Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|073750
Gene name
Locationscaffold_4:2005437..2007571
Strand+
Gene length (bp)2134
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme 1.5E-91 134 468
PF02142 MGS MGS-like domain 2.2E-24 16 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54113|PUR91_YEAST Bifunctional purine biosynthesis protein ADE16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE16 PE=1 SV=1 6 600 0.0E+00
sp|P38009|PUR92_YEAST Bifunctional purine biosynthesis protein ADE17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE17 PE=1 SV=2 6 600 0.0E+00
sp|O74928|PUR9_SCHPO Bifunctional purine biosynthesis protein ade10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade10 PE=2 SV=1 6 600 0.0E+00
sp|Q9CWJ9|PUR9_MOUSE Bifunctional purine biosynthesis protein PURH OS=Mus musculus GN=Atic PE=1 SV=2 2 600 0.0E+00
sp|O35567|PUR9_RAT Bifunctional purine biosynthesis protein PURH OS=Rattus norvegicus GN=Atic PE=1 SV=2 4 600 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54113|PUR91_YEAST Bifunctional purine biosynthesis protein ADE16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE16 PE=1 SV=1 6 600 0.0E+00
sp|P38009|PUR92_YEAST Bifunctional purine biosynthesis protein ADE17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE17 PE=1 SV=2 6 600 0.0E+00
sp|O74928|PUR9_SCHPO Bifunctional purine biosynthesis protein ade10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade10 PE=2 SV=1 6 600 0.0E+00
sp|Q9CWJ9|PUR9_MOUSE Bifunctional purine biosynthesis protein PURH OS=Mus musculus GN=Atic PE=1 SV=2 2 600 0.0E+00
sp|O35567|PUR9_RAT Bifunctional purine biosynthesis protein PURH OS=Rattus norvegicus GN=Atic PE=1 SV=2 4 600 0.0E+00
sp|Q5R5C2|PUR9_PONAB Bifunctional purine biosynthesis protein PURH OS=Pongo abelii GN=ATIC PE=2 SV=1 2 600 0.0E+00
sp|P31939|PUR9_HUMAN Bifunctional purine biosynthesis protein PURH OS=Homo sapiens GN=ATIC PE=1 SV=3 2 600 0.0E+00
sp|Q0VCK0|PUR9_BOVIN Bifunctional purine biosynthesis protein PURH OS=Bos taurus GN=ATIC PE=2 SV=1 2 600 0.0E+00
sp|P31335|PUR9_CHICK Bifunctional purine biosynthesis protein PURH OS=Gallus gallus GN=ATIC PE=1 SV=1 3 600 0.0E+00
sp|A4WWQ0|PUR9_RHOS5 Bifunctional purine biosynthesis protein PurH OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=purH PE=3 SV=1 1 600 5.0E-93
sp|B9KP36|PUR9_RHOSK Bifunctional purine biosynthesis protein PurH OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=purH PE=3 SV=1 1 600 6.0E-93
sp|Q3IYU8|PUR9_RHOS4 Bifunctional purine biosynthesis protein PurH OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=purH PE=3 SV=1 1 600 6.0E-93
sp|A3PNE9|PUR9_RHOS1 Bifunctional purine biosynthesis protein PurH OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=purH PE=3 SV=1 1 600 6.0E-93
sp|Q7N954|PUR9_PHOLL Bifunctional purine biosynthesis protein PurH OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=purH PE=3 SV=1 2 600 4.0E-92
sp|Q8DIN5|PUR9_THEEB Bifunctional purine biosynthesis protein PurH OS=Thermosynechococcus elongatus (strain BP-1) GN=purH PE=3 SV=1 5 466 3.0E-91
sp|B4TQL6|PUR9_SALSV Bifunctional purine biosynthesis protein PurH OS=Salmonella schwarzengrund (strain CVM19633) GN=purH PE=3 SV=1 2 600 8.0E-91
sp|A4TS14|PUR9_YERPP Bifunctional purine biosynthesis protein PurH OS=Yersinia pestis (strain Pestoides F) GN=purH PE=3 SV=1 2 600 1.0E-90
sp|Q1CN60|PUR9_YERPN Bifunctional purine biosynthesis protein PurH OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=purH PE=3 SV=1 2 600 1.0E-90
sp|A9R8E1|PUR9_YERPG Bifunctional purine biosynthesis protein PurH OS=Yersinia pestis bv. Antiqua (strain Angola) GN=purH PE=3 SV=1 2 600 1.0E-90
sp|Q8ZAR3|PUR9_YERPE Bifunctional purine biosynthesis protein PurH OS=Yersinia pestis GN=purH PE=3 SV=1 2 600 1.0E-90
sp|Q1C1V9|PUR9_YERPA Bifunctional purine biosynthesis protein PurH OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=purH PE=3 SV=1 2 600 1.0E-90
sp|A7FNG6|PUR9_YERP3 Bifunctional purine biosynthesis protein PurH OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=purH PE=3 SV=1 2 600 1.0E-90
sp|B1JJL6|PUR9_YERPY Bifunctional purine biosynthesis protein PurH OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=purH PE=3 SV=1 2 600 1.0E-90
sp|Q66FN5|PUR9_YERPS Bifunctional purine biosynthesis protein PurH OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=purH PE=3 SV=1 2 600 1.0E-90
sp|B2K130|PUR9_YERPB Bifunctional purine biosynthesis protein PurH OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=purH PE=3 SV=1 2 600 1.0E-90
sp|Q16CE0|PUR9_ROSDO Bifunctional purine biosynthesis protein PurH OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=purH PE=3 SV=1 2 600 1.0E-90
sp|B4T108|PUR9_SALNS Bifunctional purine biosynthesis protein PurH OS=Salmonella newport (strain SL254) GN=purH PE=3 SV=1 2 600 2.0E-90
sp|A8G8G3|PUR9_SERP5 Bifunctional purine biosynthesis protein PurH OS=Serratia proteamaculans (strain 568) GN=purH PE=3 SV=1 2 600 3.0E-90
sp|A9N0L8|PUR9_SALPB Bifunctional purine biosynthesis protein PurH OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=purH PE=3 SV=1 2 600 4.0E-90
sp|P26978|PUR9_SALTY Bifunctional purine biosynthesis protein PurH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=purH PE=3 SV=2 2 600 4.0E-90
sp|A1JIJ7|PUR9_YERE8 Bifunctional purine biosynthesis protein PurH OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=purH PE=3 SV=1 2 600 4.0E-90
sp|B4TDF3|PUR9_SALHS Bifunctional purine biosynthesis protein PurH OS=Salmonella heidelberg (strain SL476) GN=purH PE=3 SV=1 2 600 6.0E-90
sp|A1S2J9|PUR9_SHEAM Bifunctional purine biosynthesis protein PurH OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=purH PE=3 SV=1 2 600 6.0E-90
sp|Q8Z335|PUR9_SALTI Bifunctional purine biosynthesis protein PurH OS=Salmonella typhi GN=purH PE=3 SV=1 2 600 7.0E-90
sp|B5BJS5|PUR9_SALPK Bifunctional purine biosynthesis protein PurH OS=Salmonella paratyphi A (strain AKU_12601) GN=purH PE=3 SV=1 2 600 1.0E-89
sp|Q5PKA9|PUR9_SALPA Bifunctional purine biosynthesis protein PurH OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=purH PE=3 SV=1 2 600 1.0E-89
sp|C6DHT5|PUR9_PECCP Bifunctional purine biosynthesis protein PurH OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=purH PE=3 SV=1 2 600 2.0E-89
sp|B5F1I9|PUR9_SALA4 Bifunctional purine biosynthesis protein PurH OS=Salmonella agona (strain SL483) GN=purH PE=3 SV=1 2 600 2.0E-89
sp|Q3YUX8|PUR9_SHISS Bifunctional purine biosynthesis protein PurH OS=Shigella sonnei (strain Ss046) GN=purH PE=3 SV=1 2 600 2.0E-89
sp|Q83IR9|PUR9_SHIFL Bifunctional purine biosynthesis protein PurH OS=Shigella flexneri GN=purH PE=3 SV=1 2 600 2.0E-89
sp|Q0SXZ4|PUR9_SHIF8 Bifunctional purine biosynthesis protein PurH OS=Shigella flexneri serotype 5b (strain 8401) GN=purH PE=3 SV=1 2 600 2.0E-89
sp|Q32AH9|PUR9_SHIDS Bifunctional purine biosynthesis protein PurH OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=purH PE=3 SV=1 2 600 2.0E-89
sp|Q31TZ1|PUR9_SHIBS Bifunctional purine biosynthesis protein PurH OS=Shigella boydii serotype 4 (strain Sb227) GN=purH PE=3 SV=1 2 600 2.0E-89
sp|B2TWJ3|PUR9_SHIB3 Bifunctional purine biosynthesis protein PurH OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=purH PE=3 SV=1 2 600 2.0E-89
sp|B6I5L8|PUR9_ECOSE Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain SE11) GN=purH PE=3 SV=1 2 600 2.0E-89
sp|B7M7R5|PUR9_ECO8A Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O8 (strain IAI1) GN=purH PE=3 SV=1 2 600 2.0E-89
sp|Q6DAL2|PUR9_PECAS Bifunctional purine biosynthesis protein PurH OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=purH PE=3 SV=1 2 600 3.0E-89
sp|B5Z0A3|PUR9_ECO5E Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=purH PE=3 SV=1 2 600 3.0E-89
sp|Q8X611|PUR9_ECO57 Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O157:H7 GN=purH PE=3 SV=1 2 600 3.0E-89
sp|P15639|PUR9_ECOLI Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain K12) GN=purH PE=1 SV=1 2 600 3.0E-89
sp|B1IUP1|PUR9_ECOLC Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=purH PE=3 SV=1 2 600 3.0E-89
sp|B1XC09|PUR9_ECODH Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain K12 / DH10B) GN=purH PE=3 SV=1 2 600 3.0E-89
sp|C5A0U7|PUR9_ECOBW Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=purH PE=3 SV=1 2 600 3.0E-89
sp|B7LAV3|PUR9_ECO55 Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain 55989 / EAEC) GN=purH PE=3 SV=1 2 600 3.0E-89
sp|Q2NWQ7|PUR9_SODGM Bifunctional purine biosynthesis protein PurH OS=Sodalis glossinidius (strain morsitans) GN=purH PE=3 SV=1 2 600 4.0E-89
sp|B7LUJ6|PUR9_ESCF3 Bifunctional purine biosynthesis protein PurH OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=purH PE=3 SV=1 2 600 4.0E-89
sp|B5XYD2|PUR9_KLEP3 Bifunctional purine biosynthesis protein PurH OS=Klebsiella pneumoniae (strain 342) GN=purH PE=3 SV=1 2 600 5.0E-89
sp|A8AKS0|PUR9_CITK8 Bifunctional purine biosynthesis protein PurH OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=purH PE=3 SV=1 2 600 6.0E-89
sp|A8A7A6|PUR9_ECOHS Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O9:H4 (strain HS) GN=purH PE=3 SV=1 2 600 8.0E-89
sp|B7MRD0|PUR9_ECO81 Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O81 (strain ED1a) GN=purH PE=3 SV=1 2 600 1.0E-88
sp|B7NFU7|PUR9_ECOLU Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=purH PE=3 SV=1 2 600 1.0E-88
sp|Q0TA59|PUR9_ECOL5 Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=purH PE=3 SV=1 2 600 1.0E-88
sp|A6TGR3|PUR9_KLEP7 Bifunctional purine biosynthesis protein PurH OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=purH PE=3 SV=1 2 600 1.0E-88
sp|B5FQM1|PUR9_SALDC Bifunctional purine biosynthesis protein PurH OS=Salmonella dublin (strain CT_02021853) GN=purH PE=3 SV=1 2 600 2.0E-88
sp|Q74FJ9|PUR9_GEOSL Bifunctional purine biosynthesis protein PurH OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=purH PE=3 SV=1 6 493 2.0E-88
sp|Q1R5X1|PUR9_ECOUT Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain UTI89 / UPEC) GN=purH PE=3 SV=1 2 600 2.0E-88
sp|A1AIH7|PUR9_ECOK1 Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O1:K1 / APEC GN=purH PE=3 SV=1 2 600 2.0E-88
sp|B7MIZ2|PUR9_ECO45 Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=purH PE=3 SV=1 2 600 2.0E-88
sp|B7NRT9|PUR9_ECO7I Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=purH PE=3 SV=1 2 600 3.0E-88
sp|B5RFH8|PUR9_SALG2 Bifunctional purine biosynthesis protein PurH OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=purH PE=3 SV=1 2 600 4.0E-88
sp|B5QYG1|PUR9_SALEP Bifunctional purine biosynthesis protein PurH OS=Salmonella enteritidis PT4 (strain P125109) GN=purH PE=3 SV=1 2 600 4.0E-88
sp|A7MJ89|PUR9_CROS8 Bifunctional purine biosynthesis protein PurH OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=purH PE=3 SV=1 2 600 5.0E-88
sp|Q1GKJ2|PUR9_RUEST Bifunctional purine biosynthesis protein PurH OS=Ruegeria sp. (strain TM1040) GN=purH PE=3 SV=1 2 600 6.0E-88
sp|C0Q2T8|PUR9_SALPC Bifunctional purine biosynthesis protein PurH OS=Salmonella paratyphi C (strain RKS4594) GN=purH PE=3 SV=1 2 600 8.0E-88
sp|B1LPG6|PUR9_ECOSM Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=purH PE=3 SV=1 2 600 9.0E-88
sp|B7UPG1|PUR9_ECO27 Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=purH PE=3 SV=1 2 600 1.0E-87
sp|A8LMD0|PUR9_DINSH Bifunctional purine biosynthesis protein PurH OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=purH PE=3 SV=1 1 600 1.0E-87
sp|A7ZUM3|PUR9_ECO24 Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=purH PE=3 SV=1 2 600 1.0E-87
sp|B4S133|PUR9_ALTMD Bifunctional purine biosynthesis protein PurH OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=purH PE=3 SV=1 2 600 2.0E-87
sp|Q8FB68|PUR9_ECOL6 Bifunctional purine biosynthesis protein PurH OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=purH PE=3 SV=1 2 600 3.0E-87
sp|Q8YSJ2|PUR9_NOSS1 Bifunctional purine biosynthesis protein PurH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=purH PE=3 SV=1 5 466 4.0E-87
sp|B7K3N8|PUR9_CYAP8 Bifunctional purine biosynthesis protein PurH OS=Cyanothece sp. (strain PCC 8801) GN=purH PE=3 SV=1 5 466 4.0E-87
sp|Q116T4|PUR9_TRIEI Bifunctional purine biosynthesis protein PurH OS=Trichodesmium erythraeum (strain IMS101) GN=purH PE=3 SV=1 3 466 6.0E-87
sp|A9MHC3|PUR9_SALAR Bifunctional purine biosynthesis protein PurH OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=purH PE=3 SV=1 6 600 7.0E-87
sp|A9GIT1|PUR9_SORC5 Bifunctional purine biosynthesis protein PurH OS=Sorangium cellulosum (strain So ce56) GN=purH PE=3 SV=1 6 469 9.0E-87
sp|B2IX54|PUR9_NOSP7 Bifunctional purine biosynthesis protein PurH OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=purH PE=3 SV=1 4 466 9.0E-87
sp|Q3JC90|PUR9_NITOC Bifunctional purine biosynthesis protein PurH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=purH PE=3 SV=1 6 496 9.0E-87
sp|Q8Y232|PUR9_RALSO Bifunctional purine biosynthesis protein PurH OS=Ralstonia solanacearum (strain GMI1000) GN=purH PE=3 SV=1 6 600 1.0E-86
sp|A0LDB0|PUR9_MAGMM Bifunctional purine biosynthesis protein PurH OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=purH PE=3 SV=1 6 600 2.0E-86
sp|Q3M6G3|PUR9_ANAVT Bifunctional purine biosynthesis protein PurH OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=purH PE=3 SV=1 5 466 2.0E-86
