_ERWT9 | Bifunctional purine biosynthesis protein PurH OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=purH PE=3 SV=1 | 2 | 461 | 6.0E-76 |
sp|Q8UBM8|PUR9_AGRFC | Bifunctional purine biosynthesis protein PurH OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=purH PE=3 SV=2 | 6 | 600 | 8.0E-76 |
sp|C1CWJ7|PUR9_DEIDV | Bifunctional purine biosynthesis protein PurH OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=purH PE=3 SV=1 | 6 | 600 | 9.0E-76 |
sp|A8MLI9|PUR9_ALKOO | Bifunctional purine biosynthesis protein PurH OS=Alkaliphilus oremlandii (strain OhILAs) GN=purH PE=3 SV=1 | 6 | 460 | 1.0E-75 |
sp|A4VPK9|PUR9_PSEU5 | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas stutzeri (strain A1501) GN=purH PE=3 SV=1 | 1 | 512 | 1.0E-75 |
sp|Q03E83|PUR9_PEDPA | Bifunctional purine biosynthesis protein PurH OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-75 |
sp|Q46480|PUR9_ALLVD | Bifunctional purine biosynthesis protein PurH OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=purH PE=3 SV=2 | 2 | 496 | 3.0E-75 |
sp|C0QRH2|PUR9_PERMH | Bifunctional purine biosynthesis protein PurH OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=purH PE=3 SV=1 | 6 | 495 | 2.0E-74 |
sp|A5WFX4|PUR9_PSYWF | Bifunctional purine biosynthesis protein PurH OS=Psychrobacter sp. (strain PRwf-1) GN=purH PE=3 SV=1 | 6 | 493 | 2.0E-74 |
sp|Q97J91|PUR9_CLOAB | Bifunctional purine biosynthesis protein PurH OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=purH PE=3 SV=1 | 6 | 600 | 3.0E-74 |
sp|B5EL42|PUR9_ACIF5 | Bifunctional purine biosynthesis protein PurH OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=purH PE=3 SV=1 | 6 | 464 | 4.0E-74 |
sp|C1D6F1|PUR9_LARHH | Bifunctional purine biosynthesis protein PurH OS=Laribacter hongkongensis (strain HLHK9) GN=purH PE=3 SV=1 | 6 | 490 | 5.0E-74 |
sp|B7J5P7|PUR9_ACIF2 | Bifunctional purine biosynthesis protein PurH OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=purH PE=3 SV=1 | 6 | 464 | 5.0E-74 |
sp|Q9KF53|PUR9_BACHD | Bifunctional purine biosynthesis protein PurH OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purH PE=3 SV=1 | 6 | 466 | 7.0E-74 |
sp|Q049M1|PUR9_LACDB | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-73 |
sp|Q1G9G2|PUR9_LACDA | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-73 |
sp|Q28K03|PUR9_JANSC | Bifunctional purine biosynthesis protein PurH OS=Jannaschia sp. (strain CCS1) GN=purH PE=3 SV=1 | 2 | 466 | 1.0E-73 |
sp|B2A5W1|PUR9_NATTJ | Bifunctional purine biosynthesis protein PurH OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-73 |
sp|A9M4I2|PUR9_NEIM0 | Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup C (strain 053442) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-73 |
sp|B2KCF7|PUR9_ELUMP | Bifunctional purine biosynthesis protein PurH OS=Elusimicrobium minutum (strain Pei191) GN=purH PE=3 SV=1 | 6 | 495 | 2.0E-73 |
sp|B4EYT2|PUR9_PROMH | Bifunctional purine biosynthesis protein PurH OS=Proteus mirabilis (strain HI4320) GN=purH PE=3 SV=1 | 2 | 469 | 3.0E-73 |
sp|Q8CXK7|PUR9_OCEIH | Bifunctional purine biosynthesis protein PurH OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-73 |
sp|Q8Y6C5|PUR9_LISMO | Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-73 |
sp|Q6NID8|PUR9_CORDI | Bifunctional purine biosynthesis protein PurH OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=purH PE=3 SV=1 | 6 | 600 | 4.0E-73 |
sp|A6VCW0|PUR9_PSEA7 | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas aeruginosa (strain PA7) GN=purH PE=3 SV=1 | 1 | 512 | 5.0E-73 |
sp|A1KTP9|PUR9_NEIMF | Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=purH PE=3 SV=1 | 6 | 469 | 6.0E-73 |
sp|Q8REV6|PUR9_FUSNN | Bifunctional purine biosynthesis protein PurH OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=purH PE=3 SV=1 | 6 | 600 | 6.0E-73 |
sp|Q2YX50|PUR9_STAAB | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=purH PE=3 SV=1 | 6 | 466 | 8.0E-73 |
sp|P67540|PUR9_BRUSU | Bifunctional purine biosynthesis protein PurH OS=Brucella suis biovar 1 (strain 1330) GN=purH PE=3 SV=1 | 6 | 465 | 9.0E-73 |
sp|A9WWU1|PUR9_BRUSI | Bifunctional purine biosynthesis protein PurH OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=purH PE=3 SV=1 | 6 | 465 | 9.0E-73 |
sp|P67539|PUR9_BRUME | Bifunctional purine biosynthesis protein PurH OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purH PE=3 SV=1 | 6 | 465 | 9.0E-73 |
sp|C0RF67|PUR9_BRUMB | Bifunctional purine biosynthesis protein PurH OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=purH PE=3 SV=1 | 6 | 465 | 9.0E-73 |
sp|A9M854|PUR9_BRUC2 | Bifunctional purine biosynthesis protein PurH OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=purH PE=3 SV=1 | 6 | 465 | 9.0E-73 |
sp|B8I490|PUR9_CLOCE | Bifunctional purine biosynthesis protein PurH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-72 |
sp|P67544|PUR9_STAAN | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain N315) GN=purH PE=1 SV=2 | 6 | 466 | 1.0E-72 |
sp|P67543|PUR9_STAAM | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purH PE=3 SV=2 | 6 | 466 | 1.0E-72 |
sp|A5IRW0|PUR9_STAA9 | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain JH9) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-72 |
sp|A6U0P1|PUR9_STAA2 | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain JH1) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-72 |
sp|A5VSF8|PUR9_BRUO2 | Bifunctional purine biosynthesis protein PurH OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=purH PE=3 SV=1 | 6 | 465 | 1.0E-72 |
sp|P12048|PUR9_BACSU | Bifunctional purine biosynthesis protein PurH OS=Bacillus subtilis (strain 168) GN=purH PE=3 SV=2 | 6 | 466 | 1.0E-72 |
sp|Q57B71|PUR9_BRUAB | Bifunctional purine biosynthesis protein PurH OS=Brucella abortus biovar 1 (strain 9-941) GN=purH PE=3 SV=1 | 6 | 465 | 1.0E-72 |
sp|Q2YLH0|PUR9_BRUA2 | Bifunctional purine biosynthesis protein PurH OS=Brucella abortus (strain 2308) GN=purH PE=3 SV=1 | 6 | 465 | 1.0E-72 |
sp|B2S7P0|PUR9_BRUA1 | Bifunctional purine biosynthesis protein PurH OS=Brucella abortus (strain S19) GN=purH PE=3 SV=1 | 6 | 465 | 1.0E-72 |
sp|Q24QH6|PUR9_DESHY | Bifunctional purine biosynthesis protein PurH OS=Desulfitobacterium hafniense (strain Y51) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-72 |
sp|B8FP05|PUR9_DESHD | Bifunctional purine biosynthesis protein PurH OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-72 |
sp|Q02FG6|PUR9_PSEAB | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=purH PE=3 SV=1 | 1 | 512 | 2.0E-72 |
sp|Q9HUV9|PUR9_PSEAE | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purH PE=3 SV=1 | 1 | 512 | 2.0E-72 |
sp|B7V1R6|PUR9_PSEA8 | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas aeruginosa (strain LESB58) GN=purH PE=3 SV=1 | 1 | 512 | 2.0E-72 |
sp|B1J5T3|PUR9_PSEPW | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain W619) GN=purH PE=3 SV=1 | 1 | 495 | 2.0E-72 |
sp|Q2FI05|PUR9_STAA3 | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain USA300) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-72 |
sp|Q1LU51|PUR9_BAUCH | Bifunctional purine biosynthesis protein PurH OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=purH PE=3 SV=1 | 6 | 496 | 3.0E-72 |
sp|Q8NX88|PUR9_STAAW | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain MW2) GN=purH PE=3 SV=2 | 6 | 466 | 3.0E-72 |
sp|Q6GAE0|PUR9_STAAS | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain MSSA476) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-72 |
sp|Q5HH11|PUR9_STAAC | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain COL) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-72 |
sp|Q2FZI6|PUR9_STAA8 | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain NCTC 8325) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-72 |
sp|B4S3H9|PUR9_PROA2 | Bifunctional purine biosynthesis protein PurH OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=purH PE=3 SV=1 | 6 | 469 | 3.0E-72 |
sp|A4XQ60|PUR9_PSEMY | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas mendocina (strain ymp) GN=purH PE=3 SV=1 | 1 | 512 | 4.0E-72 |
sp|Q88DK3|PUR9_PSEPK | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain KT2440) GN=purH PE=3 SV=1 | 1 | 495 | 5.0E-72 |
sp|A5W9K7|PUR9_PSEP1 | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=purH PE=3 SV=1 | 1 | 495 | 5.0E-72 |
sp|Q4KIX5|PUR9_PSEF5 | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=purH PE=3 SV=1 | 1 | 512 | 5.0E-72 |
sp|Q4FRN8|PUR9_PSYA2 | Bifunctional purine biosynthesis protein PurH OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=purH PE=3 SV=1 | 5 | 493 | 6.0E-72 |
sp|Q1QA75|PUR9_PSYCK | Bifunctional purine biosynthesis protein PurH OS=Psychrobacter cryohalolentis (strain K5) GN=purH PE=3 SV=1 | 5 | 493 | 7.0E-72 |
sp|Q9JZM7|PUR9_NEIMB | Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup B (strain MC58) GN=purH PE=3 SV=1 | 6 | 469 | 8.0E-72 |
sp|Q6GI11|PUR9_STAAR | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain MRSA252) GN=purH PE=3 SV=1 | 6 | 466 | 8.0E-72 |
sp|Q1I4C1|PUR9_PSEE4 | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas entomophila (strain L48) GN=purH PE=3 SV=1 | 1 | 495 | 8.0E-72 |
sp|Q3B5R1|PUR9_CHLL7 | Bifunctional purine biosynthesis protein PurH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=purH PE=3 SV=1 | 6 | 522 | 1.0E-71 |