sp|Q3AN13|PUR9_SYNSC Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9605) GN=purH PE=3 SV=1 5 466 3.0E-86
sp|Q8PD47|PUR9_XANCP Bifunctional purine biosynthesis protein PurH OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=purH PE=3 SV=1 1 471 3.0E-86
sp|B0RN27|PUR9_XANCB Bifunctional purine biosynthesis protein PurH OS=Xanthomonas campestris pv. campestris (strain B100) GN=purH PE=3 SV=1 1 471 3.0E-86
sp|Q4UZD2|PUR9_XANC8 Bifunctional purine biosynthesis protein PurH OS=Xanthomonas campestris pv. campestris (strain 8004) GN=purH PE=3 SV=1 1 471 3.0E-86
sp|Q0AW31|PUR9_SYNWW Bifunctional purine biosynthesis protein PurH OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=purH PE=3 SV=1 6 466 4.0E-86
sp|B2FJP9|PUR9_STRMK Bifunctional purine biosynthesis protein PurH OS=Stenotrophomonas maltophilia (strain K279a) GN=purH PE=3 SV=1 1 469 5.0E-86
sp|Q98ES7|PUR9_RHILO Bifunctional purine biosynthesis protein PurH OS=Rhizobium loti (strain MAFF303099) GN=purH PE=3 SV=1 1 600 7.0E-86
sp|B4SL92|PUR9_STRM5 Bifunctional purine biosynthesis protein PurH OS=Stenotrophomonas maltophilia (strain R551-3) GN=purH PE=3 SV=1 1 469 1.0E-85
sp|A3NDF2|PUR9_BURP6 Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 668) GN=purH PE=3 SV=1 6 469 2.0E-85
sp|A3NZ64|PUR9_BURP0 Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 1106a) GN=purH PE=3 SV=1 6 469 2.0E-85
sp|A1V068|PUR9_BURMS Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain SAVP1) GN=purH PE=3 SV=1 6 469 2.0E-85
sp|Q62HA6|PUR9_BURMA Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain ATCC 23344) GN=purH PE=3 SV=1 6 469 2.0E-85
sp|A2S597|PUR9_BURM9 Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain NCTC 10229) GN=purH PE=3 SV=1 6 469 2.0E-85
sp|A3MP76|PUR9_BURM7 Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain NCTC 10247) GN=purH PE=3 SV=1 6 469 2.0E-85
sp|Q63QX8|PUR9_BURPS Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain K96243) GN=purH PE=3 SV=1 6 469 2.0E-85
sp|Q3JNS8|PUR9_BURP1 Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 1710b) GN=purH PE=3 SV=1 6 469 2.0E-85
sp|B2UFL5|PUR9_RALPJ Bifunctional purine biosynthesis protein PurH OS=Ralstonia pickettii (strain 12J) GN=purH PE=3 SV=1 6 469 2.0E-85
sp|Q2SZ52|PUR9_BURTA Bifunctional purine biosynthesis protein PurH OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=purH PE=3 SV=1 6 469 3.0E-85
sp|B6ENA8|PUR9_ALISL Bifunctional purine biosynthesis protein PurH OS=Aliivibrio salmonicida (strain LFI1238) GN=purH PE=3 SV=1 2 600 6.0E-85
sp|B3QS62|PUR9_CHLT3 Bifunctional purine biosynthesis protein PurH OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=purH PE=3 SV=1 6 466 6.0E-85
sp|A9AH70|PUR9_BURM1 Bifunctional purine biosynthesis protein PurH OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=purH PE=3 SV=1 6 469 8.0E-85
sp|Q1H4G7|PUR9_METFK Bifunctional purine biosynthesis protein PurH OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=purH PE=3 SV=1 6 600 9.0E-85
sp|Q31II8|PUR9_THICR Bifunctional purine biosynthesis protein PurH OS=Thiomicrospira crunogena (strain XCL-2) GN=purH PE=3 SV=1 2 600 1.0E-84
sp|Q0VMY5|PUR9_ALCBS Bifunctional purine biosynthesis protein PurH OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=purH PE=3 SV=1 6 495 1.0E-84
sp|A1B5K8|PUR9_PARDP Bifunctional purine biosynthesis protein PurH OS=Paracoccus denitrificans (strain Pd 1222) GN=purH PE=3 SV=1 1 600 2.0E-84
sp|A9WEK8|PUR9_CHLAA Bifunctional purine biosynthesis protein PurH OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=purH PE=3 SV=1 6 469 2.0E-84
sp|Q87KT0|PUR9_VIBPA Bifunctional purine biosynthesis protein PurH OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=purH PE=3 SV=1 2 600 3.0E-84
sp|Q2P866|PUR9_XANOM Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=purH PE=3 SV=1 1 496 7.0E-84
sp|A7MXG0|PUR9_VIBCB Bifunctional purine biosynthesis protein PurH OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=purH PE=3 SV=1 2 600 7.0E-84
sp|B4EES4|PUR9_BURCJ Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=purH PE=3 SV=1 6 469 7.0E-84
sp|C4LA41|PUR9_TOLAT Bifunctional purine biosynthesis protein PurH OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=purH PE=3 SV=1 2 600 7.0E-84
sp|Q5H5H7|PUR9_XANOR Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=purH PE=3 SV=1 1 496 1.0E-83
sp|A7HSQ6|PUR9_PARL1 Bifunctional purine biosynthesis protein PurH OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=purH PE=3 SV=1 6 600 1.0E-83
sp|B0UWT1|PUR9_HISS2 Bifunctional purine biosynthesis protein PurH OS=Histophilus somni (strain 2336) GN=purH PE=3 SV=1 2 495 3.0E-83
sp|B0KBQ1|PUR9_THEP3 Bifunctional purine biosynthesis protein PurH OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=purH PE=3 SV=1 6 600 3.0E-83
sp|B8HPG4|PUR9_CYAP4 Bifunctional purine biosynthesis protein PurH OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=purH PE=3 SV=1 5 466 3.0E-83
sp|B7KGS0|PUR9_CYAP7 Bifunctional purine biosynthesis protein PurH OS=Cyanothece sp. (strain PCC 7424) GN=purH PE=3 SV=1 4 466 3.0E-83
sp|Q8RC55|PUR9_CALS4 Bifunctional purine biosynthesis protein PurH OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=purH PE=3 SV=1 6 600 3.0E-83
sp|Q5LN38|PUR9_RUEPO Bifunctional purine biosynthesis protein PurH OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=purH PE=3 SV=1 2 469 3.0E-83
sp|Q13UC4|PUR9_BURXL Bifunctional purine biosynthesis protein PurH OS=Burkholderia xenovorans (strain LB400) GN=purH PE=3 SV=1 6 469 4.0E-83
sp|B2SRB2|PUR9_XANOP Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=purH PE=3 SV=1 1 496 4.0E-83
sp|Q0IDE8|PUR9_SYNS3 Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9311) GN=purH PE=3 SV=1 6 466 7.0E-83
sp|B0K3Q8|PUR9_THEPX Bifunctional purine biosynthesis protein PurH OS=Thermoanaerobacter sp. (strain X514) GN=purH PE=3 SV=1 6 600 8.0E-83
sp|A4JBL5|PUR9_BURVG Bifunctional purine biosynthesis protein PurH OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=purH PE=3 SV=1 6 469 9.0E-83
sp|C3LQN2|PUR9_VIBCM Bifunctional purine biosynthesis protein PurH OS=Vibrio cholerae serotype O1 (strain M66-2) GN=purH PE=3 SV=1 2 600 9.0E-83
sp|Q9KV80|PUR9_VIBCH Bifunctional purine biosynthesis protein PurH OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purH PE=3 SV=1 2 600 9.0E-83
sp|Q0I557|PUR9_HAES1 Bifunctional purine biosynthesis protein PurH OS=Haemophilus somnus (strain 129Pt) GN=purH PE=3 SV=1 2 495 9.0E-83
sp|Q2RN46|PUR9_RHORT Bifunctional purine biosynthesis protein PurH OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=purH PE=3 SV=1 1 600 1.0E-82
sp|A1AS76|PUR9_PELPD Bifunctional purine biosynthesis protein PurH OS=Pelobacter propionicus (strain DSM 2379) GN=purH PE=3 SV=1 6 493 1.0E-82
sp|A5F3U8|PUR9_VIBC3 Bifunctional purine biosynthesis protein PurH OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=purH PE=3 SV=1 2 600 1.0E-82
sp|Q0BI80|PUR9_BURCM Bifunctional purine biosynthesis protein PurH OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=purH PE=3 SV=1 6 469 1.0E-82
sp|Q1D898|PUR9_MYXXD Bifunctional purine biosynthesis protein PurH OS=Myxococcus xanthus (strain DK 1622) GN=purH PE=3 SV=1 5 600 1.0E-82
sp|B1JVV6|PUR9_BURCC Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain MC0-3) GN=purH PE=3 SV=1 6 469 1.0E-82
sp|P57828|PUR9_PASMU Bifunctional purine biosynthesis protein PurH OS=Pasteurella multocida (strain Pm70) GN=purH PE=3 SV=1 2 495 1.0E-82
sp|P74741|PUR9_SYNY3 Bifunctional purine biosynthesis protein PurH OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purH PE=3 SV=2 4 466 1.0E-82
sp|A2CCK6|PUR9_PROM3 Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9303) GN=purH PE=3 SV=1 5 466 1.0E-82
sp|Q39RK1|PUR9_GEOMG Bifunctional purine biosynthesis protein PurH OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=purH PE=3 SV=1 6 493 2.0E-82
sp|Q1BZ33|PUR9_BURCA Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain AU 1054) GN=purH PE=3 SV=1 6 469 2.0E-82
sp|Q39JI8|PUR9_BURL3 Bifunctional purine biosynthesis protein PurH OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=purH PE=3 SV=1 6 469 2.0E-82
sp|Q7TUM7|PUR9_PROMM Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9313) GN=purH PE=3 SV=1 5 466 2.0E-82
sp|Q1LRB3|PUR9_CUPMC Bifunctional purine biosynthesis protein PurH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=purH PE=3 SV=1 6 469 2.0E-82
sp|Q088G0|PUR9_SHEFN Bifunctional purine biosynthesis protein PurH OS=Shewanella frigidimarina (strain NCIMB 400) GN=purH PE=3 SV=1 2 469 3.0E-82
sp|B2G5C2|PUR9_LACRJ Bifunctional purine biosynthesis protein PurH OS=Lactobacillus reuteri (strain JCM 1112) GN=purH PE=3 SV=1 6 600 3.0E-82
sp|A5VHU2|PUR9_LACRD Bifunctional purine biosynthesis protein PurH OS=Lactobacillus reuteri (strain DSM 20016) GN=purH PE=3 SV=1 6 600 3.0E-82
sp|B1YTE2|PUR9_BURA4 Bifunctional purine biosynthesis protein PurH OS=Burkholderia ambifaria (strain MC40-6) GN=purH PE=3 SV=1 6 469 3.0E-82
sp|A6WXV3|PUR9_OCHA4 Bifunctional purine biosynthesis protein PurH OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=purH PE=3 SV=1 6 600 3.0E-82
sp|A0K4L7|PUR9_BURCH Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain HI2424) GN=purH PE=3 SV=1 6 469 4.0E-82
sp|Q88U29|PUR9_LACPL Bifunctional purine biosynthesis protein PurH OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=purH PE=3 SV=1 6 600 5.0E-82
sp|B1XS23|PUR9_POLNS Bifunctional purine biosynthesis protein PurH OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=purH PE=3 SV=1 6 469 5.0E-82
sp|A0KGJ2|PUR9_AERHH Bifunctional purine biosynthesis protein PurH OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=purH PE=3 SV=1 2 471 6.0E-82
sp|B0BZH9|PUR9_ACAM1 Bifunctional purine biosynthesis protein PurH OS=Acaryochloris marina (strain MBIC 11017) GN=purH PE=3 SV=1 5 466 7.0E-82
sp|B7H4U0|PUR9_BACC4 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain B4264) GN=purH PE=3 SV=1 6 466 1.0E-81
sp|B7JM89|PUR9_BACC0 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain AH820) GN=purH PE=3 SV=1 6 466 1.0E-81
sp|Q81ZG8|PUR9_BACAN Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis GN=purH PE=3 SV=1 6 466 1.0E-81
sp|C3L536|PUR9_BACAC Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=purH PE=3 SV=1 6 466 1.0E-81
sp|C3PBN4|PUR9_BACAA Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis (strain A0248) GN=purH PE=3 SV=1 6 466 1.0E-81
sp|Q81IP9|PUR9_BACCR Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=purH PE=3 SV=1 6 466 2.0E-81
sp|B2JGU1|PUR9_BURP8 Bifunctional purine biosynthesis protein PurH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=purH PE=3 SV=1 6 469 2.0E-81
sp|Q8PQ19|PUR9_XANAC Bifunctional purine biosynthesis protein PurH OS=Xanthomonas axonopodis pv. citri (strain 306) GN=purH PE=3 SV=1 1 471 2.0E-81
sp|B7HS36|PUR9_BACC7 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain AH187) GN=purH PE=3 SV=1 6 466 2.0E-81
sp|B9J1K9|PUR9_BACCQ Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain Q1) GN=purH PE=3 SV=1 6 466 3.0E-81
sp|C1EV67|PUR9_BACC3 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain 03BB102) GN=purH PE=3 SV=1 6 466 4.0E-81
sp|Q73EN1|PUR9_BACC1 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=purH PE=3 SV=1 6 466 4.0E-81
sp|B2SYJ7|PUR9_BURPP Bifunctional purine biosynthesis protein PurH OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=purH PE=3 SV=1 6 469 4.0E-81
sp|Q87D58|PUR9_XYLFT Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=purH PE=3 SV=1 1 600 5.0E-81
sp|B2I4L7|PUR9_XYLF2 Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain M23) GN=purH PE=3 SV=1 1 600 5.0E-81
sp|Q475R4|PUR9_CUPPJ Bifunctional purine biosynthesis protein PurH OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=purH PE=3 SV=1 6 469 5.0E-81
sp|Q3BY85|PUR9_XANC5 Bifunctional purine biosynthesis protein PurH OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=purH PE=3 SV=1 1 471 5.0E-81
sp|A0R900|PUR9_BACAH Bifunctional purine biosynthesis protein PurH OS=Bacillus thuringiensis (strain Al Hakam) GN=purH PE=3 SV=1 6 466 6.0E-81
sp|Q6HPA0|PUR9_BACHK Bifunctional purine biosynthesis protein PurH OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=purH PE=3 SV=1 6 466 9.0E-81
sp|A4SR98|PUR9_AERS4 Bifunctional purine biosynthesis protein PurH OS=Aeromonas salmonicida (strain A449) GN=purH PE=3 SV=1 2 471 1.0E-80
sp|Q89WU7|PUR9_BRADU Bifunctional purine biosynthesis protein PurH OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=purH PE=3 SV=1 6 600 1.0E-80
sp|Q12IP4|PUR9_SHEDO Bifunctional purine biosynthesis protein PurH OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=purH PE=3 SV=1 2 469 1.0E-80
sp|A9VRF5|PUR9_BACWK Bifunctional purine biosynthesis protein PurH OS=Bacillus weihenstephanensis (strain KBAB4) GN=purH PE=3 SV=1 6 466 1.0E-80
sp|A4T025|PUR9_POLSQ Bifunctional purine biosynthesis protein PurH OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=purH PE=3 SV=1 6 471 3.0E-80
sp|B7IUV7|PUR9_BACC2 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain G9842) GN=purH PE=3 SV=1 6 466 4.0E-80
sp|B8CTW4|PUR9_SHEPW Bifunctional purine biosynthesis protein PurH OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=purH PE=3 SV=1 2 496 5.0E-80
sp|Q6G5S5|PUR9_BARHE Bifunctional purine biosynthesis protein PurH OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=purH PE=3 SV=1 7 600 5.0E-80
sp|A1UR09|PUR9_BARBK Bifunctional purine biosynthesis protein PurH OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=purH PE=3 SV=1 6 600 1.0E-79
sp|A8GZM3|PUR9_SHEPA Bifunctional purine biosynthesis protein PurH OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=purH PE=3 SV=1 2 496 1.0E-79
sp|Q8EJM1|PUR9_SHEON Bifunctional purine biosynthesis protein PurH OS=Shewanella oneidensis (strain MR-1) GN=purH PE=3 SV=1 2 469 1.0E-79
sp|Q3B083|PUR9_SYNS9 Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9902) GN=purH PE=3 SV=1 5 466 1.0E-79
sp|B0TR91|PUR9_SHEHH Bifunctional purine biosynthesis protein PurH OS=Shewanella halifaxensis (strain HAW-EB4) GN=purH PE=3 SV=1 2 496 2.0E-79
sp|Q9PC10|PUR9_XYLFA Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain 9a5c) GN=purH PE=3 SV=2 1 469 2.0E-79
sp|A1SZJ2|PUR9_PSYIN Bifunctional purine biosynthesis protein PurH OS=Psychromonas ingrahamii (strain 37) GN=purH PE=3 SV=1 2 600 2.0E-79
sp|P43852|PUR9_HAEIN Bifunctional purine biosynthesis protein PurH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purH PE=3 SV=1 2 495 3.0E-79
sp|Q3A2D6|PUR9_PELCD Bifunctional purine biosynthesis protein PurH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=purH PE=3 SV=1 6 496 3.0E-79
sp|Q63GS9|PUR9_BACCZ Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ZK / E33L) GN=purH PE=3 SV=1 6 466 3.0E-79
sp|B0TEC5|PUR9_HELMI Bifunctional purine biosynthesis protein PurH OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=purH PE=3 SV=1 6 466 4.0E-79
sp|Q5FIV5|PUR9_LACAC Bifunctional purine biosynthesis protein PurH OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=purH PE=3 SV=1 6 466 4.0E-79
sp|Q7MGT5|PUR9_VIBVY Bifunctional purine biosynthesis protein PurH OS=Vibrio vulnificus (strain YJ016) GN=purH PE=3 SV=1 2 496 5.0E-79
sp|Q8DD06|PUR9_VIBVU Bifunctional purine biosynthesis protein PurH OS=Vibrio vulnificus (strain CMCP6) GN=purH PE=3 SV=1 2 496 5.0E-79
sp|A4SDE6|PUR9_CHLPM Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=purH PE=3 SV=1 6 522 5.0E-79
sp|B9M4Q6|PUR9_GEODF Bifunctional purine biosynthesis protein PurH OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=purH PE=3 SV=1 6 493 8.0E-79
sp|B3E7F6|PUR9_GEOLS Bifunctional purine biosynthesis protein PurH OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=purH PE=3 SV=1 6 512 8.0E-79
sp|A5GIF4|PUR9_SYNPW Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain WH7803) GN=purH PE=3 SV=1 6 466 9.0E-79
sp|Q5E257|PUR9_VIBF1 Bifunctional purine biosynthesis protein PurH OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=purH PE=3 SV=1 2 496 1.0E-78
sp|Q7TTX6|PUR9_SYNPX Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain WH8102) GN=purH PE=3 SV=1 5 465 1.0E-78
sp|B0JL55|PUR9_MICAN Bifunctional purine biosynthesis protein PurH OS=Microcystis aeruginosa (strain NIES-843) GN=purH PE=3 SV=1 4 466 1.0E-78
sp|A8FQD4|PUR9_SHESH Bifunctional purine biosynthesis protein PurH OS=Shewanella sediminis (strain HAW-EB3) GN=purH PE=3 SV=1 2 469 1.0E-78
sp|O67775|PUR9_AQUAE Bifunctional purine biosynthesis protein PurH OS=Aquifex aeolicus (strain VF5) GN=purH PE=3 SV=1 6 469 3.0E-78
sp|Q3IIC3|PUR9_PSEHT Bifunctional purine biosynthesis protein PurH OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=purH PE=3 SV=1 2 469 3.0E-78
sp|Q7VDS0|PUR9_PROMA Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=purH PE=3 SV=1 5 466 4.0E-78
sp|Q7P0M1|PUR9_CHRVO Bifunctional purine biosynthesis protein PurH OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=purH PE=3 SV=1 6 469 7.0E-78
sp|Q0KEC0|PUR9_CUPNH Bifunctional purine biosynthesis protein PurH OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=purH PE=3 SV=1 6 469 7.0E-78
sp|A3QII0|PUR9_SHELP Bifunctional purine biosynthesis protein PurH OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=purH PE=3 SV=1 2 469 8.0E-78
sp|B1KNA0|PUR9_SHEWM Bifunctional purine biosynthesis protein PurH OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=purH PE=3 SV=1 2 469 9.0E-78
sp|Q3ATZ1|PUR9_CHLCH Bifunctional purine biosynthesis protein PurH OS=Chlorobium chlorochromatii (strain CaD3) GN=purH PE=3 SV=1 6 522 1.0E-77
sp|Q67KG3|PUR9_SYMTH Bifunctional purine biosynthesis protein PurH OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=purH PE=3 SV=1 6 466 1.0E-77
sp|A4G1U6|PUR9_HERAR Bifunctional purine biosynthesis protein PurH OS=Herminiimonas arsenicoxydans GN=purH PE=3 SV=1 6 469 2.0E-77
sp|B5FC70|PUR9_VIBFM Bifunctional purine biosynthesis protein PurH OS=Vibrio fischeri (strain MJ11) GN=purH PE=3 SV=1 2 496 2.0E-77
sp|A9BDN8|PUR9_PROM4 Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9211) GN=purH PE=3 SV=1 5 466 2.0E-77
sp|C5CL84|PUR9_VARPS Bifunctional purine biosynthesis protein PurH OS=Variovorax paradoxus (strain S110) GN=purH PE=3 SV=1 4 471 3.0E-77
sp|A2C098|PUR9_PROM1 Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain NATL1A) GN=purH PE=3 SV=1 5 466 3.0E-77
sp|A7GKI2|PUR9_BACCN Bifunctional purine biosynthesis protein PurH OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=purH PE=3 SV=1 6 466 4.0E-77
sp|A5G879|PUR9_GEOUR Bifunctional purine biosynthesis protein PurH OS=Geobacter uraniireducens (strain Rf4) GN=purH PE=3 SV=1 6 493 4.0E-77
sp|Q46HA8|PUR9_PROMT Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain NATL2A) GN=purH PE=3 SV=1 5 466 6.0E-77
sp|A3DEU9|PUR9_CLOTH Bifunctional purine biosynthesis protein PurH OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=purH PE=3 SV=1 6 466 6.0E-77
sp|Q31R91|PUR9_SYNE7 Bifunctional purine biosynthesis protein PurH OS=Synechococcus elongatus (strain PCC 7942) GN=purH PE=3 SV=1 1 466 7.0E-77
sp|A6TLS7|PUR9_ALKMQ Bifunctional purine biosynthesis protein PurH OS=Alkaliphilus metalliredigens (strain QYMF) GN=purH PE=3 SV=1 6 460 1.0E-76
sp|B3ELV3|PUR9_CHLPB Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeobacteroides (strain BS1) GN=purH PE=3 SV=1 6 469 1.0E-76
sp|B7VM57|PUR9_VIBTL Bifunctional purine biosynthesis protein PurH OS=Vibrio tasmaniensis (strain LGP32) GN=purH PE=3 SV=1 2 496 1.0E-76
sp|B5EBF9|PUR9_GEOBB Bifunctional purine biosynthesis protein PurH OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=purH PE=3 SV=1 6 493 2.0E-76
sp|B2AH76|PUR9_CUPTR Bifunctional purine biosynthesis protein PurH OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=purH PE=3 SV=1 6 469 2.0E-76
sp|C6E5Z3|PUR9_GEOSM Bifunctional purine biosynthesis protein PurH OS=Geobacter sp. (strain M21) GN=purH PE=3 SV=1 6 493 2.0E-76
sp|B7GFU2|PUR9_ANOFW Bifunctional purine biosynthesis protein PurH OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=purH PE=3 SV=1 6 466 2.0E-76
sp|Q9JUQ8|PUR9_NEIMA Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=purH PE=3 SV=1 6 469 2.0E-76
sp|B4SDT6|PUR9_PELPB Bifunctional purine biosynthesis protein PurH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=purH PE=3 SV=1 6 522 2.0E-76
sp|A1BE85|PUR9_CHLPD Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeobacteroides (strain DSM 266) GN=purH PE=3 SV=1 6 522 6.0E-76
sp|A6SUQ1|PUR9_JANMA Bifunctional purine biosynthesis protein PurH OS=Janthinobacterium sp. (strain Marseille) GN=purH PE=3 SV=1 6 469 6.0E-76
sp|C1DLJ1|PUR9_AZOVD Bifunctional purine biosynthesis protein PurH OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=purH PE=3 SV=1 1 512 6.0E-76
sp|B0U7A0|PUR9_XYLFM Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain M12) GN=purH PE=3 SV=1 1 469 6.0E-76
sp|B2VG81|PUR9_ERWT9 Bifunctional purine biosynthesis protein PurH OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=purH PE=3 SV=1 2 461 6.0E-76
sp|Q8UBM8|PUR9_AGRFC Bifunctional purine biosynthesis protein PurH OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=purH PE=3 SV=2 6 600 8.0E-76
sp|C1CWJ7|PUR9_DEIDV Bifunctional purine biosynthesis protein PurH OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=purH PE=3 SV=1 6 600 9.0E-76
sp|A8MLI9|PUR9_ALKOO Bifunctional purine biosynthesis protein PurH OS=Alkaliphilus oremlandii (strain OhILAs) GN=purH PE=3 SV=1 6 460 1.0E-75
sp|A4VPK9|PUR9_PSEU5 Bifunctional purine biosynthesis protein PurH OS=Pseudomonas stutzeri (strain A1501) GN=purH PE=3 SV=1 1 512 1.0E-75
sp|Q03E83|PUR9_PEDPA Bifunctional purine biosynthesis protein PurH OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=purH PE=3 SV=1 6 466 2.0E-75
sp|Q46480|PUR9_ALLVD Bifunctional purine biosynthesis protein PurH OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=purH PE=3 SV=2 2 496 3.0E-75
sp|C0QRH2|PUR9_PERMH Bifunctional purine biosynthesis protein PurH OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=purH PE=3 SV=1 6 495 2.0E-74
sp|A5WFX4|PUR9_PSYWF Bifunctional purine biosynthesis protein PurH OS=Psychrobacter sp. (strain PRwf-1) GN=purH PE=3 SV=1 6 493 2.0E-74
sp|Q97J91|PUR9_CLOAB Bifunctional purine biosynthesis protein PurH OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=purH PE=3 SV=1 6 600 3.0E-74
sp|B5EL42|PUR9_ACIF5 Bifunctional purine biosynthesis protein PurH OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=purH PE=3 SV=1 6 464 4.0E-74
sp|C1D6F1|PUR9_LARHH Bifunctional purine biosynthesis protein PurH OS=Laribacter hongkongensis (strain HLHK9) GN=purH PE=3 SV=1 6 490 5.0E-74
sp|B7J5P7|PUR9_ACIF2 Bifunctional purine biosynthesis protein PurH OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=purH PE=3 SV=1 6 464 5.0E-74
sp|Q9KF53|PUR9_BACHD Bifunctional purine biosynthesis protein PurH OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purH PE=3 SV=1 6 466 7.0E-74
sp|Q049M1|PUR9_LACDB Bifunctional purine biosynthesis protein PurH OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=purH PE=3 SV=1 6 466 1.0E-73
sp|Q1G9G2|PUR9_LACDA Bifunctional purine biosynthesis protein PurH OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=purH PE=3 SV=1 6 466 1.0E-73
sp|Q28K03|PUR9_JANSC Bifunctional purine biosynthesis protein PurH OS=Jannaschia sp. (strain CCS1) GN=purH PE=3 SV=1 2 466 1.0E-73
sp|B2A5W1|PUR9_NATTJ Bifunctional purine biosynthesis protein PurH OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=purH PE=3 SV=1 6 466 2.0E-73
sp|A9M4I2|PUR9_NEIM0 Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup C (strain 053442) GN=purH PE=3 SV=1 6 469 2.0E-73
sp|B2KCF7|PUR9_ELUMP Bifunctional purine biosynthesis protein PurH OS=Elusimicrobium minutum (strain Pei191) GN=purH PE=3 SV=1 6 495 2.0E-73
sp|B4EYT2|PUR9_PROMH Bifunctional purine biosynthesis protein PurH OS=Proteus mirabilis (strain HI4320) GN=purH PE=3 SV=1 2 469 3.0E-73
sp|Q8CXK7|PUR9_OCEIH Bifunctional purine biosynthesis protein PurH OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=purH PE=3 SV=1 6 466 3.0E-73
sp|Q8Y6C5|PUR9_LISMO Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purH PE=3 SV=1 6 466 3.0E-73
sp|Q6NID8|PUR9_CORDI Bifunctional purine biosynthesis protein PurH OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=purH PE=3 SV=1 6 600 4.0E-73
sp|A6VCW0|PUR9_PSEA7 Bifunctional purine biosynthesis protein PurH OS=Pseudomonas aeruginosa (strain PA7) GN=purH PE=3 SV=1 1 512 5.0E-73
sp|A1KTP9|PUR9_NEIMF Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=purH PE=3 SV=1 6 469 6.0E-73
sp|Q8REV6|PUR9_FUSNN Bifunctional purine biosynthesis protein PurH OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=purH PE=3 SV=1 6 600 6.0E-73
sp|Q2YX50|PUR9_STAAB Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=purH PE=3 SV=1 6 466 8.0E-73
sp|P67540|PUR9_BRUSU Bifunctional purine biosynthesis protein PurH OS=Brucella suis biovar 1 (strain 1330) GN=purH PE=3 SV=1 6 465 9.0E-73
sp|A9WWU1|PUR9_BRUSI Bifunctional purine biosynthesis protein PurH OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=purH PE=3 SV=1 6 465 9.0E-73
sp|P67539|PUR9_BRUME Bifunctional purine biosynthesis protein PurH OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purH PE=3 SV=1 6 465 9.0E-73
sp|C0RF67|PUR9_BRUMB Bifunctional purine biosynthesis protein PurH OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=purH PE=3 SV=1 6 465 9.0E-73
sp|A9M854|PUR9_BRUC2 Bifunctional purine biosynthesis protein PurH OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=purH PE=3 SV=1 6 465 9.0E-73
sp|B8I490|PUR9_CLOCE Bifunctional purine biosynthesis protein PurH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=purH PE=3 SV=1 6 466 1.0E-72
sp|P67544|PUR9_STAAN Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain N315) GN=purH PE=1 SV=2 6 466 1.0E-72
sp|P67543|PUR9_STAAM Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purH PE=3 SV=2 6 466 1.0E-72
sp|A5IRW0|PUR9_STAA9 Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain JH9) GN=purH PE=3 SV=1 6 466 1.0E-72
sp|A6U0P1|PUR9_STAA2 Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain JH1) GN=purH PE=3 SV=1 6 466 1.0E-72
sp|A5VSF8|PUR9_BRUO2 Bifunctional purine biosynthesis protein PurH OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=purH PE=3 SV=1 6 465 1.0E-72
sp|P12048|PUR9_BACSU Bifunctional purine biosynthesis protein PurH OS=Bacillus subtilis (strain 168) GN=purH PE=3 SV=2 6 466 1.0E-72