sp|B0KJZ6|PUR9_PSEPG | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain GB-1) GN=purH PE=3 SV=1 | 1 | 495 | 1.0E-71 |
sp|B1HTV8|PUR9_LYSSC | Bifunctional purine biosynthesis protein PurH OS=Lysinibacillus sphaericus (strain C3-41) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-71 |
sp|A6QFT1|PUR9_STAAE | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain Newman) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-71 |
sp|C1KW64|PUR9_LISMC | Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-71 |
sp|A0AJL9|PUR9_LISW6 | Bifunctional purine biosynthesis protein PurH OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-71 |
sp|Q03Y85|PUR9_LEUMM | Bifunctional purine biosynthesis protein PurH OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=purH PE=3 SV=1 | 6 | 460 | 2.0E-71 |
sp|Q5WJ82|PUR9_BACSK | Bifunctional purine biosynthesis protein PurH OS=Bacillus clausii (strain KSM-K16) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-71 |
sp|B0SQ10|PUR9_LEPBP | Bifunctional purine biosynthesis protein PurH OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=purH PE=3 SV=1 | 6 | 469 | 3.0E-71 |
sp|B0SGW3|PUR9_LEPBA | Bifunctional purine biosynthesis protein PurH OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=purH PE=3 SV=1 | 6 | 469 | 3.0E-71 |
sp|Q5F6T1|PUR9_NEIG1 | Bifunctional purine biosynthesis protein PurH OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=purH PE=3 SV=1 | 6 | 469 | 5.0E-71 |
sp|Q49WJ7|PUR9_STAS1 | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purH PE=3 SV=1 | 6 | 466 | 6.0E-71 |
sp|A4XKZ2|PUR9_CALS8 | Bifunctional purine biosynthesis protein PurH OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=purH PE=3 SV=1 | 6 | 460 | 6.0E-71 |
sp|A3PAY7|PUR9_PROM0 | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9301) GN=purH PE=3 SV=1 | 5 | 466 | 6.0E-71 |
sp|B4RP71|PUR9_NEIG2 | Bifunctional purine biosynthesis protein PurH OS=Neisseria gonorrhoeae (strain NCCP11945) GN=purH PE=3 SV=1 | 6 | 469 | 7.0E-71 |
sp|Q71YQ3|PUR9_LISMF | Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purH PE=3 SV=1 | 6 | 466 | 7.0E-71 |
sp|A8G2S6|PUR9_PROM2 | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9215) GN=purH PE=3 SV=1 | 5 | 466 | 1.0E-70 |
sp|C3K6E0|PUR9_PSEFS | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas fluorescens (strain SBW25) GN=purH PE=3 SV=1 | 1 | 512 | 1.0E-70 |
sp|Q7TUG1|PUR9_PROMP | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=purH PE=3 SV=1 | 5 | 466 | 1.0E-70 |
sp|A5FUH4|PUR9_ACICJ | Bifunctional purine biosynthesis protein PurH OS=Acidiphilium cryptum (strain JF-5) GN=purH PE=3 SV=1 | 6 | 469 | 1.0E-70 |
sp|B3WF93|PUR9_LACCB | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus casei (strain BL23) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-70 |
sp|B3EEI0|PUR9_CHLL2 | Bifunctional purine biosynthesis protein PurH OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=purH PE=3 SV=1 | 6 | 522 | 2.0E-70 |
sp|Q489F4|PUR9_COLP3 | Bifunctional purine biosynthesis protein PurH OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=purH PE=3 SV=1 | 2 | 496 | 2.0E-70 |
sp|Q92AP3|PUR9_LISIN | Bifunctional purine biosynthesis protein PurH OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-70 |
sp|Q87VR9|PUR9_PSESM | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=purH PE=3 SV=1 | 1 | 495 | 6.0E-70 |
sp|Q037V3|PUR9_LACC3 | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus casei (strain ATCC 334) GN=purH PE=3 SV=1 | 6 | 466 | 7.0E-70 |
sp|B9EAZ2|PUR9_MACCJ | Bifunctional purine biosynthesis protein PurH OS=Macrococcus caseolyticus (strain JCSC5402) GN=purH PE=3 SV=1 | 6 | 466 | 9.0E-70 |
sp|B9JEU9|PUR9_AGRRK | Bifunctional purine biosynthesis protein PurH OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=purH PE=3 SV=1 | 6 | 464 | 1.0E-69 |
sp|A1SMP8|PUR9_NOCSJ | Bifunctional purine biosynthesis protein PurH OS=Nocardioides sp. (strain BAA-499 / JS614) GN=purH PE=3 SV=1 | 1 | 466 | 1.0E-69 |
sp|Q1J119|PUR9_DEIGD | Bifunctional purine biosynthesis protein PurH OS=Deinococcus geothermalis (strain DSM 11300) GN=purH PE=3 SV=1 | 6 | 460 | 2.0E-69 |
sp|A2BP65|PUR9_PROMS | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain AS9601) GN=purH PE=3 SV=1 | 5 | 466 | 2.0E-69 |
sp|Q38XW3|PUR9_LACSS | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-69 |
sp|Q8CT27|PUR9_STAES | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-69 |
sp|Q5HQ97|PUR9_STAEQ | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-69 |
sp|B3PS36|PUR9_RHIE6 | Bifunctional purine biosynthesis protein PurH OS=Rhizobium etli (strain CIAT 652) GN=purH PE=3 SV=1 | 6 | 465 | 2.0E-69 |
sp|Q1WU55|PUR9_LACS1 | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus salivarius (strain UCC118) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-69 |
sp|Q6FYG4|PUR9_BARQU | Bifunctional purine biosynthesis protein PurH OS=Bartonella quintana (strain Toulouse) GN=purH PE=3 SV=1 | 7 | 471 | 4.0E-69 |
sp|A7HA60|PUR9_ANADF | Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter sp. (strain Fw109-5) GN=purH PE=3 SV=1 | 6 | 512 | 5.0E-69 |
sp|B9MS89|PUR9_CALBD | Bifunctional purine biosynthesis protein PurH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=purH PE=3 SV=1 | 6 | 460 | 7.0E-69 |
sp|A0PWC5|PUR9_MYCUA | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium ulcerans (strain Agy99) GN=purH PE=3 SV=1 | 2 | 466 | 2.0E-68 |
sp|Q2K2T6|PUR9_RHIEC | Bifunctional purine biosynthesis protein PurH OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=purH PE=3 SV=1 | 6 | 465 | 2.0E-68 |
sp|B9DQ42|PUR9_STACT | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus carnosus (strain TM300) GN=purH PE=3 SV=1 | 7 | 466 | 2.0E-68 |
sp|B5ZV31|PUR9_RHILW | Bifunctional purine biosynthesis protein PurH OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=purH PE=3 SV=1 | 6 | 465 | 3.0E-68 |
sp|B2HEC3|PUR9_MYCMM | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=purH PE=3 SV=1 | 2 | 466 | 3.0E-68 |
sp|A6UED3|PUR9_SINMW | Bifunctional purine biosynthesis protein PurH OS=Sinorhizobium medicae (strain WSM419) GN=purH PE=3 SV=1 | 6 | 464 | 4.0E-68 |
sp|Q9RW01|PUR9_DEIRA | Bifunctional purine biosynthesis protein PurH OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=purH PE=3 SV=2 | 6 | 460 | 4.0E-68 |
sp|Q4L582|PUR9_STAHJ | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purH PE=3 SV=1 | 6 | 466 | 5.0E-68 |
sp|Q2IKQ7|PUR9_ANADE | Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=purH PE=3 SV=1 | 6 | 512 | 6.0E-68 |
sp|Q9ABY4|PUR9_CAUCR | Bifunctional purine biosynthesis protein PurH OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=purH PE=3 SV=1 | 6 | 522 | 8.0E-68 |
sp|Q92KX6|PUR9_RHIME | Bifunctional purine biosynthesis protein PurH OS=Rhizobium meliloti (strain 1021) GN=purH PE=3 SV=1 | 6 | 464 | 8.0E-68 |
sp|B5YLE5|PUR9_THEYD | Bifunctional purine biosynthesis protein PurH OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=purH PE=3 SV=1 | 6 | 465 | 8.0E-68 |
sp|A9IZD0|PUR9_BART1 | Bifunctional purine biosynthesis protein PurH OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=purH PE=3 SV=1 | 7 | 460 | 9.0E-68 |
sp|Q31CR6|PUR9_PROM9 | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9312) GN=purH PE=3 SV=1 | 5 | 466 | 9.0E-68 |
sp|Q833Z3|PUR9_ENTFA | Bifunctional purine biosynthesis protein PurH OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=purH PE=3 SV=1 | 6 | 466 | 9.0E-68 |
sp|C3L2U9|PUR9_CLOB6 | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain 657 / Type Ba4) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-67 |
sp|C1FV76|PUR9_CLOBJ | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Kyoto / Type A2) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-67 |
sp|B1KZ55|PUR9_CLOBM | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=purH PE=3 SV=1 | 6 | 466 | 4.0E-67 |
sp|Q1MA35|PUR9_RHIL3 | Bifunctional purine biosynthesis protein PurH OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=purH PE=3 SV=1 | 6 | 465 | 8.0E-67 |
sp|A5I5V9|PUR9_CLOBH | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=purH PE=3 SV=1 | 6 | 466 | 9.0E-67 |
sp|A7FXD3|PUR9_CLOB1 | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=purH PE=3 SV=1 | 6 | 466 | 9.0E-67 |
sp|Q86L14|PUR9_DICDI | Bifunctional purine biosynthesis protein purH OS=Dictyostelium discoideum GN=purH PE=1 SV=1 | 6 | 469 | 2.0E-66 |
sp|B1IL57|PUR9_CLOBK | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Okra / Type B1) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-66 |
sp|A9BIX9|PUR9_PETMO | Bifunctional purine biosynthesis protein PurH OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=purH PE=3 SV=1 | 6 | 460 | 4.0E-66 |
sp|B1MY42|PUR9_LEUCK | Bifunctional purine biosynthesis protein PurH OS=Leuconostoc citreum (strain KM20) GN=purH PE=3 SV=1 | 6 | 460 | 5.0E-66 |
sp|Q1B3W0|PUR9_MYCSS | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium sp. (strain MCS) GN=purH PE=3 SV=1 | 2 | 466 | 5.0E-66 |
sp|A1UL88|PUR9_MYCSK | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium sp. (strain KMS) GN=purH PE=3 SV=1 | 2 | 466 | 5.0E-66 |
sp|A7GH96|PUR9_CLOBL | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=purH PE=3 SV=1 | 6 | 466 | 6.0E-66 |
sp|P9WHM7|PUR9_MYCTU | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purH PE=1 SV=1 | 2 | 466 | 8.0E-66 |
sp|P9WHM6|PUR9_MYCTO | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purH PE=3 SV=1 | 2 | 466 | 8.0E-66 |