sp|Q57B71|PUR9_BRUAB Bifunctional purine biosynthesis protein PurH OS=Brucella abortus biovar 1 (strain 9-941) GN=purH PE=3 SV=1 6 465 1.0E-72
sp|Q2YLH0|PUR9_BRUA2 Bifunctional purine biosynthesis protein PurH OS=Brucella abortus (strain 2308) GN=purH PE=3 SV=1 6 465 1.0E-72
sp|B2S7P0|PUR9_BRUA1 Bifunctional purine biosynthesis protein PurH OS=Brucella abortus (strain S19) GN=purH PE=3 SV=1 6 465 1.0E-72
sp|Q24QH6|PUR9_DESHY Bifunctional purine biosynthesis protein PurH OS=Desulfitobacterium hafniense (strain Y51) GN=purH PE=3 SV=1 6 466 1.0E-72
sp|B8FP05|PUR9_DESHD Bifunctional purine biosynthesis protein PurH OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=purH PE=3 SV=1 6 466 1.0E-72
sp|Q02FG6|PUR9_PSEAB Bifunctional purine biosynthesis protein PurH OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=purH PE=3 SV=1 1 512 2.0E-72
sp|Q9HUV9|PUR9_PSEAE Bifunctional purine biosynthesis protein PurH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purH PE=3 SV=1 1 512 2.0E-72
sp|B7V1R6|PUR9_PSEA8 Bifunctional purine biosynthesis protein PurH OS=Pseudomonas aeruginosa (strain LESB58) GN=purH PE=3 SV=1 1 512 2.0E-72
sp|B1J5T3|PUR9_PSEPW Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain W619) GN=purH PE=3 SV=1 1 495 2.0E-72
sp|Q2FI05|PUR9_STAA3 Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain USA300) GN=purH PE=3 SV=1 6 466 2.0E-72
sp|Q1LU51|PUR9_BAUCH Bifunctional purine biosynthesis protein PurH OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=purH PE=3 SV=1 6 496 3.0E-72
sp|Q8NX88|PUR9_STAAW Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain MW2) GN=purH PE=3 SV=2 6 466 3.0E-72
sp|Q6GAE0|PUR9_STAAS Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain MSSA476) GN=purH PE=3 SV=1 6 466 3.0E-72
sp|Q5HH11|PUR9_STAAC Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain COL) GN=purH PE=3 SV=1 6 466 3.0E-72
sp|Q2FZI6|PUR9_STAA8 Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain NCTC 8325) GN=purH PE=3 SV=1 6 466 3.0E-72
sp|B4S3H9|PUR9_PROA2 Bifunctional purine biosynthesis protein PurH OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=purH PE=3 SV=1 6 469 3.0E-72
sp|A4XQ60|PUR9_PSEMY Bifunctional purine biosynthesis protein PurH OS=Pseudomonas mendocina (strain ymp) GN=purH PE=3 SV=1 1 512 4.0E-72
sp|Q88DK3|PUR9_PSEPK Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain KT2440) GN=purH PE=3 SV=1 1 495 5.0E-72
sp|A5W9K7|PUR9_PSEP1 Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=purH PE=3 SV=1 1 495 5.0E-72
sp|Q4KIX5|PUR9_PSEF5 Bifunctional purine biosynthesis protein PurH OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=purH PE=3 SV=1 1 512 5.0E-72
sp|Q4FRN8|PUR9_PSYA2 Bifunctional purine biosynthesis protein PurH OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=purH PE=3 SV=1 5 493 6.0E-72
sp|Q1QA75|PUR9_PSYCK Bifunctional purine biosynthesis protein PurH OS=Psychrobacter cryohalolentis (strain K5) GN=purH PE=3 SV=1 5 493 7.0E-72
sp|Q9JZM7|PUR9_NEIMB Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup B (strain MC58) GN=purH PE=3 SV=1 6 469 8.0E-72
sp|Q6GI11|PUR9_STAAR Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain MRSA252) GN=purH PE=3 SV=1 6 466 8.0E-72
sp|Q1I4C1|PUR9_PSEE4 Bifunctional purine biosynthesis protein PurH OS=Pseudomonas entomophila (strain L48) GN=purH PE=3 SV=1 1 495 8.0E-72
sp|Q3B5R1|PUR9_CHLL7 Bifunctional purine biosynthesis protein PurH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=purH PE=3 SV=1 6 522 1.0E-71
sp|B0KJZ6|PUR9_PSEPG Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain GB-1) GN=purH PE=3 SV=1 1 495 1.0E-71
sp|B1HTV8|PUR9_LYSSC Bifunctional purine biosynthesis protein PurH OS=Lysinibacillus sphaericus (strain C3-41) GN=purH PE=3 SV=1 6 466 1.0E-71
sp|A6QFT1|PUR9_STAAE Bifunctional purine biosynthesis protein PurH OS=Staphylococcus aureus (strain Newman) GN=purH PE=3 SV=1 6 466 1.0E-71
sp|C1KW64|PUR9_LISMC Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=purH PE=3 SV=1 6 466 2.0E-71
sp|A0AJL9|PUR9_LISW6 Bifunctional purine biosynthesis protein PurH OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=purH PE=3 SV=1 6 466 2.0E-71
sp|Q03Y85|PUR9_LEUMM Bifunctional purine biosynthesis protein PurH OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=purH PE=3 SV=1 6 460 2.0E-71
sp|Q5WJ82|PUR9_BACSK Bifunctional purine biosynthesis protein PurH OS=Bacillus clausii (strain KSM-K16) GN=purH PE=3 SV=1 6 466 2.0E-71
sp|B0SQ10|PUR9_LEPBP Bifunctional purine biosynthesis protein PurH OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=purH PE=3 SV=1 6 469 3.0E-71
sp|B0SGW3|PUR9_LEPBA Bifunctional purine biosynthesis protein PurH OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=purH PE=3 SV=1 6 469 3.0E-71
sp|Q5F6T1|PUR9_NEIG1 Bifunctional purine biosynthesis protein PurH OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=purH PE=3 SV=1 6 469 5.0E-71
sp|Q49WJ7|PUR9_STAS1 Bifunctional purine biosynthesis protein PurH OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purH PE=3 SV=1 6 466 6.0E-71
sp|A4XKZ2|PUR9_CALS8 Bifunctional purine biosynthesis protein PurH OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=purH PE=3 SV=1 6 460 6.0E-71
sp|A3PAY7|PUR9_PROM0 Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9301) GN=purH PE=3 SV=1 5 466 6.0E-71
sp|B4RP71|PUR9_NEIG2 Bifunctional purine biosynthesis protein PurH OS=Neisseria gonorrhoeae (strain NCCP11945) GN=purH PE=3 SV=1 6 469 7.0E-71
sp|Q71YQ3|PUR9_LISMF Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purH PE=3 SV=1 6 466 7.0E-71
sp|A8G2S6|PUR9_PROM2 Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9215) GN=purH PE=3 SV=1 5 466 1.0E-70
sp|C3K6E0|PUR9_PSEFS Bifunctional purine biosynthesis protein PurH OS=Pseudomonas fluorescens (strain SBW25) GN=purH PE=3 SV=1 1 512 1.0E-70
sp|Q7TUG1|PUR9_PROMP Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=purH PE=3 SV=1 5 466 1.0E-70
sp|A5FUH4|PUR9_ACICJ Bifunctional purine biosynthesis protein PurH OS=Acidiphilium cryptum (strain JF-5) GN=purH PE=3 SV=1 6 469 1.0E-70
sp|B3WF93|PUR9_LACCB Bifunctional purine biosynthesis protein PurH OS=Lactobacillus casei (strain BL23) GN=purH PE=3 SV=1 6 466 2.0E-70
sp|B3EEI0|PUR9_CHLL2 Bifunctional purine biosynthesis protein PurH OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=purH PE=3 SV=1 6 522 2.0E-70
sp|Q489F4|PUR9_COLP3 Bifunctional purine biosynthesis protein PurH OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=purH PE=3 SV=1 2 496 2.0E-70
sp|Q92AP3|PUR9_LISIN Bifunctional purine biosynthesis protein PurH OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purH PE=3 SV=1 6 466 3.0E-70
sp|Q87VR9|PUR9_PSESM Bifunctional purine biosynthesis protein PurH OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=purH PE=3 SV=1 1 495 6.0E-70
sp|Q037V3|PUR9_LACC3 Bifunctional purine biosynthesis protein PurH OS=Lactobacillus casei (strain ATCC 334) GN=purH PE=3 SV=1 6 466 7.0E-70
sp|B9EAZ2|PUR9_MACCJ Bifunctional purine biosynthesis protein PurH OS=Macrococcus caseolyticus (strain JCSC5402) GN=purH PE=3 SV=1 6 466 9.0E-70
sp|B9JEU9|PUR9_AGRRK Bifunctional purine biosynthesis protein PurH OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=purH PE=3 SV=1 6 464 1.0E-69
sp|A1SMP8|PUR9_NOCSJ Bifunctional purine biosynthesis protein PurH OS=Nocardioides sp. (strain BAA-499 / JS614) GN=purH PE=3 SV=1 1 466 1.0E-69
sp|Q1J119|PUR9_DEIGD Bifunctional purine biosynthesis protein PurH OS=Deinococcus geothermalis (strain DSM 11300) GN=purH PE=3 SV=1 6 460 2.0E-69
sp|A2BP65|PUR9_PROMS Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain AS9601) GN=purH PE=3 SV=1 5 466 2.0E-69
sp|Q38XW3|PUR9_LACSS Bifunctional purine biosynthesis protein PurH OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=purH PE=3 SV=1 6 466 2.0E-69
sp|Q8CT27|PUR9_STAES Bifunctional purine biosynthesis protein PurH OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purH PE=3 SV=1 6 466 2.0E-69
sp|Q5HQ97|PUR9_STAEQ Bifunctional purine biosynthesis protein PurH OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purH PE=3 SV=1 6 466 2.0E-69
sp|B3PS36|PUR9_RHIE6 Bifunctional purine biosynthesis protein PurH OS=Rhizobium etli (strain CIAT 652) GN=purH PE=3 SV=1 6 465 2.0E-69
sp|Q1WU55|PUR9_LACS1 Bifunctional purine biosynthesis protein PurH OS=Lactobacillus salivarius (strain UCC118) GN=purH PE=3 SV=1 6 466 2.0E-69
sp|Q6FYG4|PUR9_BARQU Bifunctional purine biosynthesis protein PurH OS=Bartonella quintana (strain Toulouse) GN=purH PE=3 SV=1 7 471 4.0E-69
sp|A7HA60|PUR9_ANADF Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter sp. (strain Fw109-5) GN=purH PE=3 SV=1 6 512 5.0E-69
sp|B9MS89|PUR9_CALBD Bifunctional purine biosynthesis protein PurH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=purH PE=3 SV=1 6 460 7.0E-69
sp|A0PWC5|PUR9_MYCUA Bifunctional purine biosynthesis protein PurH OS=Mycobacterium ulcerans (strain Agy99) GN=purH PE=3 SV=1 2 466 2.0E-68
sp|Q2K2T6|PUR9_RHIEC Bifunctional purine biosynthesis protein PurH OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=purH PE=3 SV=1 6 465 2.0E-68
sp|B9DQ42|PUR9_STACT Bifunctional purine biosynthesis protein PurH OS=Staphylococcus carnosus (strain TM300) GN=purH PE=3 SV=1 7 466 2.0E-68
sp|B5ZV31|PUR9_RHILW Bifunctional purine biosynthesis protein PurH OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=purH PE=3 SV=1 6 465 3.0E-68
sp|B2HEC3|PUR9_MYCMM Bifunctional purine biosynthesis protein PurH OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=purH PE=3 SV=1 2 466 3.0E-68
sp|A6UED3|PUR9_SINMW Bifunctional purine biosynthesis protein PurH OS=Sinorhizobium medicae (strain WSM419) GN=purH PE=3 SV=1 6 464 4.0E-68
sp|Q9RW01|PUR9_DEIRA Bifunctional purine biosynthesis protein PurH OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=purH PE=3 SV=2 6 460 4.0E-68
sp|Q4L582|PUR9_STAHJ Bifunctional purine biosynthesis protein PurH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purH PE=3 SV=1 6 466 5.0E-68
sp|Q2IKQ7|PUR9_ANADE Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=purH PE=3 SV=1 6 512 6.0E-68
sp|Q9ABY4|PUR9_CAUCR Bifunctional purine biosynthesis protein PurH OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=purH PE=3 SV=1 6 522 8.0E-68
sp|Q92KX6|PUR9_RHIME Bifunctional purine biosynthesis protein PurH OS=Rhizobium meliloti (strain 1021) GN=purH PE=3 SV=1 6 464 8.0E-68
sp|B5YLE5|PUR9_THEYD Bifunctional purine biosynthesis protein PurH OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=purH PE=3 SV=1 6 465 8.0E-68
sp|A9IZD0|PUR9_BART1 Bifunctional purine biosynthesis protein PurH OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=purH PE=3 SV=1 7 460 9.0E-68
sp|Q31CR6|PUR9_PROM9 Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9312) GN=purH PE=3 SV=1 5 466 9.0E-68
sp|Q833Z3|PUR9_ENTFA Bifunctional purine biosynthesis protein PurH OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=purH PE=3 SV=1 6 466 9.0E-68
sp|C3L2U9|PUR9_CLOB6 Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain 657 / Type Ba4) GN=purH PE=3 SV=1 6 466 3.0E-67
sp|C1FV76|PUR9_CLOBJ Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Kyoto / Type A2) GN=purH PE=3 SV=1 6 466 3.0E-67
sp|B1KZ55|PUR9_CLOBM Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=purH PE=3 SV=1 6 466 4.0E-67
sp|Q1MA35|PUR9_RHIL3 Bifunctional purine biosynthesis protein PurH OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=purH PE=3 SV=1 6 465 8.0E-67
sp|A5I5V9|PUR9_CLOBH Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=purH PE=3 SV=1 6 466 9.0E-67
sp|A7FXD3|PUR9_CLOB1 Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=purH PE=3 SV=1 6 466 9.0E-67
sp|Q86L14|PUR9_DICDI Bifunctional purine biosynthesis protein purH OS=Dictyostelium discoideum GN=purH PE=1 SV=1 6 469 2.0E-66
sp|B1IL57|PUR9_CLOBK Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Okra / Type B1) GN=purH PE=3 SV=1 6 466 2.0E-66
sp|A9BIX9|PUR9_PETMO Bifunctional purine biosynthesis protein PurH OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=purH PE=3 SV=1 6 460 4.0E-66
sp|B1MY42|PUR9_LEUCK Bifunctional purine biosynthesis protein PurH OS=Leuconostoc citreum (strain KM20) GN=purH PE=3 SV=1 6 460 5.0E-66
sp|Q1B3W0|PUR9_MYCSS Bifunctional purine biosynthesis protein PurH OS=Mycobacterium sp. (strain MCS) GN=purH PE=3 SV=1 2 466 5.0E-66
sp|A1UL88|PUR9_MYCSK Bifunctional purine biosynthesis protein PurH OS=Mycobacterium sp. (strain KMS) GN=purH PE=3 SV=1 2 466 5.0E-66
sp|A7GH96|PUR9_CLOBL Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=purH PE=3 SV=1 6 466 6.0E-66
sp|P9WHM7|PUR9_MYCTU Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purH PE=1 SV=1 2 466 8.0E-66
sp|P9WHM6|PUR9_MYCTO Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purH PE=3 SV=1 2 466 8.0E-66
sp|A5U0Z7|PUR9_MYCTA Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=purH PE=3 SV=1 2 466 8.0E-66
sp|C1ALU3|PUR9_MYCBT Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=purH PE=3 SV=1 2 466 8.0E-66
sp|A1KH91|PUR9_MYCBP Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=purH PE=3 SV=1 2 466 8.0E-66
sp|P67542|PUR9_MYCBO Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=purH PE=3 SV=1 2 466 8.0E-66
sp|Q9RHX6|PUR9_CORAM Bifunctional purine biosynthesis protein PurH OS=Corynebacterium ammoniagenes GN=purH PE=3 SV=1 6 600 1.0E-65