sp|A5U0Z7|PUR9_MYCTA | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=purH PE=3 SV=1 | 2 | 466 | 8.0E-66 |
sp|C1ALU3|PUR9_MYCBT | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=purH PE=3 SV=1 | 2 | 466 | 8.0E-66 |
sp|A1KH91|PUR9_MYCBP | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=purH PE=3 SV=1 | 2 | 466 | 8.0E-66 |
sp|P67542|PUR9_MYCBO | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=purH PE=3 SV=1 | 2 | 466 | 8.0E-66 |
sp|Q9RHX6|PUR9_CORAM | Bifunctional purine biosynthesis protein PurH OS=Corynebacterium ammoniagenes GN=purH PE=3 SV=1 | 6 | 600 | 1.0E-65 |
sp|Q8FR29|PUR9_COREF | Bifunctional purine biosynthesis protein PurH OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-65 |
sp|B3QQA5|PUR9_CHLP8 | Bifunctional purine biosynthesis protein PurH OS=Chlorobaculum parvum (strain NCIB 8327) GN=purH PE=3 SV=1 | 6 | 522 | 2.0E-65 |
sp|Q5HUK6|PUR9_CAMJR | Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni (strain RM1221) GN=purH PE=3 SV=1 | 6 | 460 | 3.0E-65 |
sp|Q2RGU9|PUR9_MOOTA | Bifunctional purine biosynthesis protein PurH OS=Moorella thermoacetica (strain ATCC 39073) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-65 |
sp|A1VZU4|PUR9_CAMJJ | Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=purH PE=3 SV=1 | 6 | 460 | 3.0E-65 |
sp|Q9PNY2|PUR9_CAMJE | Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=purH PE=1 SV=1 | 6 | 460 | 3.0E-65 |
sp|C3MAR5|PUR9_RHISN | Bifunctional purine biosynthesis protein PurH OS=Rhizobium sp. (strain NGR234) GN=purH PE=3 SV=1 | 6 | 464 | 3.0E-65 |
sp|Q9RAJ5|PUR9_MYCPA | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=purH PE=3 SV=2 | 2 | 466 | 3.0E-65 |
sp|B8JHC9|PUR9_ANAD2 | Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=purH PE=3 SV=1 | 6 | 512 | 4.0E-65 |
sp|B4UJ61|PUR9_ANASK | Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter sp. (strain K) GN=purH PE=3 SV=1 | 6 | 512 | 4.0E-65 |
sp|Q8DWK8|PUR9_STRMU | Bifunctional purine biosynthesis protein PurH OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=purH PE=3 SV=2 | 6 | 466 | 5.0E-65 |
sp|A3Q5N7|PUR9_MYCSJ | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium sp. (strain JLS) GN=purH PE=3 SV=1 | 2 | 466 | 5.0E-65 |
sp|Q8KFK6|PUR9_CHLTE | Bifunctional purine biosynthesis protein PurH OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=purH PE=3 SV=1 | 6 | 522 | 6.0E-65 |
sp|B8DDZ2|PUR9_LISMH | Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-64 |
sp|A8FM07|PUR9_CAMJ8 | Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=purH PE=3 SV=1 | 6 | 460 | 4.0E-64 |
sp|Q11CT4|PUR9_CHESB | Bifunctional purine biosynthesis protein PurH OS=Chelativorans sp. (strain BNC1) GN=purH PE=3 SV=1 | 1 | 465 | 4.0E-64 |
sp|Q8NS21|PUR9_CORGL | Bifunctional purine biosynthesis protein PurH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=purH PE=3 SV=1 | 6 | 466 | 7.0E-64 |
sp|Q03MZ6|PUR9_STRTD | Bifunctional purine biosynthesis protein PurH OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=purH PE=3 SV=1 | 6 | 466 | 8.0E-64 |
sp|A4QCK4|PUR9_CORGB | Bifunctional purine biosynthesis protein PurH OS=Corynebacterium glutamicum (strain R) GN=purH PE=3 SV=1 | 6 | 466 | 8.0E-64 |
sp|C0QXU6|PUR9_BRAHW | Bifunctional purine biosynthesis protein PurH OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=purH PE=3 SV=1 | 6 | 460 | 9.0E-64 |
sp|Q1J934|PUR9_STRPF | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-63 |
sp|Q8P310|PUR9_STRP8 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-63 |
sp|Q3K3Z7|PUR9_STRA1 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-63 |
sp|Q9KY50|PUR9_STRCO | Bifunctional purine biosynthesis protein PurH OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=purH PE=3 SV=1 | 6 | 466 | 4.0E-63 |
sp|C3PF03|PUR9_CORA7 | Bifunctional purine biosynthesis protein PurH OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=purH PE=3 SV=1 | 2 | 600 | 5.0E-63 |
sp|A8AUA2|PUR9_STRGC | Bifunctional purine biosynthesis protein PurH OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=purH PE=3 SV=1 | 6 | 466 | 5.0E-63 |
sp|C1C9V4|PUR9_STRP7 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain 70585) GN=purH PE=3 SV=1 | 7 | 466 | 6.0E-63 |
sp|C1CHW2|PUR9_STRZP | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain P1031) GN=purH PE=3 SV=1 | 7 | 466 | 9.0E-63 |
sp|C0MB61|PUR9_STRE4 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus equi subsp. equi (strain 4047) GN=purH PE=3 SV=1 | 6 | 466 | 9.0E-63 |
sp|B5XJ20|PUR9_STRPZ | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=purH PE=3 SV=1 | 6 | 466 | 9.0E-63 |
sp|A2BUP7|PUR9_PROM5 | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9515) GN=purH PE=3 SV=1 | 5 | 466 | 1.0E-62 |
sp|B2V3C3|PUR9_CLOBA | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=purH PE=3 SV=1 | 6 | 600 | 1.0E-62 |
sp|Q5XEF2|PUR9_STRP6 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-62 |
sp|A5N0Q0|PUR9_CLOK5 | Bifunctional purine biosynthesis protein PurH OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=purH PE=3 SV=1 | 6 | 460 | 1.0E-62 |
sp|B9E4K6|PUR9_CLOK1 | Bifunctional purine biosynthesis protein PurH OS=Clostridium kluyveri (strain NBRC 12016) GN=purH PE=3 SV=1 | 6 | 460 | 1.0E-62 |
sp|P0DD61|PUR9_STRPQ | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-62 |
sp|P0DD60|PUR9_STRP3 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-62 |
sp|Q9Z5H5|PUR9_MYCLE | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium leprae (strain TN) GN=purH PE=3 SV=1 | 2 | 466 | 1.0E-62 |
sp|B8ZU05|PUR9_MYCLB | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium leprae (strain Br4923) GN=purH PE=3 SV=1 | 2 | 466 | 1.0E-62 |
sp|C1CBM7|PUR9_STRZJ | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain JJA) GN=purH PE=3 SV=1 | 7 | 466 | 2.0E-62 |
sp|B8ZJN3|PUR9_STRPJ | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=purH PE=3 SV=1 | 7 | 466 | 2.0E-62 |
sp|P67546|PUR9_STRA5 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-62 |
sp|P67545|PUR9_STRA3 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype III (strain NEM316) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-62 |
sp|B1I7V8|PUR9_STRPI | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=purH PE=3 SV=1 | 7 | 466 | 2.0E-62 |
sp|C1CNS9|PUR9_STRZT | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=purH PE=3 SV=1 | 7 | 466 | 2.0E-62 |
sp|Q97T99|PUR9_STRPN | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=purH PE=3 SV=1 | 7 | 466 | 2.0E-62 |
sp|Q1JJ80|PUR9_STRPD | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-62 |
sp|Q48VY9|PUR9_STRPM | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-62 |
sp|Q1JP34|PUR9_STRPC | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-62 |
sp|Q1JE78|PUR9_STRPB | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=purH PE=3 SV=1 | 6 | 466 | 3.0E-62 |
sp|B5E5J9|PUR9_STRP4 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=purH PE=3 SV=1 | 7 | 466 | 3.0E-62 |
sp|B9DSR6|PUR9_STRU0 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=purH PE=3 SV=1 | 6 | 466 | 4.0E-62 |
sp|A7H375|PUR9_CAMJD | Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=purH PE=3 SV=1 | 6 | 460 | 6.0E-62 |
sp|Q8DRM1|PUR9_STRR6 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=purH PE=3 SV=2 | 7 | 466 | 8.0E-62 |
sp|Q04N19|PUR9_STRP2 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=purH PE=3 SV=1 | 7 | 466 | 8.0E-62 |
sp|B2TN76|PUR9_CLOBB | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=purH PE=3 SV=1 | 6 | 600 | 1.0E-61 |
sp|Q7UKJ8|PUR9_RHOBA | Bifunctional purine biosynthesis protein PurH OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=purH PE=3 SV=1 | 1 | 466 | 1.0E-61 |
sp|Q051H8|PUR9_LEPBL | Bifunctional purine biosynthesis protein PurH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-61 |
sp|Q04T56|PUR9_LEPBJ | Bifunctional purine biosynthesis protein PurH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-61 |
sp|Q892X3|PUR9_CLOTE | Bifunctional purine biosynthesis protein PurH OS=Clostridium tetani (strain Massachusetts / E88) GN=purH PE=3 SV=1 | 6 | 472 | 2.0E-61 |
sp|C0MC89|PUR9_STRS7 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=purH PE=3 SV=1 | 6 | 466 | 6.0E-61 |
sp|B8D8J3|PUR9_BUCA5 | Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=purH PE=3 SV=1 | 6 | 470 | 7.0E-61 |
sp|B8D6U7|PUR9_BUCAT | Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=purH PE=3 SV=1 | 6 | 469 | 1.0E-60 |
sp|P57143|PUR9_BUCAI | Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=purH PE=3 SV=1 | 6 | 469 | 1.0E-60 |
sp|Q0SV48|PUR9_CLOPS | Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain SM101 / Type A) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-60 |
sp|Q0TTB0|PUR9_CLOP1 | Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-60 |
sp|Q9F1T4|PUR9_STRSU | Bifunctional purine biosynthesis protein PurH OS=Streptococcus suis GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-60 |
sp|A4VSB5|PUR9_STRSY | Bifunctional purine biosynthesis protein PurH OS=Streptococcus suis (strain 05ZYH33) GN=purH PE=3 SV=1 | 6 | 466 | 6.0E-60 |
sp|A4VYK5|PUR9_STRS2 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus suis (strain 98HAH33) GN=purH PE=3 SV=1 | 6 | 466 | 6.0E-60 |
sp|Q8XMK2|PUR9_CLOPE | Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain 13 / Type A) GN=purH PE=3 SV=1 | 6 | 466 | 9.0E-60 |
sp|Q6AD62|PUR9_LEIXX | Bifunctional purine biosynthesis protein PurH OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=purH PE=3 SV=1 | 1 | 466 | 1.0E-59 |
sp|A6LSB3|PUR9_CLOB8 | Bifunctional purine biosynthesis protein PurH OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=purH PE=3 SV=1 | 6 | 464 | 2.0E-59 |
sp|Q8F3W6|PUR9_LEPIN | Bifunctional purine biosynthesis protein PurH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=purH PE=3 SV=1 | 6 | 469 | 2.0E-59 |
sp|Q72RT5|PUR9_LEPIC | Bifunctional purine biosynthesis protein PurH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=purH PE=3 SV=1 | 6 | 469 | 3.0E-59 |
sp|Q04EU6|PUR9_OENOB | Bifunctional purine biosynthesis protein PurH OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=purH PE=3 SV=1 | 6 | 466 | 6.0E-59 |
sp|A7GYY6|PUR9_CAMC5 | Bifunctional purine biosynthesis protein PurH OS=Campylobacter curvus (strain 525.92) GN=purH PE=3 SV=1 | 6 | 458 | 8.0E-59 |
sp|Q6A6Y8|PUR9_PROAC | Bifunctional purine biosynthesis protein PurH OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=purH PE=3 SV=1 | 2 | 466 | 2.0E-58 |
sp|A0Q1J0|PUR9_CLONN | Bifunctional purine biosynthesis protein PurH OS=Clostridium novyi (strain NT) GN=purH PE=3 SV=1 | 6 | 460 | 2.0E-58 |
sp|Q9CFG0|PUR9_LACLA | Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purH PE=3 SV=1 | 6 | 466 | 6.0E-57 |
sp|Q8KA70|PUR9_BUCAP | Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=purH PE=3 SV=1 | 6 | 493 | 1.0E-56 |
sp|A7ZCZ7|PUR9_CAMC1 | Bifunctional purine biosynthesis protein PurH OS=Campylobacter concisus (strain 13826) GN=purH PE=3 SV=1 | 6 | 458 | 3.0E-56 |
sp|Q18CW0|PUR9_PEPD6 | Bifunctional purine biosynthesis protein PurH OS=Peptoclostridium difficile (strain 630) GN=purH PE=3 SV=1 | 6 | 460 | 4.0E-55 |
sp|Q02Y66|PUR9_LACLS | Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=purH PE=3 SV=1 | 6 | 466 | 1.0E-54 |
sp|A2RJY0|PUR9_LACLM | Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=purH PE=3 SV=1 | 6 | 466 | 2.0E-54 |
sp|Q8A155|PUR9_BACTN | Bifunctional purine biosynthesis protein PurH OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=purH PE=3 SV=1 | 6 | 495 | 8.0E-52 |
sp|Q89B23|PUR9_BUCBP | Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=purH PE=3 SV=1 | 6 | 471 | 5.0E-51 |
sp|B3DRY6|PUR9_BIFLD | Bifunctional purine biosynthesis protein PurH OS=Bifidobacterium longum (strain DJO10A) GN=purH PE=3 SV=1 | 2 | 466 | 1.0E-50 |
sp|Q8G6B1|PUR9_BIFLO | Bifunctional purine biosynthesis protein PurH OS=Bifidobacterium longum (strain NCC 2705) GN=purH PE=3 SV=1 | 2 | 466 | 2.0E-50 |
sp|Q8D244|PUR9_WIGBR | Bifunctional purine biosynthesis protein PurH OS=Wigglesworthia glossinidia brevipalpis GN=purH PE=3 SV=1 | 1 | 600 | 9.0E-48 |
sp|Q9X0X6|PUR9_THEMA | Bifunctional purine biosynthesis protein PurH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purH PE=1 SV=1 | 7 | 466 | 2.0E-37 |
sp|Q24QH6|PUR9_DESHY | Bifunctional purine biosynthesis protein PurH OS=Desulfitobacterium hafniense (strain Y51) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-11 |
sp|B8FP05|PUR9_DESHD | Bifunctional purine biosynthesis protein PurH OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-11 |
sp|Q9ABY4|PUR9_CAUCR | Bifunctional purine biosynthesis protein PurH OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=purH PE=3 SV=1 | 481 | 600 | 3.0E-11 |
sp|Q8DRM1|PUR9_STRR6 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=purH PE=3 SV=2 | 538 | 600 | 5.0E-11 |
sp|Q04N19|PUR9_STRP2 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=purH PE=3 SV=1 | 538 | 600 | 5.0E-11 |
sp|A8AUA2|PUR9_STRGC | Bifunctional purine biosynthesis protein PurH OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=purH PE=3 SV=1 | 538 | 600 | 6.0E-11 |
sp|C1CHW2|PUR9_STRZP | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain P1031) GN=purH PE=3 SV=1 | 538 | 600 | 6.0E-11 |
sp|C1CNS9|PUR9_STRZT | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=purH PE=3 SV=1 | 538 | 600 | 6.0E-11 |
sp|Q97T99|PUR9_STRPN | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=purH PE=3 SV=1 | 538 | 600 | 6.0E-11 |
sp|Q03MZ6|PUR9_STRTD | Bifunctional purine biosynthesis protein PurH OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=purH PE=3 SV=1 | 538 | 600 | 8.0E-11 |
sp|B1I7V8|PUR9_STRPI | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=purH PE=3 SV=1 | 538 | 600 | 8.0E-11 |
sp|C1C9V4|PUR9_STRP7 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain 70585) GN=purH PE=3 SV=1 | 538 | 600 | 2.0E-10 |
sp|B5E5J9|PUR9_STRP4 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=purH PE=3 SV=1 | 538 | 600 | 2.0E-10 |
sp|Q489F4|PUR9_COLP3 | Bifunctional purine biosynthesis protein PurH OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-10 |
sp|C1CBM7|PUR9_STRZJ | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain JJA) GN=purH PE=3 SV=1 | 538 | 600 | 3.0E-10 |
sp|B8ZJN3|PUR9_STRPJ | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=purH PE=3 SV=1 | 538 | 600 | 3.0E-10 |
sp|P57828|PUR9_PASMU | Bifunctional purine biosynthesis protein PurH OS=Pasteurella multocida (strain Pm70) GN=purH PE=3 SV=1 | 405 | 600 | 4.0E-10 |
sp|Q7MGT5|PUR9_VIBVY | Bifunctional purine biosynthesis protein PurH OS=Vibrio vulnificus (strain YJ016) GN=purH PE=3 SV=1 | 483 | 600 | 4.0E-10 |
sp|Q8DD06|PUR9_VIBVU | Bifunctional purine biosynthesis protein PurH OS=Vibrio vulnificus (strain CMCP6) GN=purH PE=3 SV=1 | 483 | 600 | 4.0E-10 |
sp|B7VM57|PUR9_VIBTL | Bifunctional purine biosynthesis protein PurH OS=Vibrio tasmaniensis (strain LGP32) GN=purH PE=3 SV=1 | 495 | 600 | 5.0E-10 |
sp|Q0I557|PUR9_HAES1 | Bifunctional purine biosynthesis protein PurH OS=Haemophilus somnus (strain 129Pt) GN=purH PE=3 SV=1 | 483 | 600 | 8.0E-10 |
sp|A7H375|PUR9_CAMJD | Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=purH PE=3 SV=1 | 539 | 600 | 8.0E-10 |
sp|B0UWT1|PUR9_HISS2 | Bifunctional purine biosynthesis protein PurH OS=Histophilus somni (strain 2336) GN=purH PE=3 SV=1 | 483 | 600 | 9.0E-10 |
sp|Q5HUK6|PUR9_CAMJR | Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni (strain RM1221) GN=purH PE=3 SV=1 | 539 | 600 | 9.0E-10 |
sp|Q5E257|PUR9_VIBF1 | Bifunctional purine biosynthesis protein PurH OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=purH PE=3 SV=1 | 495 | 600 | 1.0E-09 |
sp|B5FC70|PUR9_VIBFM | Bifunctional purine biosynthesis protein PurH OS=Vibrio fischeri (strain MJ11) GN=purH PE=3 SV=1 | 495 | 600 | 1.0E-09 |
sp|A7GKI2|PUR9_BACCN | Bifunctional purine biosynthesis protein PurH OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=purH PE=3 SV=1 | 538 | 600 | 1.0E-09 |
sp|A1VZU4|PUR9_CAMJJ | Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=purH PE=3 SV=1 | 539 | 600 | 1.0E-09 |
sp|Q9PNY2|PUR9_CAMJE | Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=purH PE=1 SV=1 | 539 | 600 | 1.0E-09 |
sp|A8FM07|PUR9_CAMJ8 | Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=purH PE=3 SV=1 | 539 | 600 | 1.0E-09 |
sp|Q0VMY5|PUR9_ALCBS | Bifunctional purine biosynthesis protein PurH OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-09 |
sp|P43852|PUR9_HAEIN | Bifunctional purine biosynthesis protein PurH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-09 |
sp|Q4FRN8|PUR9_PSYA2 | Bifunctional purine biosynthesis protein PurH OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=purH PE=3 SV=1 | 480 | 600 | 2.0E-09 |
sp|Q1QA75|PUR9_PSYCK | Bifunctional purine biosynthesis protein PurH OS=Psychrobacter cryohalolentis (strain K5) GN=purH PE=3 SV=1 | 480 | 600 | 2.0E-09 |
sp|A4VPK9|PUR9_PSEU5 | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas stutzeri (strain A1501) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-09 |
sp|Q8KFK6|PUR9_CHLTE | Bifunctional purine biosynthesis protein PurH OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-09 |
sp|B0TR91|PUR9_SHEHH | Bifunctional purine biosynthesis protein PurH OS=Shewanella halifaxensis (strain HAW-EB4) GN=purH PE=3 SV=1 | 483 | 600 | 4.0E-09 |
sp|B0U7A0|PUR9_XYLFM | Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain M12) GN=purH PE=3 SV=1 | 483 | 600 | 4.0E-09 |
sp|P12048|PUR9_BACSU | Bifunctional purine biosynthesis protein PurH OS=Bacillus subtilis (strain 168) GN=purH PE=3 SV=2 | 537 | 600 | 4.0E-09 |
sp|B3QQA5|PUR9_CHLP8 | Bifunctional purine biosynthesis protein PurH OS=Chlorobaculum parvum (strain NCIB 8327) GN=purH PE=3 SV=1 | 483 | 600 | 4.0E-09 |
sp|Q74FJ9|PUR9_GEOSL | Bifunctional purine biosynthesis protein PurH OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=purH PE=3 SV=1 | 335 | 600 | 5.0E-09 |
sp|B8CTW4|PUR9_SHEPW | Bifunctional purine biosynthesis protein PurH OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=purH PE=3 SV=1 | 483 | 600 | 5.0E-09 |
sp|Q9PC10|PUR9_XYLFA | Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain 9a5c) GN=purH PE=3 SV=2 | 483 | 600 | 5.0E-09 |
sp|Q3ATZ1|PUR9_CHLCH | Bifunctional purine biosynthesis protein PurH OS=Chlorobium chlorochromatii (strain CaD3) GN=purH PE=3 SV=1 | 481 | 600 | 5.0E-09 |
sp|Q3AN13|PUR9_SYNSC | Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9605) GN=purH PE=3 SV=1 | 482 | 600 | 6.0E-09 |
sp|B7JM89|PUR9_BACC0 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain AH820) GN=purH PE=3 SV=1 | 537 | 600 | 6.0E-09 |
sp|Q81ZG8|PUR9_BACAN | Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis GN=purH PE=3 SV=1 | 537 | 600 | 6.0E-09 |