sp|Q8FR29|PUR9_COREF Bifunctional purine biosynthesis protein PurH OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=purH PE=3 SV=1 6 466 2.0E-65
sp|B3QQA5|PUR9_CHLP8 Bifunctional purine biosynthesis protein PurH OS=Chlorobaculum parvum (strain NCIB 8327) GN=purH PE=3 SV=1 6 522 2.0E-65
sp|Q5HUK6|PUR9_CAMJR Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni (strain RM1221) GN=purH PE=3 SV=1 6 460 3.0E-65
sp|Q2RGU9|PUR9_MOOTA Bifunctional purine biosynthesis protein PurH OS=Moorella thermoacetica (strain ATCC 39073) GN=purH PE=3 SV=1 6 466 3.0E-65
sp|A1VZU4|PUR9_CAMJJ Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=purH PE=3 SV=1 6 460 3.0E-65
sp|Q9PNY2|PUR9_CAMJE Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=purH PE=1 SV=1 6 460 3.0E-65
sp|C3MAR5|PUR9_RHISN Bifunctional purine biosynthesis protein PurH OS=Rhizobium sp. (strain NGR234) GN=purH PE=3 SV=1 6 464 3.0E-65
sp|Q9RAJ5|PUR9_MYCPA Bifunctional purine biosynthesis protein PurH OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=purH PE=3 SV=2 2 466 3.0E-65
sp|B8JHC9|PUR9_ANAD2 Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=purH PE=3 SV=1 6 512 4.0E-65
sp|B4UJ61|PUR9_ANASK Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter sp. (strain K) GN=purH PE=3 SV=1 6 512 4.0E-65
sp|Q8DWK8|PUR9_STRMU Bifunctional purine biosynthesis protein PurH OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=purH PE=3 SV=2 6 466 5.0E-65
sp|A3Q5N7|PUR9_MYCSJ Bifunctional purine biosynthesis protein PurH OS=Mycobacterium sp. (strain JLS) GN=purH PE=3 SV=1 2 466 5.0E-65
sp|Q8KFK6|PUR9_CHLTE Bifunctional purine biosynthesis protein PurH OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=purH PE=3 SV=1 6 522 6.0E-65
sp|B8DDZ2|PUR9_LISMH Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=purH PE=3 SV=1 6 466 2.0E-64
sp|A8FM07|PUR9_CAMJ8 Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=purH PE=3 SV=1 6 460 4.0E-64
sp|Q11CT4|PUR9_CHESB Bifunctional purine biosynthesis protein PurH OS=Chelativorans sp. (strain BNC1) GN=purH PE=3 SV=1 1 465 4.0E-64
sp|Q8NS21|PUR9_CORGL Bifunctional purine biosynthesis protein PurH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=purH PE=3 SV=1 6 466 7.0E-64
sp|Q03MZ6|PUR9_STRTD Bifunctional purine biosynthesis protein PurH OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=purH PE=3 SV=1 6 466 8.0E-64
sp|A4QCK4|PUR9_CORGB Bifunctional purine biosynthesis protein PurH OS=Corynebacterium glutamicum (strain R) GN=purH PE=3 SV=1 6 466 8.0E-64
sp|C0QXU6|PUR9_BRAHW Bifunctional purine biosynthesis protein PurH OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=purH PE=3 SV=1 6 460 9.0E-64
sp|Q1J934|PUR9_STRPF Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=purH PE=3 SV=1 6 466 1.0E-63
sp|Q8P310|PUR9_STRP8 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=purH PE=3 SV=1 6 466 1.0E-63
sp|Q3K3Z7|PUR9_STRA1 Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=purH PE=3 SV=1 6 466 3.0E-63
sp|Q9KY50|PUR9_STRCO Bifunctional purine biosynthesis protein PurH OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=purH PE=3 SV=1 6 466 4.0E-63
sp|C3PF03|PUR9_CORA7 Bifunctional purine biosynthesis protein PurH OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=purH PE=3 SV=1 2 600 5.0E-63
sp|A8AUA2|PUR9_STRGC Bifunctional purine biosynthesis protein PurH OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=purH PE=3 SV=1 6 466 5.0E-63
sp|C1C9V4|PUR9_STRP7 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain 70585) GN=purH PE=3 SV=1 7 466 6.0E-63
sp|C1CHW2|PUR9_STRZP Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain P1031) GN=purH PE=3 SV=1 7 466 9.0E-63
sp|C0MB61|PUR9_STRE4 Bifunctional purine biosynthesis protein PurH OS=Streptococcus equi subsp. equi (strain 4047) GN=purH PE=3 SV=1 6 466 9.0E-63
sp|B5XJ20|PUR9_STRPZ Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=purH PE=3 SV=1 6 466 9.0E-63
sp|A2BUP7|PUR9_PROM5 Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain MIT 9515) GN=purH PE=3 SV=1 5 466 1.0E-62
sp|B2V3C3|PUR9_CLOBA Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=purH PE=3 SV=1 6 600 1.0E-62
sp|Q5XEF2|PUR9_STRP6 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=purH PE=3 SV=1 6 466 1.0E-62
sp|A5N0Q0|PUR9_CLOK5 Bifunctional purine biosynthesis protein PurH OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=purH PE=3 SV=1 6 460 1.0E-62
sp|B9E4K6|PUR9_CLOK1 Bifunctional purine biosynthesis protein PurH OS=Clostridium kluyveri (strain NBRC 12016) GN=purH PE=3 SV=1 6 460 1.0E-62
sp|P0DD61|PUR9_STRPQ Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=purH PE=3 SV=1 6 466 1.0E-62
sp|P0DD60|PUR9_STRP3 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=purH PE=3 SV=1 6 466 1.0E-62
sp|Q9Z5H5|PUR9_MYCLE Bifunctional purine biosynthesis protein PurH OS=Mycobacterium leprae (strain TN) GN=purH PE=3 SV=1 2 466 1.0E-62
sp|B8ZU05|PUR9_MYCLB Bifunctional purine biosynthesis protein PurH OS=Mycobacterium leprae (strain Br4923) GN=purH PE=3 SV=1 2 466 1.0E-62
sp|C1CBM7|PUR9_STRZJ Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain JJA) GN=purH PE=3 SV=1 7 466 2.0E-62
sp|B8ZJN3|PUR9_STRPJ Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=purH PE=3 SV=1 7 466 2.0E-62
sp|P67546|PUR9_STRA5 Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=purH PE=3 SV=1 6 466 2.0E-62
sp|P67545|PUR9_STRA3 Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype III (strain NEM316) GN=purH PE=3 SV=1 6 466 2.0E-62
sp|B1I7V8|PUR9_STRPI Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=purH PE=3 SV=1 7 466 2.0E-62
sp|C1CNS9|PUR9_STRZT Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=purH PE=3 SV=1 7 466 2.0E-62
sp|Q97T99|PUR9_STRPN Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=purH PE=3 SV=1 7 466 2.0E-62
sp|Q1JJ80|PUR9_STRPD Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=purH PE=3 SV=1 6 466 3.0E-62
sp|Q48VY9|PUR9_STRPM Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=purH PE=3 SV=1 6 466 3.0E-62
sp|Q1JP34|PUR9_STRPC Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=purH PE=3 SV=1 6 466 3.0E-62
sp|Q1JE78|PUR9_STRPB Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=purH PE=3 SV=1 6 466 3.0E-62
sp|B5E5J9|PUR9_STRP4 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=purH PE=3 SV=1 7 466 3.0E-62
sp|B9DSR6|PUR9_STRU0 Bifunctional purine biosynthesis protein PurH OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=purH PE=3 SV=1 6 466 4.0E-62
sp|A7H375|PUR9_CAMJD Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=purH PE=3 SV=1 6 460 6.0E-62
sp|Q8DRM1|PUR9_STRR6 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=purH PE=3 SV=2 7 466 8.0E-62
sp|Q04N19|PUR9_STRP2 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=purH PE=3 SV=1 7 466 8.0E-62
sp|B2TN76|PUR9_CLOBB Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=purH PE=3 SV=1 6 600 1.0E-61
sp|Q7UKJ8|PUR9_RHOBA Bifunctional purine biosynthesis protein PurH OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=purH PE=3 SV=1 1 466 1.0E-61
sp|Q051H8|PUR9_LEPBL Bifunctional purine biosynthesis protein PurH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=purH PE=3 SV=1 6 469 2.0E-61
sp|Q04T56|PUR9_LEPBJ Bifunctional purine biosynthesis protein PurH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=purH PE=3 SV=1 6 469 2.0E-61
sp|Q892X3|PUR9_CLOTE Bifunctional purine biosynthesis protein PurH OS=Clostridium tetani (strain Massachusetts / E88) GN=purH PE=3 SV=1 6 472 2.0E-61
sp|C0MC89|PUR9_STRS7 Bifunctional purine biosynthesis protein PurH OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=purH PE=3 SV=1 6 466 6.0E-61
sp|B8D8J3|PUR9_BUCA5 Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=purH PE=3 SV=1 6 470 7.0E-61
sp|B8D6U7|PUR9_BUCAT Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=purH PE=3 SV=1 6 469 1.0E-60
sp|P57143|PUR9_BUCAI Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=purH PE=3 SV=1 6 469 1.0E-60
sp|Q0SV48|PUR9_CLOPS Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain SM101 / Type A) GN=purH PE=3 SV=1 6 466 2.0E-60
sp|Q0TTB0|PUR9_CLOP1 Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=purH PE=3 SV=1 6 466 2.0E-60
sp|Q9F1T4|PUR9_STRSU Bifunctional purine biosynthesis protein PurH OS=Streptococcus suis GN=purH PE=3 SV=1 6 466 2.0E-60
sp|A4VSB5|PUR9_STRSY Bifunctional purine biosynthesis protein PurH OS=Streptococcus suis (strain 05ZYH33) GN=purH PE=3 SV=1 6 466 6.0E-60
sp|A4VYK5|PUR9_STRS2 Bifunctional purine biosynthesis protein PurH OS=Streptococcus suis (strain 98HAH33) GN=purH PE=3 SV=1 6 466 6.0E-60
sp|Q8XMK2|PUR9_CLOPE Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain 13 / Type A) GN=purH PE=3 SV=1 6 466 9.0E-60
sp|Q6AD62|PUR9_LEIXX Bifunctional purine biosynthesis protein PurH OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=purH PE=3 SV=1 1 466 1.0E-59
sp|A6LSB3|PUR9_CLOB8 Bifunctional purine biosynthesis protein PurH OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=purH PE=3 SV=1 6 464 2.0E-59
sp|Q8F3W6|PUR9_LEPIN Bifunctional purine biosynthesis protein PurH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=purH PE=3 SV=1 6 469 2.0E-59
sp|Q72RT5|PUR9_LEPIC Bifunctional purine biosynthesis protein PurH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=purH PE=3 SV=1 6 469 3.0E-59
sp|Q04EU6|PUR9_OENOB Bifunctional purine biosynthesis protein PurH OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=purH PE=3 SV=1 6 466 6.0E-59
sp|A7GYY6|PUR9_CAMC5 Bifunctional purine biosynthesis protein PurH OS=Campylobacter curvus (strain 525.92) GN=purH PE=3 SV=1 6 458 8.0E-59
sp|Q6A6Y8|PUR9_PROAC Bifunctional purine biosynthesis protein PurH OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=purH PE=3 SV=1 2 466 2.0E-58
sp|A0Q1J0|PUR9_CLONN Bifunctional purine biosynthesis protein PurH OS=Clostridium novyi (strain NT) GN=purH PE=3 SV=1 6 460 2.0E-58
sp|Q9CFG0|PUR9_LACLA Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purH PE=3 SV=1 6 466 6.0E-57
sp|Q8KA70|PUR9_BUCAP Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=purH PE=3 SV=1 6 493 1.0E-56
sp|A7ZCZ7|PUR9_CAMC1 Bifunctional purine biosynthesis protein PurH OS=Campylobacter concisus (strain 13826) GN=purH PE=3 SV=1 6 458 3.0E-56
sp|Q18CW0|PUR9_PEPD6 Bifunctional purine biosynthesis protein PurH OS=Peptoclostridium difficile (strain 630) GN=purH PE=3 SV=1 6 460 4.0E-55
sp|Q02Y66|PUR9_LACLS Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=purH PE=3 SV=1 6 466 1.0E-54
sp|A2RJY0|PUR9_LACLM Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=purH PE=3 SV=1 6 466 2.0E-54
sp|Q8A155|PUR9_BACTN Bifunctional purine biosynthesis protein PurH OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=purH PE=3 SV=1 6 495 8.0E-52
sp|Q89B23|PUR9_BUCBP Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=purH PE=3 SV=1 6 471 5.0E-51
sp|B3DRY6|PUR9_BIFLD Bifunctional purine biosynthesis protein PurH OS=Bifidobacterium longum (strain DJO10A) GN=purH PE=3 SV=1 2 466 1.0E-50
sp|Q8G6B1|PUR9_BIFLO Bifunctional purine biosynthesis protein PurH OS=Bifidobacterium longum (strain NCC 2705) GN=purH PE=3 SV=1 2 466 2.0E-50
sp|Q8D244|PUR9_WIGBR Bifunctional purine biosynthesis protein PurH OS=Wigglesworthia glossinidia brevipalpis GN=purH PE=3 SV=1 1 600 9.0E-48
sp|Q9X0X6|PUR9_THEMA Bifunctional purine biosynthesis protein PurH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purH PE=1 SV=1 7 466 2.0E-37
sp|Q24QH6|PUR9_DESHY Bifunctional purine biosynthesis protein PurH OS=Desulfitobacterium hafniense (strain Y51) GN=purH PE=3 SV=1 483 600 2.0E-11
sp|B8FP05|PUR9_DESHD Bifunctional purine biosynthesis protein PurH OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=purH PE=3 SV=1 483 600 2.0E-11
sp|Q9ABY4|PUR9_CAUCR Bifunctional purine biosynthesis protein PurH OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=purH PE=3 SV=1 481 600 3.0E-11
sp|Q8DRM1|PUR9_STRR6 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=purH PE=3 SV=2 538 600 5.0E-11
sp|Q04N19|PUR9_STRP2 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=purH PE=3 SV=1 538 600 5.0E-11
sp|A8AUA2|PUR9_STRGC Bifunctional purine biosynthesis protein PurH OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=purH PE=3 SV=1 538 600 6.0E-11
sp|C1CHW2|PUR9_STRZP Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain P1031) GN=purH PE=3 SV=1 538 600 6.0E-11
sp|C1CNS9|PUR9_STRZT Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=purH PE=3 SV=1 538 600 6.0E-11
sp|Q97T99|PUR9_STRPN Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=purH PE=3 SV=1 538 600 6.0E-11
sp|Q03MZ6|PUR9_STRTD Bifunctional purine biosynthesis protein PurH OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=purH PE=3 SV=1 538 600 8.0E-11
sp|B1I7V8|PUR9_STRPI Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=purH PE=3 SV=1 538 600 8.0E-11
sp|C1C9V4|PUR9_STRP7 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain 70585) GN=purH PE=3 SV=1 538 600 2.0E-10
sp|B5E5J9|PUR9_STRP4 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=purH PE=3 SV=1 538 600 2.0E-10
sp|Q489F4|PUR9_COLP3 Bifunctional purine biosynthesis protein PurH OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=purH PE=3 SV=1 483 600 3.0E-10
sp|C1CBM7|PUR9_STRZJ Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain JJA) GN=purH PE=3 SV=1 538 600 3.0E-10