sp|C3L536|PUR9_BACAC | Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=purH PE=3 SV=1 | 537 | 600 | 6.0E-09 |
sp|C3PBN4|PUR9_BACAA | Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis (strain A0248) GN=purH PE=3 SV=1 | 537 | 600 | 6.0E-09 |
sp|C1EV67|PUR9_BACC3 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain 03BB102) GN=purH PE=3 SV=1 | 537 | 600 | 6.0E-09 |
sp|A0R900|PUR9_BACAH | Bifunctional purine biosynthesis protein PurH OS=Bacillus thuringiensis (strain Al Hakam) GN=purH PE=3 SV=1 | 537 | 600 | 6.0E-09 |
sp|Q6HPA0|PUR9_BACHK | Bifunctional purine biosynthesis protein PurH OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=purH PE=3 SV=1 | 537 | 600 | 6.0E-09 |
sp|Q87VR9|PUR9_PSESM | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=purH PE=3 SV=1 | 483 | 600 | 6.0E-09 |
sp|A9VRF5|PUR9_BACWK | Bifunctional purine biosynthesis protein PurH OS=Bacillus weihenstephanensis (strain KBAB4) GN=purH PE=3 SV=1 | 537 | 600 | 7.0E-09 |
sp|Q5WJ82|PUR9_BACSK | Bifunctional purine biosynthesis protein PurH OS=Bacillus clausii (strain KSM-K16) GN=purH PE=3 SV=1 | 495 | 600 | 7.0E-09 |
sp|B3E7F6|PUR9_GEOLS | Bifunctional purine biosynthesis protein PurH OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=purH PE=3 SV=1 | 539 | 600 | 8.0E-09 |
sp|A4XQ60|PUR9_PSEMY | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas mendocina (strain ymp) GN=purH PE=3 SV=1 | 483 | 600 | 8.0E-09 |
sp|A4SDE6|PUR9_CHLPM | Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=purH PE=3 SV=1 | 483 | 600 | 9.0E-09 |
sp|B4SDT6|PUR9_PELPB | Bifunctional purine biosynthesis protein PurH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=purH PE=3 SV=1 | 481 | 600 | 9.0E-09 |
sp|C0QRH2|PUR9_PERMH | Bifunctional purine biosynthesis protein PurH OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=purH PE=3 SV=1 | 523 | 600 | 9.0E-09 |
sp|A8GZM3|PUR9_SHEPA | Bifunctional purine biosynthesis protein PurH OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=purH PE=3 SV=1 | 483 | 600 | 1.0E-08 |
sp|Q67KG3|PUR9_SYMTH | Bifunctional purine biosynthesis protein PurH OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=purH PE=3 SV=1 | 483 | 600 | 1.0E-08 |
sp|A1BE85|PUR9_CHLPD | Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeobacteroides (strain DSM 266) GN=purH PE=3 SV=1 | 481 | 600 | 1.0E-08 |
sp|B4EYT2|PUR9_PROMH | Bifunctional purine biosynthesis protein PurH OS=Proteus mirabilis (strain HI4320) GN=purH PE=3 SV=1 | 483 | 600 | 1.0E-08 |
sp|A5FUH4|PUR9_ACICJ | Bifunctional purine biosynthesis protein PurH OS=Acidiphilium cryptum (strain JF-5) GN=purH PE=3 SV=1 | 483 | 600 | 1.0E-08 |
sp|B3EEI0|PUR9_CHLL2 | Bifunctional purine biosynthesis protein PurH OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=purH PE=3 SV=1 | 483 | 600 | 1.0E-08 |
sp|Q18CW0|PUR9_PEPD6 | Bifunctional purine biosynthesis protein PurH OS=Peptoclostridium difficile (strain 630) GN=purH PE=3 SV=1 | 483 | 600 | 1.0E-08 |
sp|B7H4U0|PUR9_BACC4 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain B4264) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-08 |
sp|Q81IP9|PUR9_BACCR | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-08 |
sp|B7HS36|PUR9_BACC7 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain AH187) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-08 |
sp|B9J1K9|PUR9_BACCQ | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain Q1) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-08 |
sp|Q73EN1|PUR9_BACC1 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-08 |
sp|B7IUV7|PUR9_BACC2 | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain G9842) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-08 |
sp|Q3A2D6|PUR9_PELCD | Bifunctional purine biosynthesis protein PurH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=purH PE=3 SV=1 | 541 | 600 | 2.0E-08 |
sp|Q63GS9|PUR9_BACCZ | Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ZK / E33L) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-08 |
sp|A5WFX4|PUR9_PSYWF | Bifunctional purine biosynthesis protein PurH OS=Psychrobacter sp. (strain PRwf-1) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-08 |
sp|Q1LU51|PUR9_BAUCH | Bifunctional purine biosynthesis protein PurH OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-08 |
sp|Q4KIX5|PUR9_PSEF5 | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-08 |
sp|Q1I4C1|PUR9_PSEE4 | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas entomophila (strain L48) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-08 |
sp|Q3B5R1|PUR9_CHLL7 | Bifunctional purine biosynthesis protein PurH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-08 |
sp|Q1J934|PUR9_STRPF | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=purH PE=3 SV=1 | 539 | 600 | 2.0E-08 |
sp|Q8P310|PUR9_STRP8 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=purH PE=3 SV=1 | 539 | 600 | 2.0E-08 |
sp|Q5XEF2|PUR9_STRP6 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=purH PE=3 SV=1 | 539 | 600 | 2.0E-08 |
sp|A7ZCZ7|PUR9_CAMC1 | Bifunctional purine biosynthesis protein PurH OS=Campylobacter concisus (strain 13826) GN=purH PE=3 SV=1 | 539 | 600 | 2.0E-08 |
sp|Q2P866|PUR9_XANOM | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-08 |
sp|Q5H5H7|PUR9_XANOR | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-08 |
sp|B2SRB2|PUR9_XANOP | Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-08 |
sp|Q0IDE8|PUR9_SYNS3 | Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9311) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-08 |
sp|B9M4Q6|PUR9_GEODF | Bifunctional purine biosynthesis protein PurH OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=purH PE=3 SV=1 | 481 | 600 | 3.0E-08 |
sp|B3ELV3|PUR9_CHLPB | Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeobacteroides (strain BS1) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-08 |
sp|B1J5T3|PUR9_PSEPW | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain W619) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-08 |
sp|Q88DK3|PUR9_PSEPK | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain KT2440) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-08 |
sp|A5W9K7|PUR9_PSEP1 | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-08 |
sp|B0KJZ6|PUR9_PSEPG | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain GB-1) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-08 |
sp|C3K6E0|PUR9_PSEFS | Bifunctional purine biosynthesis protein PurH OS=Pseudomonas fluorescens (strain SBW25) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-08 |
sp|B1IL57|PUR9_CLOBK | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Okra / Type B1) GN=purH PE=3 SV=1 | 537 | 600 | 3.0E-08 |
sp|B8D8J3|PUR9_BUCA5 | Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=purH PE=3 SV=1 | 495 | 600 | 3.0E-08 |
sp|B8D6U7|PUR9_BUCAT | Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=purH PE=3 SV=1 | 495 | 600 | 3.0E-08 |
sp|P57143|PUR9_BUCAI | Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=purH PE=3 SV=1 | 495 | 600 | 3.0E-08 |
sp|Q02Y66|PUR9_LACLS | Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=purH PE=3 SV=1 | 540 | 600 | 3.0E-08 |
sp|A2RJY0|PUR9_LACLM | Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=purH PE=3 SV=1 | 540 | 600 | 3.0E-08 |
sp|Q9X0X6|PUR9_THEMA | Bifunctional purine biosynthesis protein PurH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purH PE=1 SV=1 | 538 | 600 | 3.0E-08 |
sp|Q3JC90|PUR9_NITOC | Bifunctional purine biosynthesis protein PurH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=purH PE=3 SV=1 | 483 | 600 | 4.0E-08 |
sp|Q11CT4|PUR9_CHESB | Bifunctional purine biosynthesis protein PurH OS=Chelativorans sp. (strain BNC1) GN=purH PE=3 SV=1 | 541 | 600 | 4.0E-08 |
sp|Q7UKJ8|PUR9_RHOBA | Bifunctional purine biosynthesis protein PurH OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=purH PE=3 SV=1 | 540 | 600 | 4.0E-08 |
sp|Q8F3W6|PUR9_LEPIN | Bifunctional purine biosynthesis protein PurH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=purH PE=3 SV=1 | 541 | 600 | 4.0E-08 |
sp|Q72RT5|PUR9_LEPIC | Bifunctional purine biosynthesis protein PurH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=purH PE=3 SV=1 | 541 | 600 | 4.0E-08 |
sp|Q2SZ52|PUR9_BURTA | Bifunctional purine biosynthesis protein PurH OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=purH PE=3 SV=1 | 476 | 600 | 5.0E-08 |
sp|A1AS76|PUR9_PELPD | Bifunctional purine biosynthesis protein PurH OS=Pelobacter propionicus (strain DSM 2379) GN=purH PE=3 SV=1 | 481 | 600 | 5.0E-08 |
sp|P74741|PUR9_SYNY3 | Bifunctional purine biosynthesis protein PurH OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purH PE=3 SV=2 | 541 | 600 | 5.0E-08 |
sp|B2JGU1|PUR9_BURP8 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=purH PE=3 SV=1 | 476 | 600 | 5.0E-08 |
sp|Q9CFG0|PUR9_LACLA | Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purH PE=3 SV=1 | 540 | 600 | 5.0E-08 |
sp|A4XKZ2|PUR9_CALS8 | Bifunctional purine biosynthesis protein PurH OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=purH PE=3 SV=1 | 539 | 600 | 6.0E-08 |
sp|C1FV76|PUR9_CLOBJ | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Kyoto / Type A2) GN=purH PE=3 SV=1 | 537 | 600 | 6.0E-08 |
sp|B7K3N8|PUR9_CYAP8 | Bifunctional purine biosynthesis protein PurH OS=Cyanothece sp. (strain PCC 8801) GN=purH PE=3 SV=1 | 541 | 600 | 7.0E-08 |
sp|B2UFL5|PUR9_RALPJ | Bifunctional purine biosynthesis protein PurH OS=Ralstonia pickettii (strain 12J) GN=purH PE=3 SV=1 | 476 | 600 | 7.0E-08 |
sp|A5I5V9|PUR9_CLOBH | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=purH PE=3 SV=1 | 537 | 600 | 7.0E-08 |
sp|A7FXD3|PUR9_CLOB1 | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=purH PE=3 SV=1 | 537 | 600 | 7.0E-08 |
sp|A7GH96|PUR9_CLOBL | Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=purH PE=3 SV=1 | 537 | 600 | 7.0E-08 |
sp|Q2RGU9|PUR9_MOOTA | Bifunctional purine biosynthesis protein PurH OS=Moorella thermoacetica (strain ATCC 39073) GN=purH PE=3 SV=1 | 483 | 600 | 7.0E-08 |
sp|A3NDF2|PUR9_BURP6 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 668) GN=purH PE=3 SV=1 | 476 | 600 | 8.0E-08 |
sp|A3NZ64|PUR9_BURP0 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 1106a) GN=purH PE=3 SV=1 | 476 | 600 | 8.0E-08 |
sp|A1V068|PUR9_BURMS | Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain SAVP1) GN=purH PE=3 SV=1 | 476 | 600 | 8.0E-08 |
sp|Q62HA6|PUR9_BURMA | Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain ATCC 23344) GN=purH PE=3 SV=1 | 476 | 600 | 8.0E-08 |
sp|A2S597|PUR9_BURM9 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain NCTC 10229) GN=purH PE=3 SV=1 | 476 | 600 | 8.0E-08 |
sp|A3MP76|PUR9_BURM7 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain NCTC 10247) GN=purH PE=3 SV=1 | 476 | 600 | 8.0E-08 |
sp|Q63QX8|PUR9_BURPS | Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain K96243) GN=purH PE=3 SV=1 | 476 | 600 | 8.0E-08 |
sp|Q3JNS8|PUR9_BURP1 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 1710b) GN=purH PE=3 SV=1 | 476 | 600 | 8.0E-08 |
sp|B2AH76|PUR9_CUPTR | Bifunctional purine biosynthesis protein PurH OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=purH PE=3 SV=1 | 476 | 600 | 8.0E-08 |
sp|A7GYY6|PUR9_CAMC5 | Bifunctional purine biosynthesis protein PurH OS=Campylobacter curvus (strain 525.92) GN=purH PE=3 SV=1 | 539 | 600 | 8.0E-08 |
sp|A9AH70|PUR9_BURM1 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=purH PE=3 SV=1 | 476 | 600 | 1.0E-07 |
sp|Q39RK1|PUR9_GEOMG | Bifunctional purine biosynthesis protein PurH OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=purH PE=3 SV=1 | 481 | 600 | 1.0E-07 |
sp|Q0KEC0|PUR9_CUPNH | Bifunctional purine biosynthesis protein PurH OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=purH PE=3 SV=1 | 476 | 600 | 1.0E-07 |
sp|P67540|PUR9_BRUSU | Bifunctional purine biosynthesis protein PurH OS=Brucella suis biovar 1 (strain 1330) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|A9WWU1|PUR9_BRUSI | Bifunctional purine biosynthesis protein PurH OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|P67539|PUR9_BRUME | Bifunctional purine biosynthesis protein PurH OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|C0RF67|PUR9_BRUMB | Bifunctional purine biosynthesis protein PurH OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|A9M854|PUR9_BRUC2 | Bifunctional purine biosynthesis protein PurH OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|A5VSF8|PUR9_BRUO2 | Bifunctional purine biosynthesis protein PurH OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|Q57B71|PUR9_BRUAB | Bifunctional purine biosynthesis protein PurH OS=Brucella abortus biovar 1 (strain 9-941) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|Q2YLH0|PUR9_BRUA2 | Bifunctional purine biosynthesis protein PurH OS=Brucella abortus (strain 2308) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|B2S7P0|PUR9_BRUA1 | Bifunctional purine biosynthesis protein PurH OS=Brucella abortus (strain S19) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|B5YLE5|PUR9_THEYD | Bifunctional purine biosynthesis protein PurH OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=purH PE=3 SV=1 | 484 | 600 | 1.0E-07 |
sp|Q051H8|PUR9_LEPBL | Bifunctional purine biosynthesis protein PurH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|Q04T56|PUR9_LEPBJ | Bifunctional purine biosynthesis protein PurH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-07 |
sp|B4EES4|PUR9_BURCJ | Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=purH PE=3 SV=1 | 476 | 600 | 2.0E-07 |
sp|Q1LRB3|PUR9_CUPMC | Bifunctional purine biosynthesis protein PurH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=purH PE=3 SV=1 | 476 | 600 | 2.0E-07 |
sp|C5CL84|PUR9_VARPS | Bifunctional purine biosynthesis protein PurH OS=Variovorax paradoxus (strain S110) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-07 |
sp|Q31R91|PUR9_SYNE7 | Bifunctional purine biosynthesis protein PurH OS=Synechococcus elongatus (strain PCC 7942) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-07 |
sp|A6TLS7|PUR9_ALKMQ | Bifunctional purine biosynthesis protein PurH OS=Alkaliphilus metalliredigens (strain QYMF) GN=purH PE=3 SV=1 | 536 | 600 | 2.0E-07 |
sp|Q46480|PUR9_ALLVD | Bifunctional purine biosynthesis protein PurH OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=purH PE=3 SV=2 | 541 | 600 | 2.0E-07 |
sp|C1D6F1|PUR9_LARHH | Bifunctional purine biosynthesis protein PurH OS=Laribacter hongkongensis (strain HLHK9) GN=purH PE=3 SV=1 | 480 | 600 | 2.0E-07 |
sp|B0SQ10|PUR9_LEPBP | Bifunctional purine biosynthesis protein PurH OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=purH PE=3 SV=1 | 541 | 600 | 2.0E-07 |
sp|B0SGW3|PUR9_LEPBA | Bifunctional purine biosynthesis protein PurH OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=purH PE=3 SV=1 | 541 | 600 | 2.0E-07 |
sp|Q8YSJ2|PUR9_NOSS1 | Bifunctional purine biosynthesis protein PurH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=purH PE=3 SV=1 | 538 | 600 | 3.0E-07 |
sp|Q3M6G3|PUR9_ANAVT | Bifunctional purine biosynthesis protein PurH OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=purH PE=3 SV=1 | 538 | 600 | 3.0E-07 |
sp|Q5LN38|PUR9_RUEPO | Bifunctional purine biosynthesis protein PurH OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=purH PE=3 SV=1 | 541 | 600 | 3.0E-07 |
sp|Q39JI8|PUR9_BURL3 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=purH PE=3 SV=1 | 483 | 600 | 3.0E-07 |
sp|A5G879|PUR9_GEOUR | Bifunctional purine biosynthesis protein PurH OS=Geobacter uraniireducens (strain Rf4) GN=purH PE=3 SV=1 | 541 | 600 | 3.0E-07 |
sp|B2VG81|PUR9_ERWT9 | Bifunctional purine biosynthesis protein PurH OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=purH PE=3 SV=1 | 538 | 600 | 3.0E-07 |
sp|B5EL42|PUR9_ACIF5 | Bifunctional purine biosynthesis protein PurH OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=purH PE=3 SV=1 | 539 | 600 | 3.0E-07 |
sp|B7J5P7|PUR9_ACIF2 | Bifunctional purine biosynthesis protein PurH OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=purH PE=3 SV=1 | 539 | 600 | 3.0E-07 |
sp|B2HEC3|PUR9_MYCMM | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=purH PE=3 SV=1 | 481 | 600 | 3.0E-07 |
sp|Q0TTB0|PUR9_CLOP1 | Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=purH PE=3 SV=1 | 541 | 600 | 3.0E-07 |
sp|Q8XMK2|PUR9_CLOPE | Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain 13 / Type A) GN=purH PE=3 SV=1 | 541 | 600 | 3.0E-07 |
sp|A0Q1J0|PUR9_CLONN | Bifunctional purine biosynthesis protein PurH OS=Clostridium novyi (strain NT) GN=purH PE=3 SV=1 | 522 | 600 | 3.0E-07 |
sp|Q89B23|PUR9_BUCBP | Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=purH PE=3 SV=1 | 539 | 600 | 3.0E-07 |
sp|B7KGS0|PUR9_CYAP7 | Bifunctional purine biosynthesis protein PurH OS=Cyanothece sp. (strain PCC 7424) GN=purH PE=3 SV=1 | 545 | 600 | 4.0E-07 |
sp|Q475R4|PUR9_CUPPJ | Bifunctional purine biosynthesis protein PurH OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=purH PE=3 SV=1 | 476 | 600 | 4.0E-07 |
sp|A0PWC5|PUR9_MYCUA | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium ulcerans (strain Agy99) GN=purH PE=3 SV=1 | 481 | 600 | 4.0E-07 |
sp|A9BIX9|PUR9_PETMO | Bifunctional purine biosynthesis protein PurH OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=purH PE=3 SV=1 | 541 | 600 | 4.0E-07 |
sp|A4JBL5|PUR9_BURVG | Bifunctional purine biosynthesis protein PurH OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=purH PE=3 SV=1 | 483 | 600 | 5.0E-07 |
sp|B2KCF7|PUR9_ELUMP | Bifunctional purine biosynthesis protein PurH OS=Elusimicrobium minutum (strain Pei191) GN=purH PE=3 SV=1 | 546 | 600 | 5.0E-07 |
sp|Q8Y6C5|PUR9_LISMO | Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purH PE=3 SV=1 | 537 | 600 | 5.0E-07 |
sp|B4S3H9|PUR9_PROA2 | Bifunctional purine biosynthesis protein PurH OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=purH PE=3 SV=1 | 483 | 600 | 5.0E-07 |
sp|B9MS89|PUR9_CALBD | Bifunctional purine biosynthesis protein PurH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=purH PE=3 SV=1 | 539 | 600 | 5.0E-07 |
sp|Q0SV48|PUR9_CLOPS | Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain SM101 / Type A) GN=purH PE=3 SV=1 | 541 | 600 | 5.0E-07 |
sp|Q116T4|PUR9_TRIEI | Bifunctional purine biosynthesis protein PurH OS=Trichodesmium erythraeum (strain IMS101) GN=purH PE=3 SV=1 | 541 | 600 | 6.0E-07 |
sp|B1JVV6|PUR9_BURCC | Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain MC0-3) GN=purH PE=3 SV=1 | 483 | 600 | 6.0E-07 |
sp|Q1BZ33|PUR9_BURCA | Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain AU 1054) GN=purH PE=3 SV=1 | 483 | 600 | 6.0E-07 |
sp|A0K4L7|PUR9_BURCH | Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain HI2424) GN=purH PE=3 SV=1 | 483 | 600 | 6.0E-07 |