sp|B8ZJN3|PUR9_STRPJ Bifunctional purine biosynthesis protein PurH OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=purH PE=3 SV=1 538 600 3.0E-10
sp|P57828|PUR9_PASMU Bifunctional purine biosynthesis protein PurH OS=Pasteurella multocida (strain Pm70) GN=purH PE=3 SV=1 405 600 4.0E-10
sp|Q7MGT5|PUR9_VIBVY Bifunctional purine biosynthesis protein PurH OS=Vibrio vulnificus (strain YJ016) GN=purH PE=3 SV=1 483 600 4.0E-10
sp|Q8DD06|PUR9_VIBVU Bifunctional purine biosynthesis protein PurH OS=Vibrio vulnificus (strain CMCP6) GN=purH PE=3 SV=1 483 600 4.0E-10
sp|B7VM57|PUR9_VIBTL Bifunctional purine biosynthesis protein PurH OS=Vibrio tasmaniensis (strain LGP32) GN=purH PE=3 SV=1 495 600 5.0E-10
sp|Q0I557|PUR9_HAES1 Bifunctional purine biosynthesis protein PurH OS=Haemophilus somnus (strain 129Pt) GN=purH PE=3 SV=1 483 600 8.0E-10
sp|A7H375|PUR9_CAMJD Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=purH PE=3 SV=1 539 600 8.0E-10
sp|B0UWT1|PUR9_HISS2 Bifunctional purine biosynthesis protein PurH OS=Histophilus somni (strain 2336) GN=purH PE=3 SV=1 483 600 9.0E-10
sp|Q5HUK6|PUR9_CAMJR Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni (strain RM1221) GN=purH PE=3 SV=1 539 600 9.0E-10
sp|Q5E257|PUR9_VIBF1 Bifunctional purine biosynthesis protein PurH OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=purH PE=3 SV=1 495 600 1.0E-09
sp|B5FC70|PUR9_VIBFM Bifunctional purine biosynthesis protein PurH OS=Vibrio fischeri (strain MJ11) GN=purH PE=3 SV=1 495 600 1.0E-09
sp|A7GKI2|PUR9_BACCN Bifunctional purine biosynthesis protein PurH OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=purH PE=3 SV=1 538 600 1.0E-09
sp|A1VZU4|PUR9_CAMJJ Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=purH PE=3 SV=1 539 600 1.0E-09
sp|Q9PNY2|PUR9_CAMJE Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=purH PE=1 SV=1 539 600 1.0E-09
sp|A8FM07|PUR9_CAMJ8 Bifunctional purine biosynthesis protein PurH OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=purH PE=3 SV=1 539 600 1.0E-09
sp|Q0VMY5|PUR9_ALCBS Bifunctional purine biosynthesis protein PurH OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=purH PE=3 SV=1 483 600 2.0E-09
sp|P43852|PUR9_HAEIN Bifunctional purine biosynthesis protein PurH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purH PE=3 SV=1 483 600 2.0E-09
sp|Q4FRN8|PUR9_PSYA2 Bifunctional purine biosynthesis protein PurH OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=purH PE=3 SV=1 480 600 2.0E-09
sp|Q1QA75|PUR9_PSYCK Bifunctional purine biosynthesis protein PurH OS=Psychrobacter cryohalolentis (strain K5) GN=purH PE=3 SV=1 480 600 2.0E-09
sp|A4VPK9|PUR9_PSEU5 Bifunctional purine biosynthesis protein PurH OS=Pseudomonas stutzeri (strain A1501) GN=purH PE=3 SV=1 483 600 3.0E-09
sp|Q8KFK6|PUR9_CHLTE Bifunctional purine biosynthesis protein PurH OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=purH PE=3 SV=1 483 600 3.0E-09
sp|B0TR91|PUR9_SHEHH Bifunctional purine biosynthesis protein PurH OS=Shewanella halifaxensis (strain HAW-EB4) GN=purH PE=3 SV=1 483 600 4.0E-09
sp|B0U7A0|PUR9_XYLFM Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain M12) GN=purH PE=3 SV=1 483 600 4.0E-09
sp|P12048|PUR9_BACSU Bifunctional purine biosynthesis protein PurH OS=Bacillus subtilis (strain 168) GN=purH PE=3 SV=2 537 600 4.0E-09
sp|B3QQA5|PUR9_CHLP8 Bifunctional purine biosynthesis protein PurH OS=Chlorobaculum parvum (strain NCIB 8327) GN=purH PE=3 SV=1 483 600 4.0E-09
sp|Q74FJ9|PUR9_GEOSL Bifunctional purine biosynthesis protein PurH OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=purH PE=3 SV=1 335 600 5.0E-09
sp|B8CTW4|PUR9_SHEPW Bifunctional purine biosynthesis protein PurH OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=purH PE=3 SV=1 483 600 5.0E-09
sp|Q9PC10|PUR9_XYLFA Bifunctional purine biosynthesis protein PurH OS=Xylella fastidiosa (strain 9a5c) GN=purH PE=3 SV=2 483 600 5.0E-09
sp|Q3ATZ1|PUR9_CHLCH Bifunctional purine biosynthesis protein PurH OS=Chlorobium chlorochromatii (strain CaD3) GN=purH PE=3 SV=1 481 600 5.0E-09
sp|Q3AN13|PUR9_SYNSC Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9605) GN=purH PE=3 SV=1 482 600 6.0E-09
sp|B7JM89|PUR9_BACC0 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain AH820) GN=purH PE=3 SV=1 537 600 6.0E-09
sp|Q81ZG8|PUR9_BACAN Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis GN=purH PE=3 SV=1 537 600 6.0E-09
sp|C3L536|PUR9_BACAC Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=purH PE=3 SV=1 537 600 6.0E-09
sp|C3PBN4|PUR9_BACAA Bifunctional purine biosynthesis protein PurH OS=Bacillus anthracis (strain A0248) GN=purH PE=3 SV=1 537 600 6.0E-09
sp|C1EV67|PUR9_BACC3 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain 03BB102) GN=purH PE=3 SV=1 537 600 6.0E-09
sp|A0R900|PUR9_BACAH Bifunctional purine biosynthesis protein PurH OS=Bacillus thuringiensis (strain Al Hakam) GN=purH PE=3 SV=1 537 600 6.0E-09
sp|Q6HPA0|PUR9_BACHK Bifunctional purine biosynthesis protein PurH OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=purH PE=3 SV=1 537 600 6.0E-09
sp|Q87VR9|PUR9_PSESM Bifunctional purine biosynthesis protein PurH OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=purH PE=3 SV=1 483 600 6.0E-09
sp|A9VRF5|PUR9_BACWK Bifunctional purine biosynthesis protein PurH OS=Bacillus weihenstephanensis (strain KBAB4) GN=purH PE=3 SV=1 537 600 7.0E-09
sp|Q5WJ82|PUR9_BACSK Bifunctional purine biosynthesis protein PurH OS=Bacillus clausii (strain KSM-K16) GN=purH PE=3 SV=1 495 600 7.0E-09
sp|B3E7F6|PUR9_GEOLS Bifunctional purine biosynthesis protein PurH OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=purH PE=3 SV=1 539 600 8.0E-09
sp|A4XQ60|PUR9_PSEMY Bifunctional purine biosynthesis protein PurH OS=Pseudomonas mendocina (strain ymp) GN=purH PE=3 SV=1 483 600 8.0E-09
sp|A4SDE6|PUR9_CHLPM Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=purH PE=3 SV=1 483 600 9.0E-09
sp|B4SDT6|PUR9_PELPB Bifunctional purine biosynthesis protein PurH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=purH PE=3 SV=1 481 600 9.0E-09
sp|C0QRH2|PUR9_PERMH Bifunctional purine biosynthesis protein PurH OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=purH PE=3 SV=1 523 600 9.0E-09
sp|A8GZM3|PUR9_SHEPA Bifunctional purine biosynthesis protein PurH OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=purH PE=3 SV=1 483 600 1.0E-08
sp|Q67KG3|PUR9_SYMTH Bifunctional purine biosynthesis protein PurH OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=purH PE=3 SV=1 483 600 1.0E-08
sp|A1BE85|PUR9_CHLPD Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeobacteroides (strain DSM 266) GN=purH PE=3 SV=1 481 600 1.0E-08
sp|B4EYT2|PUR9_PROMH Bifunctional purine biosynthesis protein PurH OS=Proteus mirabilis (strain HI4320) GN=purH PE=3 SV=1 483 600 1.0E-08
sp|A5FUH4|PUR9_ACICJ Bifunctional purine biosynthesis protein PurH OS=Acidiphilium cryptum (strain JF-5) GN=purH PE=3 SV=1 483 600 1.0E-08
sp|B3EEI0|PUR9_CHLL2 Bifunctional purine biosynthesis protein PurH OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=purH PE=3 SV=1 483 600 1.0E-08
sp|Q18CW0|PUR9_PEPD6 Bifunctional purine biosynthesis protein PurH OS=Peptoclostridium difficile (strain 630) GN=purH PE=3 SV=1 483 600 1.0E-08
sp|B7H4U0|PUR9_BACC4 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain B4264) GN=purH PE=3 SV=1 537 600 2.0E-08
sp|Q81IP9|PUR9_BACCR Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=purH PE=3 SV=1 537 600 2.0E-08
sp|B7HS36|PUR9_BACC7 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain AH187) GN=purH PE=3 SV=1 537 600 2.0E-08
sp|B9J1K9|PUR9_BACCQ Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain Q1) GN=purH PE=3 SV=1 537 600 2.0E-08
sp|Q73EN1|PUR9_BACC1 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=purH PE=3 SV=1 537 600 2.0E-08
sp|B7IUV7|PUR9_BACC2 Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain G9842) GN=purH PE=3 SV=1 537 600 2.0E-08
sp|Q3A2D6|PUR9_PELCD Bifunctional purine biosynthesis protein PurH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=purH PE=3 SV=1 541 600 2.0E-08
sp|Q63GS9|PUR9_BACCZ Bifunctional purine biosynthesis protein PurH OS=Bacillus cereus (strain ZK / E33L) GN=purH PE=3 SV=1 537 600 2.0E-08
sp|A5WFX4|PUR9_PSYWF Bifunctional purine biosynthesis protein PurH OS=Psychrobacter sp. (strain PRwf-1) GN=purH PE=3 SV=1 483 600 2.0E-08
sp|Q1LU51|PUR9_BAUCH Bifunctional purine biosynthesis protein PurH OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=purH PE=3 SV=1 483 600 2.0E-08
sp|Q4KIX5|PUR9_PSEF5 Bifunctional purine biosynthesis protein PurH OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=purH PE=3 SV=1 483 600 2.0E-08
sp|Q1I4C1|PUR9_PSEE4 Bifunctional purine biosynthesis protein PurH OS=Pseudomonas entomophila (strain L48) GN=purH PE=3 SV=1 483 600 2.0E-08
sp|Q3B5R1|PUR9_CHLL7 Bifunctional purine biosynthesis protein PurH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=purH PE=3 SV=1 483 600 2.0E-08
sp|Q1J934|PUR9_STRPF Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=purH PE=3 SV=1 539 600 2.0E-08
sp|Q8P310|PUR9_STRP8 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=purH PE=3 SV=1 539 600 2.0E-08
sp|Q5XEF2|PUR9_STRP6 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=purH PE=3 SV=1 539 600 2.0E-08
sp|A7ZCZ7|PUR9_CAMC1 Bifunctional purine biosynthesis protein PurH OS=Campylobacter concisus (strain 13826) GN=purH PE=3 SV=1 539 600 2.0E-08
sp|Q2P866|PUR9_XANOM Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=purH PE=3 SV=1 483 600 3.0E-08
sp|Q5H5H7|PUR9_XANOR Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=purH PE=3 SV=1 483 600 3.0E-08
sp|B2SRB2|PUR9_XANOP Bifunctional purine biosynthesis protein PurH OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=purH PE=3 SV=1 483 600 3.0E-08
sp|Q0IDE8|PUR9_SYNS3 Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9311) GN=purH PE=3 SV=1 483 600 3.0E-08
sp|B9M4Q6|PUR9_GEODF Bifunctional purine biosynthesis protein PurH OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=purH PE=3 SV=1 481 600 3.0E-08
sp|B3ELV3|PUR9_CHLPB Bifunctional purine biosynthesis protein PurH OS=Chlorobium phaeobacteroides (strain BS1) GN=purH PE=3 SV=1 483 600 3.0E-08
sp|B1J5T3|PUR9_PSEPW Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain W619) GN=purH PE=3 SV=1 483 600 3.0E-08
sp|Q88DK3|PUR9_PSEPK Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain KT2440) GN=purH PE=3 SV=1 483 600 3.0E-08
sp|A5W9K7|PUR9_PSEP1 Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=purH PE=3 SV=1 483 600 3.0E-08
sp|B0KJZ6|PUR9_PSEPG Bifunctional purine biosynthesis protein PurH OS=Pseudomonas putida (strain GB-1) GN=purH PE=3 SV=1 483 600 3.0E-08
sp|C3K6E0|PUR9_PSEFS Bifunctional purine biosynthesis protein PurH OS=Pseudomonas fluorescens (strain SBW25) GN=purH PE=3 SV=1 483 600 3.0E-08
sp|B1IL57|PUR9_CLOBK Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Okra / Type B1) GN=purH PE=3 SV=1 537 600 3.0E-08
sp|B8D8J3|PUR9_BUCA5 Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=purH PE=3 SV=1 495 600 3.0E-08
sp|B8D6U7|PUR9_BUCAT Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=purH PE=3 SV=1 495 600 3.0E-08
sp|P57143|PUR9_BUCAI Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=purH PE=3 SV=1 495 600 3.0E-08
sp|Q02Y66|PUR9_LACLS Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=purH PE=3 SV=1 540 600 3.0E-08
sp|A2RJY0|PUR9_LACLM Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=purH PE=3 SV=1 540 600 3.0E-08
sp|Q9X0X6|PUR9_THEMA Bifunctional purine biosynthesis protein PurH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=purH PE=1 SV=1 538 600 3.0E-08
sp|Q3JC90|PUR9_NITOC Bifunctional purine biosynthesis protein PurH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=purH PE=3 SV=1 483 600 4.0E-08
sp|Q11CT4|PUR9_CHESB Bifunctional purine biosynthesis protein PurH OS=Chelativorans sp. (strain BNC1) GN=purH PE=3 SV=1 541 600 4.0E-08
sp|Q7UKJ8|PUR9_RHOBA Bifunctional purine biosynthesis protein PurH OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=purH PE=3 SV=1 540 600 4.0E-08
sp|Q8F3W6|PUR9_LEPIN Bifunctional purine biosynthesis protein PurH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=purH PE=3 SV=1 541 600 4.0E-08
sp|Q72RT5|PUR9_LEPIC Bifunctional purine biosynthesis protein PurH OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=purH PE=3 SV=1 541 600 4.0E-08
sp|Q2SZ52|PUR9_BURTA Bifunctional purine biosynthesis protein PurH OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=purH PE=3 SV=1 476 600 5.0E-08
sp|A1AS76|PUR9_PELPD Bifunctional purine biosynthesis protein PurH OS=Pelobacter propionicus (strain DSM 2379) GN=purH PE=3 SV=1 481 600 5.0E-08
sp|P74741|PUR9_SYNY3 Bifunctional purine biosynthesis protein PurH OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purH PE=3 SV=2 541 600 5.0E-08
sp|B2JGU1|PUR9_BURP8 Bifunctional purine biosynthesis protein PurH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=purH PE=3 SV=1 476 600 5.0E-08
sp|Q9CFG0|PUR9_LACLA Bifunctional purine biosynthesis protein PurH OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purH PE=3 SV=1 540 600 5.0E-08
sp|A4XKZ2|PUR9_CALS8 Bifunctional purine biosynthesis protein PurH OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=purH PE=3 SV=1 539 600 6.0E-08