sp|Q3B083|PUR9_SYNS9 | Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9902) GN=purH PE=3 SV=1 | 483 | 600 | 6.0E-07 |
sp|A1KTP9|PUR9_NEIMF | Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=purH PE=3 SV=1 | 483 | 600 | 6.0E-07 |
sp|Q5F6T1|PUR9_NEIG1 | Bifunctional purine biosynthesis protein PurH OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=purH PE=3 SV=1 | 483 | 600 | 6.0E-07 |
sp|B4RP71|PUR9_NEIG2 | Bifunctional purine biosynthesis protein PurH OS=Neisseria gonorrhoeae (strain NCCP11945) GN=purH PE=3 SV=1 | 483 | 600 | 6.0E-07 |
sp|B2SYJ7|PUR9_BURPP | Bifunctional purine biosynthesis protein PurH OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=purH PE=3 SV=1 | 476 | 600 | 7.0E-07 |
sp|A6SUQ1|PUR9_JANMA | Bifunctional purine biosynthesis protein PurH OS=Janthinobacterium sp. (strain Marseille) GN=purH PE=3 SV=1 | 483 | 600 | 7.0E-07 |
sp|Q8DWK8|PUR9_STRMU | Bifunctional purine biosynthesis protein PurH OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=purH PE=3 SV=2 | 538 | 600 | 7.0E-07 |
sp|B0JL55|PUR9_MICAN | Bifunctional purine biosynthesis protein PurH OS=Microcystis aeruginosa (strain NIES-843) GN=purH PE=3 SV=1 | 545 | 600 | 8.0E-07 |
sp|B7GFU2|PUR9_ANOFW | Bifunctional purine biosynthesis protein PurH OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=purH PE=3 SV=1 | 483 | 600 | 8.0E-07 |
sp|A7HA60|PUR9_ANADF | Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter sp. (strain Fw109-5) GN=purH PE=3 SV=1 | 523 | 600 | 8.0E-07 |
sp|Q0BI80|PUR9_BURCM | Bifunctional purine biosynthesis protein PurH OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=purH PE=3 SV=1 | 483 | 600 | 9.0E-07 |
sp|B1YTE2|PUR9_BURA4 | Bifunctional purine biosynthesis protein PurH OS=Burkholderia ambifaria (strain MC40-6) GN=purH PE=3 SV=1 | 483 | 600 | 9.0E-07 |
sp|B5EBF9|PUR9_GEOBB | Bifunctional purine biosynthesis protein PurH OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=purH PE=3 SV=1 | 539 | 600 | 9.0E-07 |
sp|A9M4I2|PUR9_NEIM0 | Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup C (strain 053442) GN=purH PE=3 SV=1 | 483 | 600 | 9.0E-07 |
sp|Q13UC4|PUR9_BURXL | Bifunctional purine biosynthesis protein PurH OS=Burkholderia xenovorans (strain LB400) GN=purH PE=3 SV=1 | 476 | 600 | 1.0E-06 |
sp|B0TEC5|PUR9_HELMI | Bifunctional purine biosynthesis protein PurH OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=purH PE=3 SV=1 | 541 | 600 | 1.0E-06 |
sp|Q5FIV5|PUR9_LACAC | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=purH PE=3 SV=1 | 540 | 600 | 1.0E-06 |
sp|O67775|PUR9_AQUAE | Bifunctional purine biosynthesis protein PurH OS=Aquifex aeolicus (strain VF5) GN=purH PE=3 SV=1 | 483 | 600 | 1.0E-06 |
sp|Q7VDS0|PUR9_PROMA | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=purH PE=3 SV=1 | 483 | 600 | 1.0E-06 |
sp|A4G1U6|PUR9_HERAR | Bifunctional purine biosynthesis protein PurH OS=Herminiimonas arsenicoxydans GN=purH PE=3 SV=1 | 483 | 600 | 1.0E-06 |
sp|A0AJL9|PUR9_LISW6 | Bifunctional purine biosynthesis protein PurH OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=purH PE=3 SV=1 | 537 | 600 | 1.0E-06 |
sp|Q92AP3|PUR9_LISIN | Bifunctional purine biosynthesis protein PurH OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purH PE=3 SV=1 | 537 | 600 | 1.0E-06 |
sp|Q04EU6|PUR9_OENOB | Bifunctional purine biosynthesis protein PurH OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=purH PE=3 SV=1 | 534 | 600 | 1.0E-06 |
sp|Q7P0M1|PUR9_CHRVO | Bifunctional purine biosynthesis protein PurH OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=purH PE=3 SV=1 | 539 | 600 | 2.0E-06 |
sp|C6E5Z3|PUR9_GEOSM | Bifunctional purine biosynthesis protein PurH OS=Geobacter sp. (strain M21) GN=purH PE=3 SV=1 | 539 | 600 | 2.0E-06 |
sp|Q9KF53|PUR9_BACHD | Bifunctional purine biosynthesis protein PurH OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purH PE=3 SV=1 | 538 | 600 | 2.0E-06 |
sp|Q049M1|PUR9_LACDB | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=purH PE=3 SV=1 | 540 | 600 | 2.0E-06 |
sp|Q1G9G2|PUR9_LACDA | Bifunctional purine biosynthesis protein PurH OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=purH PE=3 SV=1 | 540 | 600 | 2.0E-06 |
sp|Q9JZM7|PUR9_NEIMB | Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup B (strain MC58) GN=purH PE=3 SV=1 | 483 | 600 | 2.0E-06 |
sp|C1KW64|PUR9_LISMC | Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-06 |
sp|Q71YQ3|PUR9_LISMF | Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-06 |
sp|B9EAZ2|PUR9_MACCJ | Bifunctional purine biosynthesis protein PurH OS=Macrococcus caseolyticus (strain JCSC5402) GN=purH PE=3 SV=1 | 540 | 600 | 2.0E-06 |
sp|B9DQ42|PUR9_STACT | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus carnosus (strain TM300) GN=purH PE=3 SV=1 | 540 | 600 | 2.0E-06 |
sp|P9WHM7|PUR9_MYCTU | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purH PE=1 SV=1 | 481 | 600 | 2.0E-06 |
sp|P9WHM6|PUR9_MYCTO | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purH PE=3 SV=1 | 481 | 600 | 2.0E-06 |
sp|A5U0Z7|PUR9_MYCTA | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=purH PE=3 SV=1 | 481 | 600 | 2.0E-06 |
sp|C1ALU3|PUR9_MYCBT | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=purH PE=3 SV=1 | 481 | 600 | 2.0E-06 |
sp|A1KH91|PUR9_MYCBP | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=purH PE=3 SV=1 | 481 | 600 | 2.0E-06 |
sp|P67542|PUR9_MYCBO | Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=purH PE=3 SV=1 | 481 | 600 | 2.0E-06 |
sp|A5N0Q0|PUR9_CLOK5 | Bifunctional purine biosynthesis protein PurH OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-06 |
sp|B9E4K6|PUR9_CLOK1 | Bifunctional purine biosynthesis protein PurH OS=Clostridium kluyveri (strain NBRC 12016) GN=purH PE=3 SV=1 | 537 | 600 | 2.0E-06 |
sp|Q49WJ7|PUR9_STAS1 | Bifunctional purine biosynthesis protein PurH OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purH PE=3 SV=1 | 540 | 600 | 3.0E-06 |
sp|Q6FYG4|PUR9_BARQU | Bifunctional purine biosynthesis protein PurH OS=Bartonella quintana (strain Toulouse) GN=purH PE=3 SV=1 | 541 | 600 | 3.0E-06 |
sp|A6UED3|PUR9_SINMW | Bifunctional purine biosynthesis protein PurH OS=Sinorhizobium medicae (strain WSM419) GN=purH PE=3 SV=1 | 541 | 600 | 3.0E-06 |
sp|Q92KX6|PUR9_RHIME | Bifunctional purine biosynthesis protein PurH OS=Rhizobium meliloti (strain 1021) GN=purH PE=3 SV=1 | 541 | 600 | 3.0E-06 |
sp|B8DDZ2|PUR9_LISMH | Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=purH PE=3 SV=1 | 537 | 600 | 3.0E-06 |
sp|C0QXU6|PUR9_BRAHW | Bifunctional purine biosynthesis protein PurH OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=purH PE=3 SV=1 | 537 | 600 | 3.0E-06 |
sp|Q3K3Z7|PUR9_STRA1 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=purH PE=3 SV=1 | 539 | 600 | 3.0E-06 |
sp|P67546|PUR9_STRA5 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=purH PE=3 SV=1 | 539 | 600 | 3.0E-06 |
sp|P67545|PUR9_STRA3 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype III (strain NEM316) GN=purH PE=3 SV=1 | 539 | 600 | 3.0E-06 |
sp|Q892X3|PUR9_CLOTE | Bifunctional purine biosynthesis protein PurH OS=Clostridium tetani (strain Massachusetts / E88) GN=purH PE=3 SV=1 | 537 | 600 | 3.0E-06 |
sp|B1XS23|PUR9_POLNS | Bifunctional purine biosynthesis protein PurH OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=purH PE=3 SV=1 | 483 | 600 | 4.0E-06 |
sp|B0BZH9|PUR9_ACAM1 | Bifunctional purine biosynthesis protein PurH OS=Acaryochloris marina (strain MBIC 11017) GN=purH PE=3 SV=1 | 538 | 600 | 4.0E-06 |
sp|A2C098|PUR9_PROM1 | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain NATL1A) GN=purH PE=3 SV=1 | 538 | 600 | 4.0E-06 |
sp|Q46HA8|PUR9_PROMT | Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain NATL2A) GN=purH PE=3 SV=1 | 538 | 600 | 4.0E-06 |
sp|Q9KY50|PUR9_STRCO | Bifunctional purine biosynthesis protein PurH OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=purH PE=3 SV=1 | 483 | 600 | 4.0E-06 |
sp|Q1J119|PUR9_DEIGD | Bifunctional purine biosynthesis protein PurH OS=Deinococcus geothermalis (strain DSM 11300) GN=purH PE=3 SV=1 | 483 | 600 | 5.0E-06 |
sp|Q2IKQ7|PUR9_ANADE | Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=purH PE=3 SV=1 | 541 | 600 | 5.0E-06 |
sp|B8JHC9|PUR9_ANAD2 | Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=purH PE=3 SV=1 | 541 | 600 | 5.0E-06 |
sp|B4UJ61|PUR9_ANASK | Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter sp. (strain K) GN=purH PE=3 SV=1 | 541 | 600 | 5.0E-06 |
sp|B3QS62|PUR9_CHLT3 | Bifunctional purine biosynthesis protein PurH OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=purH PE=3 SV=1 | 483 | 600 | 6.0E-06 |
sp|A5GIF4|PUR9_SYNPW | Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain WH7803) GN=purH PE=3 SV=1 | 483 | 600 | 6.0E-06 |
sp|Q1JJ80|PUR9_STRPD | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=purH PE=3 SV=1 | 539 | 600 | 7.0E-06 |
sp|A3QII0|PUR9_SHELP | Bifunctional purine biosynthesis protein PurH OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=purH PE=3 SV=1 | 483 | 600 | 8.0E-06 |
sp|B5XJ20|PUR9_STRPZ | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=purH PE=3 SV=1 | 539 | 600 | 8.0E-06 |
sp|P0DD61|PUR9_STRPQ | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=purH PE=3 SV=1 | 539 | 600 | 8.0E-06 |
sp|P0DD60|PUR9_STRP3 | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=purH PE=3 SV=1 | 539 | 600 | 8.0E-06 |
sp|Q48VY9|PUR9_STRPM | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=purH PE=3 SV=1 | 539 | 600 | 8.0E-06 |
sp|Q1JP34|PUR9_STRPC | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=purH PE=3 SV=1 | 539 | 600 | 8.0E-06 |
sp|Q1JE78|PUR9_STRPB | Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=purH PE=3 SV=1 | 539 | 600 | 8.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003937 | IMP cyclohydrolase activity | Yes |
GO:0004643 | phosphoribosylaminoimidazolecarboxamide formyltransferase activity | Yes |
GO:0006164 | purine nucleotide biosynthetic process | Yes |
GO:0016742 | hydroxymethyl-, formyl- and related transferase activity | No |
GO:0019438 | aromatic compound biosynthetic process | No |
GO:0072522 | purine-containing compound biosynthetic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0072521 | purine-containing compound metabolic process | No |
GO:0044281 | small molecule metabolic process | No |
GO:0006139 | nucleobase-containing compound metabolic process | No |
GO:0009165 | nucleotide biosynthetic process | No |
GO:0008150 | biological_process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0006793 | phosphorus metabolic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:1901360 | organic cyclic compound metabolic process | No |
GO:0009058 | biosynthetic process | No |
GO:0006796 | phosphate-containing compound metabolic process | No |
GO:0016787 | hydrolase activity | No |
GO:1901293 | nucleoside phosphate biosynthetic process | No |
GO:0006163 | purine nucleotide metabolic process | No |
GO:0055086 | nucleobase-containing small molecule metabolic process | No |
GO:0016740 | transferase activity | No |
GO:0016741 | transferase activity, transferring one-carbon groups | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0003824 | catalytic activity | No |
GO:0009987 | cellular process | No |
GO:0006725 | cellular aromatic compound metabolic process | No |
GO:0044238 | primary metabolic process | No |
GO:1901362 | organic cyclic compound biosynthetic process | No |
GO:0003674 | molecular_function | No |
GO:0034654 | nucleobase-containing compound biosynthetic process | No |
GO:0008152 | metabolic process | No |
GO:0016810 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds | No |
GO:0018130 | heterocycle biosynthetic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0016814 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines | No |
GO:0009117 | nucleotide metabolic process | No |
GO:0019637 | organophosphate metabolic process | No |
GO:0006753 | nucleoside phosphate metabolic process | No |
GO:0019238 | cyclohydrolase activity | No |
GO:0046483 | heterocycle metabolic process | No |
GO:0090407 | organophosphate biosynthetic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 23 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|073750 MPQHIALLSVYDKTNLLDLAKGLQESGVRLLGSGGTAKKIRDAGIPIEDVSDITKAPEMLGGRVKTLHPAVHGGI LARSIPSDEEDLKAQSISPISIVVCNLYPFTQTIAKPNCTLSDAIEEIDIGGVTLLRAAAKNHARVSILSDPVDY DGFLAKWKEGKGDVGEGERAKLALKAFEQTAKYDEAISGYFRAQYASAELSAEKKFADVQRMVLRYGANPHQKPA QAFVDEGNLPFKALCGSPGYINLLDALNSYALVRELQGALNLPAAASFKHVSPAGAAVGIELDEIEKKVYGVDDL KEPLTPLAAAYARARGADRMSSFGDFVALSAPCDLATARIISREVSDGIIAPGYSPEALDVLRKKKSGKYCVLEM DPSYDPPSVETKQVYGIFLQQKRNDAKIDSSLFSNLVSKNRHLTPEAITDLIVATLALKYTQSNSVAYAYHGAIV GIGAGQQSRIHCTRLAGGKTDLWWLRHHPRVIDLPFKKGVKRADKANAIDLYVSGEELEGSEKSHWESLFEGRVE DLSAGEKREWIRKLDGVACSSDAFFPFPDNVYRARKSGVKYLCAPGGSVMDDECIKAADELDMVFAHTELRLFHH * |
Coding | >AgabiH97|073750 ATGCCTCAGCACATTGCTCTTTTATCGGTGTACGACAAGACTAATCTTCTAGATCTTGCGAAGGGTCTTCAAGAA TCAGGTGTGCGATTGTTAGGGTCAGGGGGCACCGCAAAAAAAATCAGGGATGCTGGCATTCCCATCGAAGATGTT TCTGATATCACAAAAGCCCCCGAAATGTTAGGTGGTCGTGTCAAAACTCTCCATCCAGCTGTTCACGGAGGCATC CTGGCGCGTTCAATTCCGTCTGACGAAGAAGACCTCAAAGCCCAATCTATTTCTCCAATTTCCATCGTCGTCTGC AACCTGTATCCTTTCACCCAAACCATTGCAAAACCCAACTGCACCTTGTCTGATGCAATTGAAGAAATTGATATC GGAGGAGTTACCCTTCTTCGTGCGGCAGCCAAAAACCACGCTCGCGTATCTATATTATCCGACCCTGTCGATTAT GATGGTTTTTTGGCCAAGTGGAAAGAAGGCAAAGGCGATGTCGGTGAGGGTGAGAGAGCAAAATTAGCGTTGAAG GCGTTTGAACAGACTGCAAAGTATGATGAAGCTATTAGTGGATACTTCAGGGCACAATATGCTTCGGCAGAGTTA AGTGCAGAGAAGAAATTTGCGGACGTACAGAGGATGGTGTTGAGATACGGCGCCAATCCTCATCAAAAACCAGCA CAGGCATTTGTGGACGAGGGGAATTTACCGTTCAAGGCTCTCTGCGGATCGCCTGGTTATATTAACCTGCTCGAC GCCTTGAATTCTTACGCGTTGGTGAGAGAACTCCAAGGAGCTCTGAATCTCCCCGCTGCCGCGTCGTTCAAGCAT GTTTCTCCTGCTGGTGCTGCCGTTGGAATTGAACTCGACGAGATCGAAAAGAAGGTCTATGGTGTTGATGATCTC AAGGAGCCTCTGACACCTCTTGCTGCCGCATATGCTCGTGCTCGTGGTGCTGATCGTATGTCTTCTTTCGGAGAC TTTGTCGCCCTCTCGGCTCCTTGCGATCTCGCGACTGCTCGCATTATTTCTCGAGAAGTCTCCGATGGAATAATC GCTCCCGGATATTCGCCTGAAGCCCTTGACGTCCTCAGAAAAAAGAAGTCTGGGAAGTATTGTGTTCTCGAGATG GATCCCTCGTATGATCCTCCTTCCGTAGAGACCAAACAAGTTTACGGCATCTTCCTCCAGCAAAAACGCAATGAT GCCAAAATCGACTCCTCACTCTTCTCAAATCTCGTCTCCAAAAACAGACACCTCACACCAGAAGCTATTACAGAT TTGATCGTAGCCACCCTCGCACTCAAATACACTCAGTCCAACAGTGTTGCCTATGCTTATCATGGGGCTATTGTT GGCATCGGTGCGGGACAACAATCGAGAATTCATTGCACTCGTCTCGCAGGAGGCAAAACCGATCTATGGTGGCTC CGTCATCATCCTCGTGTCATCGACTTACCATTCAAAAAAGGAGTTAAGAGGGCGGACAAAGCGAATGCAATTGAT CTATATGTATCTGGTGAAGAGCTTGAAGGTTCGGAGAAAAGTCATTGGGAATCTTTGTTTGAAGGTAGGGTAGAG GATTTGAGTGCGGGAGAGAAGAGGGAGTGGATTAGGAAGCTGGATGGAGTAGCTTGTTCAAGTGATGCATTTTTC CCGTTCCCGGATAACGTCTATAGAGCGAGGAAGAGTGGTGTCAAGTATCTTTGTGCACCTGGTGGAAGTGTGATG GATGATGAGTGTATAAAGGCGGCGGATGAACTGGACATGGTATTTGCCCATACTGAACTCCGGTTATTCCATCAT TAG |
Transcript | >AgabiH97|073750 ATGCCTCAGCACATTGCTCTTTTATCGGTGTACGACAAGACTAATCTTCTAGATCTTGCGAAGGGTCTTCAAGAA TCAGGTGTGCGATTGTTAGGGTCAGGGGGCACCGCAAAAAAAATCAGGGATGCTGGCATTCCCATCGAAGATGTT TCTGATATCACAAAAGCCCCCGAAATGTTAGGTGGTCGTGTCAAAACTCTCCATCCAGCTGTTCACGGAGGCATC CTGGCGCGTTCAATTCCGTCTGACGAAGAAGACCTCAAAGCCCAATCTATTTCTCCAATTTCCATCGTCGTCTGC AACCTGTATCCTTTCACCCAAACCATTGCAAAACCCAACTGCACCTTGTCTGATGCAATTGAAGAAATTGATATC GGAGGAGTTACCCTTCTTCGTGCGGCAGCCAAAAACCACGCTCGCGTATCTATATTATCCGACCCTGTCGATTAT GATGGTTTTTTGGCCAAGTGGAAAGAAGGCAAAGGCGATGTCGGTGAGGGTGAGAGAGCAAAATTAGCGTTGAAG GCGTTTGAACAGACTGCAAAGTATGATGAAGCTATTAGTGGATACTTCAGGGCACAATATGCTTCGGCAGAGTTA AGTGCAGAGAAGAAATTTGCGGACGTACAGAGGATGGTGTTGAGATACGGCGCCAATCCTCATCAAAAACCAGCA CAGGCATTTGTGGACGAGGGGAATTTACCGTTCAAGGCTCTCTGCGGATCGCCTGGTTATATTAACCTGCTCGAC GCCTTGAATTCTTACGCGTTGGTGAGAGAACTCCAAGGAGCTCTGAATCTCCCCGCTGCCGCGTCGTTCAAGCAT GTTTCTCCTGCTGGTGCTGCCGTTGGAATTGAACTCGACGAGATCGAAAAGAAGGTCTATGGTGTTGATGATCTC AAGGAGCCTCTGACACCTCTTGCTGCCGCATATGCTCGTGCTCGTGGTGCTGATCGTATGTCTTCTTTCGGAGAC TTTGTCGCCCTCTCGGCTCCTTGCGATCTCGCGACTGCTCGCATTATTTCTCGAGAAGTCTCCGATGGAATAATC GCTCCCGGATATTCGCCTGAAGCCCTTGACGTCCTCAGAAAAAAGAAGTCTGGGAAGTATTGTGTTCTCGAGATG GATCCCTCGTATGATCCTCCTTCCGTAGAGACCAAACAAGTTTACGGCATCTTCCTCCAGCAAAAACGCAATGAT GCCAAAATCGACTCCTCACTCTTCTCAAATCTCGTCTCCAAAAACAGACACCTCACACCAGAAGCTATTACAGAT TTGATCGTAGCCACCCTCGCACTCAAATACACTCAGTCCAACAGTGTTGCCTATGCTTATCATGGGGCTATTGTT GGCATCGGTGCGGGACAACAATCGAGAATTCATTGCACTCGTCTCGCAGGAGGCAAAACCGATCTATGGTGGCTC CGTCATCATCCTCGTGTCATCGACTTACCATTCAAAAAAGGAGTTAAGAGGGCGGACAAAGCGAATGCAATTGAT CTATATGTATCTGGTGAAGAGCTTGAAGGTTCGGAGAAAAGTCATTGGGAATCTTTGTTTGAAGGTAGGGTAGAG GATTTGAGTGCGGGAGAGAAGAGGGAGTGGATTAGGAAGCTGGATGGAGTAGCTTGTTCAAGTGATGCATTTTTC CCGTTCCCGGATAACGTCTATAGAGCGAGGAAGAGTGGTGTCAAGTATCTTTGTGCACCTGGTGGAAGTGTGATG GATGATGAGTGTATAAAGGCGGCGGATGAACTGGACATGGTATTTGCCCATACTGAACTCCGGTTATTCCATCAT TAG |
Gene | >AgabiH97|073750 ATGCCTCAGCACATTGGTATGTGCGACGTATAAAACTTTCGAAATGCAATTCAATAACACCAACAGCTCTTTTAT CGGTGTACGACAAGACTAATCTTCTAGATCTTGCGAAGGGTCTTCAAGAATCAGGTGTGCGATTGTTAGGGTCAG GGGGCACCGCAAAAAAAATCAGGGATGCTGGCATTCCCATCGAGTTCGTCTTTTTCCGCATAGTATCCAATTTAC GTGACTATATTCCTGCAGAGATGTTTCTGATATCACAAAAGCCCCCGAAATGTTAGGTGGTCGTGTCAAAACTCT CCATCCAGCTGTTCACGGAGGTTAGTACGGCGTAACTCATTCACGGTATACGATGAGAACTTCACTATTTTATCT ATTTTATCAAGGCATCCTGGCGCGTTCAATTCCGTCTGACGAAGAAGACCTCAAAGCCCAATCTATTTCTCCAAT TTCCATCGTCGTCTGCAACCTGTATCCTTTCACCCAAACCATTGCAAAACCCAACTGCACCTTGTCTGATGCAAT TGAAGAAATTGATATCGGAGGAGTTACCCTTCTTCGTGCGGCAGCCAAAAACCACGCTCGCGTATCTATATTATC CGACCCTGTCGATTATGATGGTTTTTTGGCCAAGTGGAAAGAAGGCAAAGGCGATGTCGGTGAGGGTGAGAGAGC AAAATTAGCGTTGAAGGCGTTTGAACAGACTGCAAAGTATGATGAAGCTATTAGTGGATACTTCAGGGCACAATA TGCTTCGGCAGAGTTAAGTGCAGAGAAGAAATTTGCGGACGTACAGAGGATGGTGTTGAGATACGGCGCCAATCC TCATCAAAAACCAGCACAGGCATTTGTGGACGAGGGGAATTTACCGTTCAAGGGTAGGTGATTTACCTGAGCAGT TAGCGAACCACTAATGTTAGTTAGCTCTCTGCGGATCGCCTGGTTATATTAACCTGCTCGACGCCTTGAATTCTT ACGCGTTGGTGAGAGAACTCCAAGGAGCTCTGAATCTCCCCGCTGCCGCGTCGTTCAAGCATGTTTCTCCTGCTG GTGCTGCCGTTGGAATTGAACTCGACGAGATCGAAAAGAAGGTCTATGGTGTTGATGATCTCAAGGAGCCTCTGA CACCTCTTGCTGCCGCATATGCTCGTGCTCGTGGTACGGCTGTTGTCGTTTTCTTTGTATGTTTATCCCAACCTA ACGAGAGTATTATCCAGGTGCTGATCGTATGTCTTCTTTCGGAGACTTTGTCGCCCTCTCGGCTCCTTGCGATCT CGCGACTGCTCGCATTATTTCTCGAGAAGTCTCCGATGGAATAATCGCTCCCGGATATTCGCCTGAAGCCCTTGA CGTCCTCAGAAAAAAGAAGTCTGGGAAGTATTGTGTTCTCGAGGTTTGTCCGGGCTATAATAACCCTGTACATGA TTTATTCTTGACCCTATGAACATCCTAGATGGATCCCTCGTATGATCCTCCTTCCGTAGAGACCAAACAAGTTTA CGGCATCTTCCTCCAGCAAAAACGCAATGATGCCAAAATCGACTCCTCACTCTTCTCAAATCTCGTCTCCAAAAA CAGACACCTCACACCAGAAGCTATTACAGATTTGATCGTAGCCACCCTCGCACTCAAATACACTCAGTCCAACAG TGTTGCCTATGCTTATCATGGGGCTATTGTTGGCATCGGTGCGGGACAACAATCGAGAATTCATTGCACTCGTCT CGCAGGAGGCAAAACCGATCTATGGTGGCTCCGTCATCATCCTCGTGTCATCGACTTACCATTCAAAAAAGGAGT TAAGAGGGCGGACAAAGCGAATGCAATTGATCTATATGTATCTGGTGAAGAGCTTGAAGGTTCGGAGAAAAGTCA TTGGGAATCTTTGTTTGAAGGTAGGGTAGAGGATTTGAGTGCGGGAGAGAAGAGGGAGTGGATTAGGAAGCTGGA TGGAGTAGCTTGTTCAAGTGATGCATTTTTCCCGTTCCCGGATAACGTCTATAGAGCGAGGAAGAGTGGTGTCAA GTATCTTTGTGCACCTGGTGGAAGTGTGATGGATGATGAGTGTATAAAGGCGGCGGATGAACTGGACATGGTATT TGCCCATACTGAACTCCGGTTATTCCATCATTAG |