sp|C1FV76|PUR9_CLOBJ Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Kyoto / Type A2) GN=purH PE=3 SV=1 537 600 6.0E-08
sp|B7K3N8|PUR9_CYAP8 Bifunctional purine biosynthesis protein PurH OS=Cyanothece sp. (strain PCC 8801) GN=purH PE=3 SV=1 541 600 7.0E-08
sp|B2UFL5|PUR9_RALPJ Bifunctional purine biosynthesis protein PurH OS=Ralstonia pickettii (strain 12J) GN=purH PE=3 SV=1 476 600 7.0E-08
sp|A5I5V9|PUR9_CLOBH Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=purH PE=3 SV=1 537 600 7.0E-08
sp|A7FXD3|PUR9_CLOB1 Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=purH PE=3 SV=1 537 600 7.0E-08
sp|A7GH96|PUR9_CLOBL Bifunctional purine biosynthesis protein PurH OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=purH PE=3 SV=1 537 600 7.0E-08
sp|Q2RGU9|PUR9_MOOTA Bifunctional purine biosynthesis protein PurH OS=Moorella thermoacetica (strain ATCC 39073) GN=purH PE=3 SV=1 483 600 7.0E-08
sp|A3NDF2|PUR9_BURP6 Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 668) GN=purH PE=3 SV=1 476 600 8.0E-08
sp|A3NZ64|PUR9_BURP0 Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 1106a) GN=purH PE=3 SV=1 476 600 8.0E-08
sp|A1V068|PUR9_BURMS Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain SAVP1) GN=purH PE=3 SV=1 476 600 8.0E-08
sp|Q62HA6|PUR9_BURMA Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain ATCC 23344) GN=purH PE=3 SV=1 476 600 8.0E-08
sp|A2S597|PUR9_BURM9 Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain NCTC 10229) GN=purH PE=3 SV=1 476 600 8.0E-08
sp|A3MP76|PUR9_BURM7 Bifunctional purine biosynthesis protein PurH OS=Burkholderia mallei (strain NCTC 10247) GN=purH PE=3 SV=1 476 600 8.0E-08
sp|Q63QX8|PUR9_BURPS Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain K96243) GN=purH PE=3 SV=1 476 600 8.0E-08
sp|Q3JNS8|PUR9_BURP1 Bifunctional purine biosynthesis protein PurH OS=Burkholderia pseudomallei (strain 1710b) GN=purH PE=3 SV=1 476 600 8.0E-08
sp|B2AH76|PUR9_CUPTR Bifunctional purine biosynthesis protein PurH OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=purH PE=3 SV=1 476 600 8.0E-08
sp|A7GYY6|PUR9_CAMC5 Bifunctional purine biosynthesis protein PurH OS=Campylobacter curvus (strain 525.92) GN=purH PE=3 SV=1 539 600 8.0E-08
sp|A9AH70|PUR9_BURM1 Bifunctional purine biosynthesis protein PurH OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=purH PE=3 SV=1 476 600 1.0E-07
sp|Q39RK1|PUR9_GEOMG Bifunctional purine biosynthesis protein PurH OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=purH PE=3 SV=1 481 600 1.0E-07
sp|Q0KEC0|PUR9_CUPNH Bifunctional purine biosynthesis protein PurH OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=purH PE=3 SV=1 476 600 1.0E-07
sp|P67540|PUR9_BRUSU Bifunctional purine biosynthesis protein PurH OS=Brucella suis biovar 1 (strain 1330) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|A9WWU1|PUR9_BRUSI Bifunctional purine biosynthesis protein PurH OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|P67539|PUR9_BRUME Bifunctional purine biosynthesis protein PurH OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|C0RF67|PUR9_BRUMB Bifunctional purine biosynthesis protein PurH OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|A9M854|PUR9_BRUC2 Bifunctional purine biosynthesis protein PurH OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|A5VSF8|PUR9_BRUO2 Bifunctional purine biosynthesis protein PurH OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|Q57B71|PUR9_BRUAB Bifunctional purine biosynthesis protein PurH OS=Brucella abortus biovar 1 (strain 9-941) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|Q2YLH0|PUR9_BRUA2 Bifunctional purine biosynthesis protein PurH OS=Brucella abortus (strain 2308) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|B2S7P0|PUR9_BRUA1 Bifunctional purine biosynthesis protein PurH OS=Brucella abortus (strain S19) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|B5YLE5|PUR9_THEYD Bifunctional purine biosynthesis protein PurH OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=purH PE=3 SV=1 484 600 1.0E-07
sp|Q051H8|PUR9_LEPBL Bifunctional purine biosynthesis protein PurH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|Q04T56|PUR9_LEPBJ Bifunctional purine biosynthesis protein PurH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=purH PE=3 SV=1 541 600 1.0E-07
sp|B4EES4|PUR9_BURCJ Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=purH PE=3 SV=1 476 600 2.0E-07
sp|Q1LRB3|PUR9_CUPMC Bifunctional purine biosynthesis protein PurH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=purH PE=3 SV=1 476 600 2.0E-07
sp|C5CL84|PUR9_VARPS Bifunctional purine biosynthesis protein PurH OS=Variovorax paradoxus (strain S110) GN=purH PE=3 SV=1 483 600 2.0E-07
sp|Q31R91|PUR9_SYNE7 Bifunctional purine biosynthesis protein PurH OS=Synechococcus elongatus (strain PCC 7942) GN=purH PE=3 SV=1 483 600 2.0E-07
sp|A6TLS7|PUR9_ALKMQ Bifunctional purine biosynthesis protein PurH OS=Alkaliphilus metalliredigens (strain QYMF) GN=purH PE=3 SV=1 536 600 2.0E-07
sp|Q46480|PUR9_ALLVD Bifunctional purine biosynthesis protein PurH OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=purH PE=3 SV=2 541 600 2.0E-07
sp|C1D6F1|PUR9_LARHH Bifunctional purine biosynthesis protein PurH OS=Laribacter hongkongensis (strain HLHK9) GN=purH PE=3 SV=1 480 600 2.0E-07
sp|B0SQ10|PUR9_LEPBP Bifunctional purine biosynthesis protein PurH OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=purH PE=3 SV=1 541 600 2.0E-07
sp|B0SGW3|PUR9_LEPBA Bifunctional purine biosynthesis protein PurH OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=purH PE=3 SV=1 541 600 2.0E-07
sp|Q8YSJ2|PUR9_NOSS1 Bifunctional purine biosynthesis protein PurH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=purH PE=3 SV=1 538 600 3.0E-07
sp|Q3M6G3|PUR9_ANAVT Bifunctional purine biosynthesis protein PurH OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=purH PE=3 SV=1 538 600 3.0E-07
sp|Q5LN38|PUR9_RUEPO Bifunctional purine biosynthesis protein PurH OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=purH PE=3 SV=1 541 600 3.0E-07
sp|Q39JI8|PUR9_BURL3 Bifunctional purine biosynthesis protein PurH OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=purH PE=3 SV=1 483 600 3.0E-07
sp|A5G879|PUR9_GEOUR Bifunctional purine biosynthesis protein PurH OS=Geobacter uraniireducens (strain Rf4) GN=purH PE=3 SV=1 541 600 3.0E-07
sp|B2VG81|PUR9_ERWT9 Bifunctional purine biosynthesis protein PurH OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=purH PE=3 SV=1 538 600 3.0E-07
sp|B5EL42|PUR9_ACIF5 Bifunctional purine biosynthesis protein PurH OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=purH PE=3 SV=1 539 600 3.0E-07
sp|B7J5P7|PUR9_ACIF2 Bifunctional purine biosynthesis protein PurH OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=purH PE=3 SV=1 539 600 3.0E-07
sp|B2HEC3|PUR9_MYCMM Bifunctional purine biosynthesis protein PurH OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=purH PE=3 SV=1 481 600 3.0E-07
sp|Q0TTB0|PUR9_CLOP1 Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=purH PE=3 SV=1 541 600 3.0E-07
sp|Q8XMK2|PUR9_CLOPE Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain 13 / Type A) GN=purH PE=3 SV=1 541 600 3.0E-07
sp|A0Q1J0|PUR9_CLONN Bifunctional purine biosynthesis protein PurH OS=Clostridium novyi (strain NT) GN=purH PE=3 SV=1 522 600 3.0E-07
sp|Q89B23|PUR9_BUCBP Bifunctional purine biosynthesis protein PurH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=purH PE=3 SV=1 539 600 3.0E-07
sp|B7KGS0|PUR9_CYAP7 Bifunctional purine biosynthesis protein PurH OS=Cyanothece sp. (strain PCC 7424) GN=purH PE=3 SV=1 545 600 4.0E-07
sp|Q475R4|PUR9_CUPPJ Bifunctional purine biosynthesis protein PurH OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=purH PE=3 SV=1 476 600 4.0E-07
sp|A0PWC5|PUR9_MYCUA Bifunctional purine biosynthesis protein PurH OS=Mycobacterium ulcerans (strain Agy99) GN=purH PE=3 SV=1 481 600 4.0E-07
sp|A9BIX9|PUR9_PETMO Bifunctional purine biosynthesis protein PurH OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=purH PE=3 SV=1 541 600 4.0E-07
sp|A4JBL5|PUR9_BURVG Bifunctional purine biosynthesis protein PurH OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=purH PE=3 SV=1 483 600 5.0E-07
sp|B2KCF7|PUR9_ELUMP Bifunctional purine biosynthesis protein PurH OS=Elusimicrobium minutum (strain Pei191) GN=purH PE=3 SV=1 546 600 5.0E-07
sp|Q8Y6C5|PUR9_LISMO Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purH PE=3 SV=1 537 600 5.0E-07
sp|B4S3H9|PUR9_PROA2 Bifunctional purine biosynthesis protein PurH OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=purH PE=3 SV=1 483 600 5.0E-07
sp|B9MS89|PUR9_CALBD Bifunctional purine biosynthesis protein PurH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=purH PE=3 SV=1 539 600 5.0E-07
sp|Q0SV48|PUR9_CLOPS Bifunctional purine biosynthesis protein PurH OS=Clostridium perfringens (strain SM101 / Type A) GN=purH PE=3 SV=1 541 600 5.0E-07
sp|Q116T4|PUR9_TRIEI Bifunctional purine biosynthesis protein PurH OS=Trichodesmium erythraeum (strain IMS101) GN=purH PE=3 SV=1 541 600 6.0E-07
sp|B1JVV6|PUR9_BURCC Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain MC0-3) GN=purH PE=3 SV=1 483 600 6.0E-07
sp|Q1BZ33|PUR9_BURCA Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain AU 1054) GN=purH PE=3 SV=1 483 600 6.0E-07
sp|A0K4L7|PUR9_BURCH Bifunctional purine biosynthesis protein PurH OS=Burkholderia cenocepacia (strain HI2424) GN=purH PE=3 SV=1 483 600 6.0E-07
sp|Q3B083|PUR9_SYNS9 Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain CC9902) GN=purH PE=3 SV=1 483 600 6.0E-07
sp|A1KTP9|PUR9_NEIMF Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=purH PE=3 SV=1 483 600 6.0E-07
sp|Q5F6T1|PUR9_NEIG1 Bifunctional purine biosynthesis protein PurH OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=purH PE=3 SV=1 483 600 6.0E-07
sp|B4RP71|PUR9_NEIG2 Bifunctional purine biosynthesis protein PurH OS=Neisseria gonorrhoeae (strain NCCP11945) GN=purH PE=3 SV=1 483 600 6.0E-07
sp|B2SYJ7|PUR9_BURPP Bifunctional purine biosynthesis protein PurH OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=purH PE=3 SV=1 476 600 7.0E-07
sp|A6SUQ1|PUR9_JANMA Bifunctional purine biosynthesis protein PurH OS=Janthinobacterium sp. (strain Marseille) GN=purH PE=3 SV=1 483 600 7.0E-07
sp|Q8DWK8|PUR9_STRMU Bifunctional purine biosynthesis protein PurH OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=purH PE=3 SV=2 538 600 7.0E-07
sp|B0JL55|PUR9_MICAN Bifunctional purine biosynthesis protein PurH OS=Microcystis aeruginosa (strain NIES-843) GN=purH PE=3 SV=1 545 600 8.0E-07
sp|B7GFU2|PUR9_ANOFW Bifunctional purine biosynthesis protein PurH OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=purH PE=3 SV=1 483 600 8.0E-07
sp|A7HA60|PUR9_ANADF Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter sp. (strain Fw109-5) GN=purH PE=3 SV=1 523 600 8.0E-07
sp|Q0BI80|PUR9_BURCM Bifunctional purine biosynthesis protein PurH OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=purH PE=3 SV=1 483 600 9.0E-07
sp|B1YTE2|PUR9_BURA4 Bifunctional purine biosynthesis protein PurH OS=Burkholderia ambifaria (strain MC40-6) GN=purH PE=3 SV=1 483 600 9.0E-07
sp|B5EBF9|PUR9_GEOBB Bifunctional purine biosynthesis protein PurH OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=purH PE=3 SV=1 539 600 9.0E-07
sp|A9M4I2|PUR9_NEIM0 Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup C (strain 053442) GN=purH PE=3 SV=1 483 600 9.0E-07
sp|Q13UC4|PUR9_BURXL Bifunctional purine biosynthesis protein PurH OS=Burkholderia xenovorans (strain LB400) GN=purH PE=3 SV=1 476 600 1.0E-06
sp|B0TEC5|PUR9_HELMI Bifunctional purine biosynthesis protein PurH OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=purH PE=3 SV=1 541 600 1.0E-06
sp|Q5FIV5|PUR9_LACAC Bifunctional purine biosynthesis protein PurH OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=purH PE=3 SV=1 540 600 1.0E-06
sp|O67775|PUR9_AQUAE Bifunctional purine biosynthesis protein PurH OS=Aquifex aeolicus (strain VF5) GN=purH PE=3 SV=1 483 600 1.0E-06
sp|Q7VDS0|PUR9_PROMA Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=purH PE=3 SV=1 483 600 1.0E-06
sp|A4G1U6|PUR9_HERAR Bifunctional purine biosynthesis protein PurH OS=Herminiimonas arsenicoxydans GN=purH PE=3 SV=1 483 600 1.0E-06
sp|A0AJL9|PUR9_LISW6 Bifunctional purine biosynthesis protein PurH OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=purH PE=3 SV=1 537 600 1.0E-06
sp|Q92AP3|PUR9_LISIN Bifunctional purine biosynthesis protein PurH OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purH PE=3 SV=1 537 600 1.0E-06
sp|Q04EU6|PUR9_OENOB Bifunctional purine biosynthesis protein PurH OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=purH PE=3 SV=1 534 600 1.0E-06
sp|Q7P0M1|PUR9_CHRVO Bifunctional purine biosynthesis protein PurH OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=purH PE=3 SV=1 539 600 2.0E-06
sp|C6E5Z3|PUR9_GEOSM Bifunctional purine biosynthesis protein PurH OS=Geobacter sp. (strain M21) GN=purH PE=3 SV=1 539 600 2.0E-06
sp|Q9KF53|PUR9_BACHD Bifunctional purine biosynthesis protein PurH OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purH PE=3 SV=1 538 600 2.0E-06
sp|Q049M1|PUR9_LACDB Bifunctional purine biosynthesis protein PurH OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=purH PE=3 SV=1 540 600 2.0E-06
sp|Q1G9G2|PUR9_LACDA Bifunctional purine biosynthesis protein PurH OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=purH PE=3 SV=1 540 600 2.0E-06
sp|Q9JZM7|PUR9_NEIMB Bifunctional purine biosynthesis protein PurH OS=Neisseria meningitidis serogroup B (strain MC58) GN=purH PE=3 SV=1 483 600 2.0E-06
sp|C1KW64|PUR9_LISMC Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=purH PE=3 SV=1 537 600 2.0E-06
sp|Q71YQ3|PUR9_LISMF Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purH PE=3 SV=1 537 600 2.0E-06
sp|B9EAZ2|PUR9_MACCJ Bifunctional purine biosynthesis protein PurH OS=Macrococcus caseolyticus (strain JCSC5402) GN=purH PE=3 SV=1 540 600 2.0E-06
sp|B9DQ42|PUR9_STACT Bifunctional purine biosynthesis protein PurH OS=Staphylococcus carnosus (strain TM300) GN=purH PE=3 SV=1 540 600 2.0E-06
sp|P9WHM7|PUR9_MYCTU Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purH PE=1 SV=1 481 600 2.0E-06
sp|P9WHM6|PUR9_MYCTO Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purH PE=3 SV=1 481 600 2.0E-06
sp|A5U0Z7|PUR9_MYCTA Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=purH PE=3 SV=1 481 600 2.0E-06
sp|C1ALU3|PUR9_MYCBT Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=purH PE=3 SV=1 481 600 2.0E-06
sp|A1KH91|PUR9_MYCBP Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=purH PE=3 SV=1 481 600 2.0E-06
sp|P67542|PUR9_MYCBO Bifunctional purine biosynthesis protein PurH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=purH PE=3 SV=1 481 600 2.0E-06
sp|A5N0Q0|PUR9_CLOK5 Bifunctional purine biosynthesis protein PurH OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=purH PE=3 SV=1 537 600 2.0E-06
sp|B9E4K6|PUR9_CLOK1 Bifunctional purine biosynthesis protein PurH OS=Clostridium kluyveri (strain NBRC 12016) GN=purH PE=3 SV=1 537 600 2.0E-06
sp|Q49WJ7|PUR9_STAS1 Bifunctional purine biosynthesis protein PurH OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purH PE=3 SV=1 540 600 3.0E-06
sp|Q6FYG4|PUR9_BARQU Bifunctional purine biosynthesis protein PurH OS=Bartonella quintana (strain Toulouse) GN=purH PE=3 SV=1 541 600 3.0E-06
sp|A6UED3|PUR9_SINMW Bifunctional purine biosynthesis protein PurH OS=Sinorhizobium medicae (strain WSM419) GN=purH PE=3 SV=1 541 600 3.0E-06
sp|Q92KX6|PUR9_RHIME Bifunctional purine biosynthesis protein PurH OS=Rhizobium meliloti (strain 1021) GN=purH PE=3 SV=1 541 600 3.0E-06
sp|B8DDZ2|PUR9_LISMH Bifunctional purine biosynthesis protein PurH OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=purH PE=3 SV=1 537 600 3.0E-06
sp|C0QXU6|PUR9_BRAHW Bifunctional purine biosynthesis protein PurH OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=purH PE=3 SV=1 537 600 3.0E-06
sp|Q3K3Z7|PUR9_STRA1 Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=purH PE=3 SV=1 539 600 3.0E-06
sp|P67546|PUR9_STRA5 Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=purH PE=3 SV=1 539 600 3.0E-06
sp|P67545|PUR9_STRA3 Bifunctional purine biosynthesis protein PurH OS=Streptococcus agalactiae serotype III (strain NEM316) GN=purH PE=3 SV=1 539 600 3.0E-06
sp|Q892X3|PUR9_CLOTE Bifunctional purine biosynthesis protein PurH OS=Clostridium tetani (strain Massachusetts / E88) GN=purH PE=3 SV=1 537 600 3.0E-06
sp|B1XS23|PUR9_POLNS Bifunctional purine biosynthesis protein PurH OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=purH PE=3 SV=1 483 600 4.0E-06
sp|B0BZH9|PUR9_ACAM1 Bifunctional purine biosynthesis protein PurH OS=Acaryochloris marina (strain MBIC 11017) GN=purH PE=3 SV=1 538 600 4.0E-06
sp|A2C098|PUR9_PROM1 Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain NATL1A) GN=purH PE=3 SV=1 538 600 4.0E-06
sp|Q46HA8|PUR9_PROMT Bifunctional purine biosynthesis protein PurH OS=Prochlorococcus marinus (strain NATL2A) GN=purH PE=3 SV=1 538 600 4.0E-06
sp|Q9KY50|PUR9_STRCO Bifunctional purine biosynthesis protein PurH OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=purH PE=3 SV=1 483 600 4.0E-06
sp|Q1J119|PUR9_DEIGD Bifunctional purine biosynthesis protein PurH OS=Deinococcus geothermalis (strain DSM 11300) GN=purH PE=3 SV=1 483 600 5.0E-06
sp|Q2IKQ7|PUR9_ANADE Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=purH PE=3 SV=1 541 600 5.0E-06
sp|B8JHC9|PUR9_ANAD2 Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=purH PE=3 SV=1 541 600 5.0E-06
sp|B4UJ61|PUR9_ANASK Bifunctional purine biosynthesis protein PurH OS=Anaeromyxobacter sp. (strain K) GN=purH PE=3 SV=1 541 600 5.0E-06
sp|B3QS62|PUR9_CHLT3 Bifunctional purine biosynthesis protein PurH OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=purH PE=3 SV=1 483 600 6.0E-06
sp|A5GIF4|PUR9_SYNPW Bifunctional purine biosynthesis protein PurH OS=Synechococcus sp. (strain WH7803) GN=purH PE=3 SV=1 483 600 6.0E-06
sp|Q1JJ80|PUR9_STRPD Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=purH PE=3 SV=1 539 600 7.0E-06
sp|A3QII0|PUR9_SHELP Bifunctional purine biosynthesis protein PurH OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=purH PE=3 SV=1 483 600 8.0E-06
sp|B5XJ20|PUR9_STRPZ Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=purH PE=3 SV=1 539 600 8.0E-06
sp|P0DD61|PUR9_STRPQ Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=purH PE=3 SV=1 539 600 8.0E-06
sp|P0DD60|PUR9_STRP3 Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=purH PE=3 SV=1 539 600 8.0E-06
sp|Q48VY9|PUR9_STRPM Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=purH PE=3 SV=1 539 600 8.0E-06
sp|Q1JP34|PUR9_STRPC Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=purH PE=3 SV=1 539 600 8.0E-06
sp|Q1JE78|PUR9_STRPB Bifunctional purine biosynthesis protein PurH OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=purH PE=3 SV=1 539 600 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003937 IMP cyclohydrolase activity Yes
GO:0004643 phosphoribosylaminoimidazolecarboxamide formyltransferase activity Yes
GO:0006164 purine nucleotide biosynthetic process Yes
GO:0016742 hydroxymethyl-, formyl- and related transferase activity No
GO:0019438 aromatic compound biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016787 hydrolase activity No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0006163 purine nucleotide metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003674 molecular_function No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines No
GO:0009117 nucleotide metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0019238 cyclohydrolase activity No
GO:0046483 heterocycle metabolic process No
GO:0090407 organophosphate biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|073750
MPQHIALLSVYDKTNLLDLAKGLQESGVRLLGSGGTAKKIRDAGIPIEDVSDITKAPEMLGGRVKTLHPAVHGGI
LARSIPSDEEDLKAQSISPISIVVCNLYPFTQTIAKPNCTLSDAIEEIDIGGVTLLRAAAKNHARVSILSDPVDY
DGFLAKWKEGKGDVGEGERAKLALKAFEQTAKYDEAISGYFRAQYASAELSAEKKFADVQRMVLRYGANPHQKPA
QAFVDEGNLPFKALCGSPGYINLLDALNSYALVRELQGALNLPAAASFKHVSPAGAAVGIELDEIEKKVYGVDDL
KEPLTPLAAAYARARGADRMSSFGDFVALSAPCDLATARIISREVSDGIIAPGYSPEALDVLRKKKSGKYCVLEM
DPSYDPPSVETKQVYGIFLQQKRNDAKIDSSLFSNLVSKNRHLTPEAITDLIVATLALKYTQSNSVAYAYHGAIV
GIGAGQQSRIHCTRLAGGKTDLWWLRHHPRVIDLPFKKGVKRADKANAIDLYVSGEELEGSEKSHWESLFEGRVE
DLSAGEKREWIRKLDGVACSSDAFFPFPDNVYRARKSGVKYLCAPGGSVMDDECIKAADELDMVFAHTELRLFHH
*
Coding >AgabiH97|073750
ATGCCTCAGCACATTGCTCTTTTATCGGTGTACGACAAGACTAATCTTCTAGATCTTGCGAAGGGTCTTCAAGAA
TCAGGTGTGCGATTGTTAGGGTCAGGGGGCACCGCAAAAAAAATCAGGGATGCTGGCATTCCCATCGAAGATGTT
TCTGATATCACAAAAGCCCCCGAAATGTTAGGTGGTCGTGTCAAAACTCTCCATCCAGCTGTTCACGGAGGCATC
CTGGCGCGTTCAATTCCGTCTGACGAAGAAGACCTCAAAGCCCAATCTATTTCTCCAATTTCCATCGTCGTCTGC
AACCTGTATCCTTTCACCCAAACCATTGCAAAACCCAACTGCACCTTGTCTGATGCAATTGAAGAAATTGATATC
GGAGGAGTTACCCTTCTTCGTGCGGCAGCCAAAAACCACGCTCGCGTATCTATATTATCCGACCCTGTCGATTAT
GATGGTTTTTTGGCCAAGTGGAAAGAAGGCAAAGGCGATGTCGGTGAGGGTGAGAGAGCAAAATTAGCGTTGAAG
GCGTTTGAACAGACTGCAAAGTATGATGAAGCTATTAGTGGATACTTCAGGGCACAATATGCTTCGGCAGAGTTA
AGTGCAGAGAAGAAATTTGCGGACGTACAGAGGATGGTGTTGAGATACGGCGCCAATCCTCATCAAAAACCAGCA
CAGGCATTTGTGGACGAGGGGAATTTACCGTTCAAGGCTCTCTGCGGATCGCCTGGTTATATTAACCTGCTCGAC
GCCTTGAATTCTTACGCGTTGGTGAGAGAACTCCAAGGAGCTCTGAATCTCCCCGCTGCCGCGTCGTTCAAGCAT
GTTTCTCCTGCTGGTGCTGCCGTTGGAATTGAACTCGACGAGATCGAAAAGAAGGTCTATGGTGTTGATGATCTC
AAGGAGCCTCTGACACCTCTTGCTGCCGCATATGCTCGTGCTCGTGGTGCTGATCGTATGTCTTCTTTCGGAGAC
TTTGTCGCCCTCTCGGCTCCTTGCGATCTCGCGACTGCTCGCATTATTTCTCGAGAAGTCTCCGATGGAATAATC
GCTCCCGGATATTCGCCTGAAGCCCTTGACGTCCTCAGAAAAAAGAAGTCTGGGAAGTATTGTGTTCTCGAGATG
GATCCCTCGTATGATCCTCCTTCCGTAGAGACCAAACAAGTTTACGGCATCTTCCTCCAGCAAAAACGCAATGAT
GCCAAAATCGACTCCTCACTCTTCTCAAATCTCGTCTCCAAAAACAGACACCTCACACCAGAAGCTATTACAGAT
TTGATCGTAGCCACCCTCGCACTCAAATACACTCAGTCCAACAGTGTTGCCTATGCTTATCATGGGGCTATTGTT
GGCATCGGTGCGGGACAACAATCGAGAATTCATTGCACTCGTCTCGCAGGAGGCAAAACCGATCTATGGTGGCTC
CGTCATCATCCTCGTGTCATCGACTTACCATTCAAAAAAGGAGTTAAGAGGGCGGACAAAGCGAATGCAATTGAT
CTATATGTATCTGGTGAAGAGCTTGAAGGTTCGGAGAAAAGTCATTGGGAATCTTTGTTTGAAGGTAGGGTAGAG
GATTTGAGTGCGGGAGAGAAGAGGGAGTGGATTAGGAAGCTGGATGGAGTAGCTTGTTCAAGTGATGCATTTTTC
CCGTTCCCGGATAACGTCTATAGAGCGAGGAAGAGTGGTGTCAAGTATCTTTGTGCACCTGGTGGAAGTGTGATG
GATGATGAGTGTATAAAGGCGGCGGATGAACTGGACATGGTATTTGCCCATACTGAACTCCGGTTATTCCATCAT
TAG
Transcript >AgabiH97|073750
ATGCCTCAGCACATTGCTCTTTTATCGGTGTACGACAAGACTAATCTTCTAGATCTTGCGAAGGGTCTTCAAGAA
TCAGGTGTGCGATTGTTAGGGTCAGGGGGCACCGCAAAAAAAATCAGGGATGCTGGCATTCCCATCGAAGATGTT
TCTGATATCACAAAAGCCCCCGAAATGTTAGGTGGTCGTGTCAAAACTCTCCATCCAGCTGTTCACGGAGGCATC
CTGGCGCGTTCAATTCCGTCTGACGAAGAAGACCTCAAAGCCCAATCTATTTCTCCAATTTCCATCGTCGTCTGC
AACCTGTATCCTTTCACCCAAACCATTGCAAAACCCAACTGCACCTTGTCTGATGCAATTGAAGAAATTGATATC
GGAGGAGTTACCCTTCTTCGTGCGGCAGCCAAAAACCACGCTCGCGTATCTATATTATCCGACCCTGTCGATTAT
GATGGTTTTTTGGCCAAGTGGAAAGAAGGCAAAGGCGATGTCGGTGAGGGTGAGAGAGCAAAATTAGCGTTGAAG
GCGTTTGAACAGACTGCAAAGTATGATGAAGCTATTAGTGGATACTTCAGGGCACAATATGCTTCGGCAGAGTTA
AGTGCAGAGAAGAAATTTGCGGACGTACAGAGGATGGTGTTGAGATACGGCGCCAATCCTCATCAAAAACCAGCA
CAGGCATTTGTGGACGAGGGGAATTTACCGTTCAAGGCTCTCTGCGGATCGCCTGGTTATATTAACCTGCTCGAC
GCCTTGAATTCTTACGCGTTGGTGAGAGAACTCCAAGGAGCTCTGAATCTCCCCGCTGCCGCGTCGTTCAAGCAT
GTTTCTCCTGCTGGTGCTGCCGTTGGAATTGAACTCGACGAGATCGAAAAGAAGGTCTATGGTGTTGATGATCTC
AAGGAGCCTCTGACACCTCTTGCTGCCGCATATGCTCGTGCTCGTGGTGCTGATCGTATGTCTTCTTTCGGAGAC
TTTGTCGCCCTCTCGGCTCCTTGCGATCTCGCGACTGCTCGCATTATTTCTCGAGAAGTCTCCGATGGAATAATC
GCTCCCGGATATTCGCCTGAAGCCCTTGACGTCCTCAGAAAAAAGAAGTCTGGGAAGTATTGTGTTCTCGAGATG
GATCCCTCGTATGATCCTCCTTCCGTAGAGACCAAACAAGTTTACGGCATCTTCCTCCAGCAAAAACGCAATGAT
GCCAAAATCGACTCCTCACTCTTCTCAAATCTCGTCTCCAAAAACAGACACCTCACACCAGAAGCTATTACAGAT
TTGATCGTAGCCACCCTCGCACTCAAATACACTCAGTCCAACAGTGTTGCCTATGCTTATCATGGGGCTATTGTT
GGCATCGGTGCGGGACAACAATCGAGAATTCATTGCACTCGTCTCGCAGGAGGCAAAACCGATCTATGGTGGCTC
CGTCATCATCCTCGTGTCATCGACTTACCATTCAAAAAAGGAGTTAAGAGGGCGGACAAAGCGAATGCAATTGAT
CTATATGTATCTGGTGAAGAGCTTGAAGGTTCGGAGAAAAGTCATTGGGAATCTTTGTTTGAAGGTAGGGTAGAG
GATTTGAGTGCGGGAGAGAAGAGGGAGTGGATTAGGAAGCTGGATGGAGTAGCTTGTTCAAGTGATGCATTTTTC
CCGTTCCCGGATAACGTCTATAGAGCGAGGAAGAGTGGTGTCAAGTATCTTTGTGCACCTGGTGGAAGTGTGATG
GATGATGAGTGTATAAAGGCGGCGGATGAACTGGACATGGTATTTGCCCATACTGAACTCCGGTTATTCCATCAT
TAG
Gene >AgabiH97|073750
ATGCCTCAGCACATTGGTATGTGCGACGTATAAAACTTTCGAAATGCAATTCAATAACACCAACAGCTCTTTTAT
CGGTGTACGACAAGACTAATCTTCTAGATCTTGCGAAGGGTCTTCAAGAATCAGGTGTGCGATTGTTAGGGTCAG
GGGGCACCGCAAAAAAAATCAGGGATGCTGGCATTCCCATCGAGTTCGTCTTTTTCCGCATAGTATCCAATTTAC
GTGACTATATTCCTGCAGAGATGTTTCTGATATCACAAAAGCCCCCGAAATGTTAGGTGGTCGTGTCAAAACTCT
CCATCCAGCTGTTCACGGAGGTTAGTACGGCGTAACTCATTCACGGTATACGATGAGAACTTCACTATTTTATCT
ATTTTATCAAGGCATCCTGGCGCGTTCAATTCCGTCTGACGAAGAAGACCTCAAAGCCCAATCTATTTCTCCAAT
TTCCATCGTCGTCTGCAACCTGTATCCTTTCACCCAAACCATTGCAAAACCCAACTGCACCTTGTCTGATGCAAT
TGAAGAAATTGATATCGGAGGAGTTACCCTTCTTCGTGCGGCAGCCAAAAACCACGCTCGCGTATCTATATTATC
CGACCCTGTCGATTATGATGGTTTTTTGGCCAAGTGGAAAGAAGGCAAAGGCGATGTCGGTGAGGGTGAGAGAGC
AAAATTAGCGTTGAAGGCGTTTGAACAGACTGCAAAGTATGATGAAGCTATTAGTGGATACTTCAGGGCACAATA
TGCTTCGGCAGAGTTAAGTGCAGAGAAGAAATTTGCGGACGTACAGAGGATGGTGTTGAGATACGGCGCCAATCC
TCATCAAAAACCAGCACAGGCATTTGTGGACGAGGGGAATTTACCGTTCAAGGGTAGGTGATTTACCTGAGCAGT
TAGCGAACCACTAATGTTAGTTAGCTCTCTGCGGATCGCCTGGTTATATTAACCTGCTCGACGCCTTGAATTCTT
ACGCGTTGGTGAGAGAACTCCAAGGAGCTCTGAATCTCCCCGCTGCCGCGTCGTTCAAGCATGTTTCTCCTGCTG
GTGCTGCCGTTGGAATTGAACTCGACGAGATCGAAAAGAAGGTCTATGGTGTTGATGATCTCAAGGAGCCTCTGA
CACCTCTTGCTGCCGCATATGCTCGTGCTCGTGGTACGGCTGTTGTCGTTTTCTTTGTATGTTTATCCCAACCTA
ACGAGAGTATTATCCAGGTGCTGATCGTATGTCTTCTTTCGGAGACTTTGTCGCCCTCTCGGCTCCTTGCGATCT
CGCGACTGCTCGCATTATTTCTCGAGAAGTCTCCGATGGAATAATCGCTCCCGGATATTCGCCTGAAGCCCTTGA
CGTCCTCAGAAAAAAGAAGTCTGGGAAGTATTGTGTTCTCGAGGTTTGTCCGGGCTATAATAACCCTGTACATGA
TTTATTCTTGACCCTATGAACATCCTAGATGGATCCCTCGTATGATCCTCCTTCCGTAGAGACCAAACAAGTTTA
CGGCATCTTCCTCCAGCAAAAACGCAATGATGCCAAAATCGACTCCTCACTCTTCTCAAATCTCGTCTCCAAAAA
CAGACACCTCACACCAGAAGCTATTACAGATTTGATCGTAGCCACCCTCGCACTCAAATACACTCAGTCCAACAG
TGTTGCCTATGCTTATCATGGGGCTATTGTTGGCATCGGTGCGGGACAACAATCGAGAATTCATTGCACTCGTCT
CGCAGGAGGCAAAACCGATCTATGGTGGCTCCGTCATCATCCTCGTGTCATCGACTTACCATTCAAAAAAGGAGT
TAAGAGGGCGGACAAAGCGAATGCAATTGATCTATATGTATCTGGTGAAGAGCTTGAAGGTTCGGAGAAAAGTCA
TTGGGAATCTTTGTTTGAAGGTAGGGTAGAGGATTTGAGTGCGGGAGAGAAGAGGGAGTGGATTAGGAAGCTGGA
TGGAGTAGCTTGTTCAAGTGATGCATTTTTCCCGTTCCCGGATAACGTCTATAGAGCGAGGAAGAGTGGTGTCAA
GTATCTTTGTGCACCTGGTGGAAGTGTGATGGATGATGAGTGTATAAAGGCGGCGGATGAACTGGACATGGTATT
TGCCCATACTGAACTCCGGTTATTCCATCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail