Protein ID | AgabiH97|073630 |
Gene name | |
Location | scaffold_4:1983663..1985157 |
Strand | - |
Gene length (bp) | 1494 |
Transcript length (bp) | 1236 |
Coding sequence length (bp) | 1236 |
Protein length (aa) | 412 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00108 | Thiolase_N | Thiolase, N-terminal domain | 1.4E-89 | 28 | 282 |
PF02803 | Thiolase_C | Thiolase, C-terminal domain | 1.5E-38 | 290 | 410 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q6AZA0|THIL_DANRE | Acetyl-CoA acetyltransferase, mitochondrial OS=Danio rerio GN=acat1 PE=2 SV=1 | 11 | 411 | 1.0E-149 |
sp|Q6GN02|THILB_XENLA | Acetyl-CoA acetyltransferase B, mitochondrial OS=Xenopus laevis GN=acat1-b PE=2 SV=1 | 27 | 411 | 1.0E-147 |
sp|P24752|THIL_HUMAN | Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens GN=ACAT1 PE=1 SV=1 | 2 | 411 | 2.0E-147 |
sp|Q6NU46|THILA_XENLA | Acetyl-CoA acetyltransferase A, mitochondrial OS=Xenopus laevis GN=acat1-a PE=2 SV=1 | 27 | 411 | 5.0E-147 |
sp|Q8HXY6|THIL_MACFA | Acetyl-CoA acetyltransferase, mitochondrial OS=Macaca fascicularis GN=ACAT1 PE=2 SV=1 | 2 | 411 | 7.0E-147 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q6AZA0|THIL_DANRE | Acetyl-CoA acetyltransferase, mitochondrial OS=Danio rerio GN=acat1 PE=2 SV=1 | 11 | 411 | 1.0E-149 |
sp|Q6GN02|THILB_XENLA | Acetyl-CoA acetyltransferase B, mitochondrial OS=Xenopus laevis GN=acat1-b PE=2 SV=1 | 27 | 411 | 1.0E-147 |
sp|P24752|THIL_HUMAN | Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens GN=ACAT1 PE=1 SV=1 | 2 | 411 | 2.0E-147 |
sp|Q6NU46|THILA_XENLA | Acetyl-CoA acetyltransferase A, mitochondrial OS=Xenopus laevis GN=acat1-a PE=2 SV=1 | 27 | 411 | 5.0E-147 |
sp|Q8HXY6|THIL_MACFA | Acetyl-CoA acetyltransferase, mitochondrial OS=Macaca fascicularis GN=ACAT1 PE=2 SV=1 | 2 | 411 | 7.0E-147 |
sp|Q8QZT1|THIL_MOUSE | Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus GN=Acat1 PE=1 SV=1 | 2 | 411 | 2.0E-145 |
sp|Q29RZ0|THIL_BOVIN | Acetyl-CoA acetyltransferase, mitochondrial OS=Bos taurus GN=ACAT1 PE=2 SV=1 | 2 | 411 | 4.0E-145 |
sp|Q5BKN8|THIL_XENTR | Acetyl-CoA acetyltransferase, mitochondrial OS=Xenopus tropicalis GN=acat1 PE=2 SV=1 | 27 | 411 | 2.0E-144 |
sp|P17764|THIL_RAT | Acetyl-CoA acetyltransferase, mitochondrial OS=Rattus norvegicus GN=Acat1 PE=1 SV=1 | 2 | 411 | 2.0E-141 |
sp|Q22100|THILH_CAEEL | Acetyl-CoA acetyltransferase homolog, mitochondrial OS=Caenorhabditis elegans GN=kat-1 PE=1 SV=2 | 15 | 411 | 8.0E-138 |
sp|Q6L8K7|THIL_YARLI | Acetyl-CoA acetyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAT1 PE=3 SV=1 | 30 | 411 | 1.0E-131 |
sp|Q9UQW6|THIL_SCHPO | Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg10 PE=2 SV=1 | 27 | 411 | 4.0E-131 |
sp|Q86AD9|THIL1_DICDI | Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum GN=DDB_G0271544 PE=2 SV=1 | 24 | 411 | 5.0E-131 |
sp|Q9FIK7|THIC2_ARATH | Probable acetyl-CoA acetyltransferase, cytosolic 2 OS=Arabidopsis thaliana GN=At5g47720 PE=2 SV=1 | 24 | 409 | 8.0E-129 |
sp|Q8S4Y1|THIC1_ARATH | Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabidopsis thaliana GN=AAT1 PE=2 SV=1 | 27 | 411 | 8.0E-123 |
sp|Q04677|THIB_CANTR | Acetyl-CoA acetyltransferase IB OS=Candida tropicalis GN=PACTB PE=1 SV=3 | 25 | 411 | 6.0E-122 |
sp|Q12598|THIA_CANTR | Acetyl-CoA acetyltransferase IA OS=Candida tropicalis GN=PACTA PE=1 SV=3 | 25 | 411 | 3.0E-121 |
sp|P41338|THIL_YEAST | Acetyl-CoA acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG10 PE=1 SV=3 | 22 | 411 | 1.0E-120 |
sp|P44873|ATOB_HAEIN | Acetyl-CoA acetyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atoB PE=3 SV=1 | 25 | 411 | 3.0E-116 |
sp|P45359|THLA_CLOAB | Acetyl-CoA acetyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thlA PE=1 SV=1 | 25 | 410 | 2.0E-111 |
sp|P10551|THIL_SACMO | Acetyl-CoA acetyltransferase OS=Saccharomyces pastorianus (strain ATCC 76670 / Carlsberg bottom yeast no.2 / CBS 1503 / CLIB 180 / NBRC 10610 / NRRL Y-1525) GN=ERG10 PE=3 SV=1 | 22 | 411 | 5.0E-111 |
sp|Q18AR0|THLA_PEPD6 | Acetyl-CoA acetyltransferase OS=Peptoclostridium difficile (strain 630) GN=thlA PE=1 SV=1 | 27 | 410 | 1.0E-108 |
sp|Q8CQN7|THLA_STAES | Probable acetyl-CoA acyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2384 PE=3 SV=1 | 28 | 410 | 7.0E-107 |
sp|Q5HS07|THLA_STAEQ | Probable acetyl-CoA acyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0032 PE=3 SV=1 | 28 | 410 | 7.0E-107 |
sp|P14611|THIL_CUPNH | Acetyl-CoA acetyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbA PE=1 SV=1 | 25 | 410 | 6.0E-102 |
sp|Q5HIU0|THLA_STAAC | Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain COL) GN=SACOL0426 PE=3 SV=1 | 28 | 410 | 2.0E-100 |
sp|P45369|THIL_ALLVD | Acetyl-CoA acetyltransferase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbA PE=3 SV=2 | 28 | 411 | 2.0E-100 |
sp|Q9I2A8|ATOB_PSEAE | Acetyl-CoA acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atoB PE=3 SV=1 | 25 | 410 | 5.0E-100 |
sp|Q2G124|THLA_STAA8 | Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00336 PE=3 SV=1 | 28 | 410 | 6.0E-100 |
sp|Q2FJQ9|THLA_STAA3 | Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0355 PE=3 SV=1 | 28 | 410 | 6.0E-100 |
sp|Q6GJW4|THLA_STAAR | Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0351 PE=3 SV=1 | 28 | 410 | 1.0E-99 |
sp|Q7A7L2|THLA_STAAN | Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain N315) GN=SA0342 PE=1 SV=1 | 28 | 410 | 1.0E-99 |
sp|Q99WM3|THLA_STAAM | Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0354 PE=3 SV=1 | 28 | 410 | 1.0E-99 |
sp|Q8NY95|THLA_STAAW | Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain MW2) GN=MW0330 PE=3 SV=1 | 28 | 410 | 2.0E-99 |
sp|Q6GCB8|THLA_STAAS | Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0330 PE=3 SV=1 | 28 | 410 | 2.0E-99 |
sp|Q2YVF5|THLA_STAAB | Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0304 PE=3 SV=1 | 28 | 410 | 4.0E-99 |
sp|P54810|THIL_PARDE | Acetyl-CoA acetyltransferase OS=Paracoccus denitrificans GN=phaA PE=3 SV=1 | 25 | 410 | 3.0E-97 |
sp|P45855|THL_BACSU | Acetyl-CoA acetyltransferase OS=Bacillus subtilis (strain 168) GN=mmgA PE=2 SV=2 | 27 | 409 | 5.0E-97 |
sp|Q9ZHI1|THIL_CHRVO | Acetyl-CoA acetyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=phaA PE=3 SV=2 | 27 | 410 | 1.0E-96 |
sp|Q8CAY6|THIC_MOUSE | Acetyl-CoA acetyltransferase, cytosolic OS=Mus musculus GN=Acat2 PE=1 SV=2 | 28 | 410 | 1.0E-95 |
sp|Q5XI22|THIC_RAT | Acetyl-CoA acetyltransferase, cytosolic OS=Rattus norvegicus GN=Acat2 PE=1 SV=1 | 28 | 410 | 4.0E-95 |
sp|P76461|ATOB_ECOLI | Acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) GN=atoB PE=1 SV=1 | 25 | 411 | 9.0E-95 |
sp|P45363|THIL_THIVI | Acetyl-CoA acetyltransferase OS=Thiocystis violacea GN=phbA PE=3 SV=1 | 28 | 411 | 1.0E-94 |
sp|P50174|THIL_RHIME | Acetyl-CoA acetyltransferase OS=Rhizobium meliloti (strain 1021) GN=phbA PE=3 SV=1 | 26 | 411 | 4.0E-93 |
sp|Q46939|YQEF_ECOLI | Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) GN=yqeF PE=3 SV=2 | 25 | 410 | 6.0E-93 |
sp|Q9BWD1|THIC_HUMAN | Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens GN=ACAT2 PE=1 SV=2 | 28 | 410 | 8.0E-92 |
sp|A0R1Y7|FADA4_MYCS2 | Probable acetyl-CoA acetyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_4920 PE=1 SV=2 | 29 | 410 | 2.0E-91 |
sp|P07097|THIL_ZOORA | Acetyl-CoA acetyltransferase OS=Zoogloea ramigera GN=phbA PE=1 SV=4 | 26 | 411 | 3.0E-88 |
sp|Q8BWT1|THIM_MOUSE | 3-ketoacyl-CoA thiolase, mitochondrial OS=Mus musculus GN=Acaa2 PE=1 SV=3 | 22 | 409 | 4.0E-83 |
sp|P46707|FADA4_MYCLE | Probable acetyl-CoA acetyltransferase OS=Mycobacterium leprae (strain TN) GN=fadA4 PE=3 SV=1 | 29 | 409 | 1.0E-82 |
sp|P42765|THIM_HUMAN | 3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens GN=ACAA2 PE=1 SV=2 | 22 | 409 | 2.0E-82 |
sp|P13437|THIM_RAT | 3-ketoacyl-CoA thiolase, mitochondrial OS=Rattus norvegicus GN=Acaa2 PE=2 SV=1 | 22 | 409 | 2.0E-81 |
sp|P9WG69|FADA4_MYCTU | Probable acetyl-CoA acetyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadA4 PE=1 SV=1 | 29 | 409 | 3.0E-81 |
sp|P9WG68|FADA4_MYCTO | Probable acetyl-CoA acetyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadA4 PE=3 SV=1 | 29 | 409 | 3.0E-81 |
sp|P66927|FADA4_MYCBO | Probable acetyl-CoA acetyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadA4 PE=3 SV=1 | 29 | 409 | 3.0E-81 |
sp|Q5RES5|THIM_PONAB | 3-ketoacyl-CoA thiolase, mitochondrial OS=Pongo abelii GN=ACAA2 PE=2 SV=1 | 22 | 409 | 4.0E-81 |
sp|Q0KBP1|BKTB_CUPNH | Beta-ketothiolase BktB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=bktB PE=1 SV=1 | 27 | 411 | 4.0E-80 |
sp|Q3T0R7|THIM_BOVIN | 3-ketoacyl-CoA thiolase, mitochondrial OS=Bos taurus GN=ACAA2 PE=2 SV=1 | 22 | 409 | 1.0E-79 |
sp|Q9I6R0|PCAF_PSEAE | Beta-ketoadipyl-CoA thiolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaF PE=3 SV=1 | 27 | 411 | 8.0E-72 |
sp|Q8VPF1|PCAF_PSEKB | Beta-ketoadipyl-CoA thiolase OS=Pseudomonas knackmussii (strain DSM 6978 / LMG 23759 / B13) GN=pcaF PE=1 SV=1 | 27 | 411 | 4.0E-71 |
sp|Q8SVA6|THIK_ENCCU | 3-ketoacyl-CoA thiolase, peroxisomal OS=Encephalitozoon cuniculi (strain GB-M1) GN=FOX3 PE=1 SV=1 | 27 | 410 | 2.0E-69 |
sp|P33291|THIKB_CANTR | 3-ketoacyl-CoA thiolase B, peroxisomal OS=Candida tropicalis PE=3 SV=1 | 27 | 410 | 3.0E-69 |
sp|O32177|FADA_BACSU | 3-ketoacyl-CoA thiolase OS=Bacillus subtilis (strain 168) GN=fadA PE=2 SV=1 | 25 | 409 | 4.0E-69 |
sp|P0C7L2|PAAJ_ECOLI | 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase OS=Escherichia coli (strain K12) GN=paaJ PE=1 SV=1 | 27 | 411 | 2.0E-68 |
sp|P0C7L3|PAAJ_ECOLX | Beta-ketoadipyl-CoA thiolase OS=Escherichia coli GN=paaJ PE=3 SV=1 | 27 | 411 | 6.0E-68 |
sp|B6EGU1|FADA_ALISL | 3-ketoacyl-CoA thiolase OS=Aliivibrio salmonicida (strain LFI1238) GN=fadA PE=3 SV=1 | 25 | 410 | 9.0E-68 |
sp|P09110|THIK_HUMAN | 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens GN=ACAA1 PE=1 SV=2 | 27 | 409 | 8.0E-67 |
sp|P21775|THIKA_RAT | 3-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus norvegicus GN=Acaa1a PE=1 SV=2 | 27 | 409 | 2.0E-66 |
sp|P07871|THIKB_RAT | 3-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus norvegicus GN=Acaa1b PE=1 SV=2 | 27 | 409 | 6.0E-66 |
sp|Q8VCH0|THIKB_MOUSE | 3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus GN=Acaa1b PE=1 SV=1 | 27 | 409 | 2.0E-65 |
sp|Q921H8|THIKA_MOUSE | 3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus GN=Acaa1a PE=1 SV=1 | 27 | 409 | 3.0E-65 |
sp|B5FEW7|FADA_VIBFM | 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain MJ11) GN=fadA PE=3 SV=1 | 25 | 410 | 6.0E-65 |
sp|Q5E8X7|FADA_VIBF1 | 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadA PE=3 SV=2 | 25 | 410 | 6.0E-65 |
sp|P33290|THIKA_CANTR | 3-ketoacyl-CoA thiolase A, peroxisomal OS=Candida tropicalis PE=3 SV=1 | 27 | 410 | 9.0E-64 |
sp|Q43974|PCAF_ACIAD | Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaF PE=1 SV=1 | 30 | 411 | 1.0E-63 |
sp|Q43935|CATF_ACIAD | Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catF PE=3 SV=1 | 30 | 411 | 3.0E-63 |
sp|Q0VNZ7|FADA_ALCBS | 3-ketoacyl-CoA thiolase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=fadA PE=3 SV=1 | 27 | 411 | 6.0E-63 |
sp|Q51956|PCAF_PSEPU | Beta-ketoadipyl-CoA thiolase OS=Pseudomonas putida GN=pcaF PE=3 SV=1 | 27 | 411 | 7.0E-63 |
sp|Q2SD23|FADA_HAHCH | 3-ketoacyl-CoA thiolase OS=Hahella chejuensis (strain KCTC 2396) GN=fadA PE=3 SV=1 | 27 | 411 | 1.0E-61 |
sp|A1TZR8|FADA_MARHV | 3-ketoacyl-CoA thiolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=fadA PE=3 SV=1 | 42 | 411 | 3.0E-61 |
sp|Q56WD9|THIK2_ARATH | 3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana GN=PED1 PE=1 SV=2 | 27 | 410 | 7.0E-60 |
sp|B2VFE0|FADA_ERWT9 | 3-ketoacyl-CoA thiolase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-59 |
sp|Q8LF48|THIK1_ARATH | 3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana GN=KAT1 PE=2 SV=2 | 27 | 410 | 9.0E-59 |
sp|A6VVM8|FADA_MARMS | 3-ketoacyl-CoA thiolase OS=Marinomonas sp. (strain MWYL1) GN=fadA PE=3 SV=1 | 27 | 411 | 9.0E-59 |
sp|Q9F0Y6|FADA_ENTCL | 3-ketoacyl-CoA thiolase OS=Enterobacter cloacae GN=fadA PE=3 SV=1 | 25 | 411 | 3.0E-58 |
sp|A6TGM3|FADA_KLEP7 | 3-ketoacyl-CoA thiolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadA PE=3 SV=1 | 25 | 411 | 3.0E-58 |
sp|A8G8D0|FADA_SERP5 | 3-ketoacyl-CoA thiolase OS=Serratia proteamaculans (strain 568) GN=fadA PE=3 SV=1 | 25 | 411 | 1.0E-57 |
sp|Q5QXH8|FADA_IDILO | 3-ketoacyl-CoA thiolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadA PE=3 SV=1 | 25 | 411 | 1.0E-57 |
sp|P0A2H7|FADA_SALTY | 3-ketoacyl-CoA thiolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadA PE=1 SV=1 | 25 | 411 | 2.0E-57 |
sp|P0A2H8|FADA_SALTI | 3-ketoacyl-CoA thiolase OS=Salmonella typhi GN=fadA PE=3 SV=1 | 25 | 411 | 2.0E-57 |
sp|Q5PKQ3|FADA_SALPA | 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadA PE=3 SV=1 | 25 | 411 | 2.0E-57 |
sp|Q1Q8K0|FADA_PSYCK | 3-ketoacyl-CoA thiolase OS=Psychrobacter cryohalolentis (strain K5) GN=fadA PE=3 SV=1 | 27 | 411 | 2.0E-57 |
sp|Q8X8J4|FADA_ECO57 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O157:H7 GN=fadA PE=3 SV=1 | 25 | 411 | 2.0E-57 |
sp|Q6DAP6|FADA_PECAS | 3-ketoacyl-CoA thiolase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadA PE=3 SV=1 | 25 | 410 | 2.0E-57 |
sp|A7ZU50|FADA_ECO24 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-57 |
sp|Q57HM7|FADA_SALCH | 3-ketoacyl-CoA thiolase OS=Salmonella choleraesuis (strain SC-B67) GN=fadA PE=3 SV=1 | 25 | 411 | 5.0E-57 |
sp|Q4FQC7|FADA_PSYA2 | 3-ketoacyl-CoA thiolase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-57 |
sp|Q3IJ24|FADA_PSEHT | 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fadA PE=3 SV=1 | 29 | 411 | 8.0E-57 |
sp|Q6LW07|FADA_PHOPR | 3-ketoacyl-CoA thiolase OS=Photobacterium profundum GN=fadA PE=3 SV=1 | 28 | 411 | 9.0E-57 |
sp|B7LTZ0|FADA_ESCF3 | 3-ketoacyl-CoA thiolase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadA PE=3 SV=1 | 25 | 411 | 1.0E-56 |
sp|A7MQM5|FADA_CROS8 | 3-ketoacyl-CoA thiolase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadA PE=3 SV=1 | 25 | 411 | 1.0E-56 |
sp|Q32A20|FADA_SHIDS | 3-ketoacyl-CoA thiolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadA PE=3 SV=1 | 25 | 411 | 2.0E-56 |
sp|Q31UE3|FADA_SHIBS | 3-ketoacyl-CoA thiolase OS=Shigella boydii serotype 4 (strain Sb227) GN=fadA PE=3 SV=1 | 25 | 411 | 2.0E-56 |
sp|A4STF3|FADA_AERS4 | 3-ketoacyl-CoA thiolase OS=Aeromonas salmonicida (strain A449) GN=fadA PE=3 SV=1 | 25 | 411 | 2.0E-56 |
sp|A1AI32|FADA_ECOK1 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O1:K1 / APEC GN=fadA PE=3 SV=1 | 25 | 411 | 2.0E-56 |
sp|Q1R467|FADA_ECOUT | 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain UTI89 / UPEC) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-56 |
sp|Q570C8|THIK5_ARATH | 3-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidopsis thaliana GN=KAT5 PE=2 SV=2 | 27 | 410 | 4.0E-56 |
sp|Q3K9D9|FADA_PSEPF | 3-ketoacyl-CoA thiolase OS=Pseudomonas fluorescens (strain Pf0-1) GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-56 |
sp|A8ACZ3|FADA_CITK8 | 3-ketoacyl-CoA thiolase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadA PE=3 SV=1 | 25 | 411 | 6.0E-56 |
sp|A8A6V0|FADA_ECOHS | 3-ketoacyl-CoA thiolase OS=Escherichia coli O9:H4 (strain HS) GN=fadA PE=3 SV=1 | 25 | 411 | 8.0E-56 |
sp|Q3YVC2|FADA_SHISS | 3-ketoacyl-CoA thiolase OS=Shigella sonnei (strain Ss046) GN=fadA PE=3 SV=1 | 25 | 411 | 9.0E-56 |
sp|A1JIG3|FADA_YERE8 | 3-ketoacyl-CoA thiolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadA PE=3 SV=1 | 25 | 411 | 1.0E-55 |
sp|C6DI66|FADA_PECCP | 3-ketoacyl-CoA thiolase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadA PE=3 SV=1 | 25 | 411 | 1.0E-55 |
sp|A0KEL0|FADA_AERHH | 3-ketoacyl-CoA thiolase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadA PE=3 SV=1 | 25 | 411 | 1.0E-55 |
sp|Q4KFC3|FADA_PSEF5 | 3-ketoacyl-CoA thiolase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fadA PE=3 SV=1 | 27 | 411 | 3.0E-55 |
sp|Q0TAL1|FADA_ECOL5 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadA PE=3 SV=1 | 25 | 411 | 3.0E-55 |
sp|Q66FR9|FADA_YERPS | 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-55 |
sp|A4TR28|FADA_YERPP | 3-ketoacyl-CoA thiolase OS=Yersinia pestis (strain Pestoides F) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-55 |
sp|Q1CNA0|FADA_YERPN | 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-55 |
sp|Q8ZAM9|FADA_YERPE | 3-ketoacyl-CoA thiolase OS=Yersinia pestis GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-55 |
sp|Q1C2C3|FADA_YERPA | 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-55 |
sp|A7FDF1|FADA_YERP3 | 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-55 |
sp|Q8FBI3|FADA_ECOL6 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-55 |
sp|Q83PG2|FADA_SHIFL | 3-ketoacyl-CoA thiolase OS=Shigella flexneri GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-55 |
sp|Q0SZ35|FADA_SHIF8 | 3-ketoacyl-CoA thiolase OS=Shigella flexneri serotype 5b (strain 8401) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-55 |
sp|P21151|FADA_ECOLI | 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12) GN=fadA PE=1 SV=3 | 25 | 411 | 5.0E-55 |
sp|A5WH98|FADA_PSYWF | 3-ketoacyl-CoA thiolase OS=Psychrobacter sp. (strain PRwf-1) GN=fadA PE=3 SV=1 | 27 | 411 | 6.0E-55 |
sp|Q87ZB3|FADA_PSESM | 3-ketoacyl-CoA thiolase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadA PE=3 SV=1 | 27 | 411 | 6.0E-55 |
sp|A4WFX5|FADA_ENT38 | 3-ketoacyl-CoA thiolase OS=Enterobacter sp. (strain 638) GN=fadA PE=3 SV=1 | 25 | 411 | 1.0E-54 |
sp|Q7MZ91|FADA_PHOLL | 3-ketoacyl-CoA thiolase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadA PE=3 SV=1 | 25 | 411 | 2.0E-54 |
sp|P28790|FADA_PSEFR | 3-ketoacyl-CoA thiolase OS=Pseudomonas fragi GN=fadA PE=1 SV=2 | 27 | 411 | 3.0E-54 |
sp|Q48GW4|FADA_PSE14 | 3-ketoacyl-CoA thiolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-54 |
sp|Q4ZRA1|FADA_PSEU2 | 3-ketoacyl-CoA thiolase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-54 |
sp|Q9HZJ3|FADA_PSEAE | 3-ketoacyl-CoA thiolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadA PE=3 SV=1 | 27 | 411 | 2.0E-53 |
sp|Q02PH7|FADA_PSEAB | 3-ketoacyl-CoA thiolase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadA PE=3 SV=1 | 27 | 411 | 2.0E-53 |
sp|A6V383|FADA_PSEA7 | 3-ketoacyl-CoA thiolase OS=Pseudomonas aeruginosa (strain PA7) GN=fadA PE=3 SV=1 | 27 | 411 | 2.0E-53 |
sp|B2VJ10|FADI_ERWT9 | 3-ketoacyl-CoA thiolase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=fadI PE=3 SV=1 | 16 | 379 | 6.0E-53 |
sp|Q489W4|FADA_COLP3 | 3-ketoacyl-CoA thiolase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fadA PE=3 SV=1 | 27 | 411 | 8.0E-53 |
sp|O46629|ECHB_BOVIN | Trifunctional enzyme subunit beta, mitochondrial OS=Bos taurus GN=HADHB PE=2 SV=1 | 19 | 409 | 8.0E-53 |
sp|Q5R1W7|ECHB_PANTR | Trifunctional enzyme subunit beta, mitochondrial OS=Pan troglodytes GN=HADHB PE=2 SV=1 | 19 | 409 | 8.0E-53 |
sp|A5W6G9|FADA_PSEP1 | 3-ketoacyl-CoA thiolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fadA PE=3 SV=1 | 27 | 411 | 9.0E-53 |
sp|P55084|ECHB_HUMAN | Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens GN=HADHB PE=1 SV=3 | 19 | 409 | 1.0E-52 |
sp|Q88L01|FADA_PSEPK | 3-ketoacyl-CoA thiolase OS=Pseudomonas putida (strain KT2440) GN=fadA PE=3 SV=1 | 27 | 411 | 1.0E-52 |
sp|Q8DDK5|FADA_VIBVU | 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain CMCP6) GN=fadA PE=3 SV=1 | 28 | 410 | 1.0E-52 |
sp|Q8HXX4|ECHB_MACFA | Trifunctional enzyme subunit beta, mitochondrial OS=Macaca fascicularis GN=HADHB PE=2 SV=1 | 19 | 409 | 1.0E-52 |
sp|Q7MQI0|FADA_VIBVY | 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain YJ016) GN=fadA PE=3 SV=1 | 28 | 410 | 2.0E-52 |
sp|A1JK23|FADI_YERE8 | 3-ketoacyl-CoA thiolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadI PE=3 SV=1 | 16 | 379 | 2.0E-52 |
sp|Q87TP0|FADA_VIBPA | 3-ketoacyl-CoA thiolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadA PE=3 SV=1 | 23 | 410 | 2.0E-52 |
sp|Q21KB1|FADA_SACD2 | 3-ketoacyl-CoA thiolase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=fadA PE=3 SV=1 | 22 | 411 | 3.0E-52 |
sp|A4VKA4|FADA_PSEU5 | 3-ketoacyl-CoA thiolase OS=Pseudomonas stutzeri (strain A1501) GN=fadA PE=3 SV=1 | 27 | 411 | 4.0E-52 |
sp|Q93Q11|FADA_PSEOL | 3-ketoacyl-CoA thiolase OS=Pseudomonas oleovorans GN=fadA PE=3 SV=1 | 27 | 411 | 4.0E-52 |
sp|Q9R9W0|FADA_PSEPU | 3-ketoacyl-CoA thiolase OS=Pseudomonas putida GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-52 |
sp|A3Q8U3|FADA_SHELP | 3-ketoacyl-CoA thiolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadA PE=3 SV=1 | 25 | 410 | 9.0E-52 |
sp|Q1I7D5|FADA_PSEE4 | 3-ketoacyl-CoA thiolase OS=Pseudomonas entomophila (strain L48) GN=fadA PE=3 SV=1 | 27 | 411 | 9.0E-52 |
sp|Q99JY0|ECHB_MOUSE | Trifunctional enzyme subunit beta, mitochondrial OS=Mus musculus GN=Hadhb PE=1 SV=1 | 4 | 409 | 1.0E-51 |
sp|A1RI91|FADI_SHESW | 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain W3-18-1) GN=fadI PE=3 SV=1 | 28 | 409 | 2.0E-51 |
sp|A9KTW7|FADI_SHEB9 | 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS195) GN=fadI PE=3 SV=1 | 28 | 409 | 2.0E-51 |
sp|A3D685|FADI_SHEB5 | 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadI PE=3 SV=1 | 28 | 409 | 2.0E-51 |
sp|B8EE97|FADI_SHEB2 | 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS223) GN=fadI PE=3 SV=1 | 28 | 409 | 2.0E-51 |
sp|A6WQ26|FADI_SHEB8 | 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS185) GN=fadI PE=3 SV=1 | 28 | 409 | 3.0E-51 |
sp|P27796|THIK_YEAST | 3-ketoacyl-CoA thiolase, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POT1 PE=1 SV=1 | 27 | 408 | 3.0E-51 |
sp|A8GH87|FADI_SERP5 | 3-ketoacyl-CoA thiolase OS=Serratia proteamaculans (strain 568) GN=fadI PE=3 SV=1 | 16 | 387 | 3.0E-51 |
sp|Q05493|THIK_YARLI | 3-ketoacyl-CoA thiolase, peroxisomal OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=POT1 PE=3 SV=1 | 27 | 408 | 4.0E-51 |
sp|A4Y898|FADI_SHEPC | 3-ketoacyl-CoA thiolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadI PE=3 SV=1 | 28 | 409 | 5.0E-51 |
sp|Q60587|ECHB_RAT | Trifunctional enzyme subunit beta, mitochondrial OS=Rattus norvegicus GN=Hadhb PE=1 SV=1 | 8 | 409 | 5.0E-51 |
sp|A4XSM9|FADA_PSEMY | 3-ketoacyl-CoA thiolase OS=Pseudomonas mendocina (strain ymp) GN=fadA PE=3 SV=1 | 27 | 411 | 7.0E-51 |
sp|A6TC20|FADI_KLEP7 | 3-ketoacyl-CoA thiolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadI PE=3 SV=1 | 16 | 387 | 1.0E-50 |
sp|Q47ZB6|FADI_COLP3 | 3-ketoacyl-CoA thiolase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fadI PE=3 SV=1 | 28 | 386 | 1.0E-50 |
sp|B7LLC9|FADI_ESCF3 | 3-ketoacyl-CoA thiolase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadI PE=3 SV=1 | 16 | 387 | 1.0E-50 |
sp|B7NP25|FADI_ECO7I | 3-ketoacyl-CoA thiolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadI PE=3 SV=1 | 16 | 387 | 2.0E-50 |
sp|Q57LW5|FADI_SALCH | 3-ketoacyl-CoA thiolase OS=Salmonella choleraesuis (strain SC-B67) GN=fadI PE=3 SV=1 | 16 | 387 | 2.0E-50 |
sp|B6I6Q5|FADI_ECOSE | 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain SE11) GN=fadI PE=3 SV=1 | 16 | 387 | 2.0E-50 |
sp|B7M6M3|FADI_ECO8A | 3-ketoacyl-CoA thiolase OS=Escherichia coli O8 (strain IAI1) GN=fadI PE=3 SV=1 | 16 | 387 | 2.0E-50 |
sp|A7ZPF9|FADI_ECO24 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadI PE=3 SV=1 | 16 | 387 | 2.0E-50 |
sp|B5XVW1|FADI_KLEP3 | 3-ketoacyl-CoA thiolase OS=Klebsiella pneumoniae (strain 342) GN=fadI PE=3 SV=1 | 16 | 387 | 2.0E-50 |
sp|A4WCW7|FADI_ENT38 | 3-ketoacyl-CoA thiolase OS=Enterobacter sp. (strain 638) GN=fadI PE=3 SV=1 | 16 | 387 | 2.0E-50 |
sp|A8A2L1|FADI_ECOHS | 3-ketoacyl-CoA thiolase OS=Escherichia coli O9:H4 (strain HS) GN=fadI PE=3 SV=1 | 16 | 387 | 3.0E-50 |
sp|B7LBJ6|FADI_ECO55 | 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain 55989 / EAEC) GN=fadI PE=3 SV=1 | 16 | 387 | 3.0E-50 |
sp|A9MJ36|FADI_SALAR | 3-ketoacyl-CoA thiolase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=fadI PE=3 SV=1 | 16 | 387 | 3.0E-50 |
sp|B2TWV5|FADI_SHIB3 | 3-ketoacyl-CoA thiolase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadI PE=3 SV=1 | 16 | 387 | 3.0E-50 |
sp|A5F464|FADA_VIBC3 | 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadA PE=3 SV=1 | 28 | 410 | 3.0E-50 |
sp|B7UFZ9|FADI_ECO27 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadI PE=3 SV=1 | 16 | 387 | 4.0E-50 |
sp|B5FGB5|FADI_VIBFM | 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain MJ11) GN=fadI PE=3 SV=1 | 15 | 387 | 4.0E-50 |
sp|Q1R971|FADI_ECOUT | 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain UTI89 / UPEC) GN=fadI PE=3 SV=1 | 16 | 387 | 4.0E-50 |
sp|Q0TFA5|FADI_ECOL5 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadI PE=3 SV=1 | 16 | 387 | 4.0E-50 |
sp|A1ADI9|FADI_ECOK1 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O1:K1 / APEC GN=fadI PE=3 SV=1 | 16 | 387 | 4.0E-50 |
sp|B7MGV8|FADI_ECO45 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadI PE=3 SV=1 | 16 | 387 | 4.0E-50 |
sp|B4SZR1|FADI_SALNS | 3-ketoacyl-CoA thiolase OS=Salmonella newport (strain SL254) GN=fadI PE=3 SV=1 | 16 | 387 | 4.0E-50 |
sp|Q9KNI0|FADA_VIBCH | 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadA PE=3 SV=1 | 28 | 410 | 4.0E-50 |
sp|B4TQC3|FADI_SALSV | 3-ketoacyl-CoA thiolase OS=Salmonella schwarzengrund (strain CVM19633) GN=fadI PE=3 SV=1 | 16 | 387 | 5.0E-50 |
sp|A9N452|FADI_SALPB | 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadI PE=3 SV=1 | 16 | 387 | 5.0E-50 |
sp|B1IXA4|FADI_ECOLC | 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadI PE=3 SV=1 | 16 | 387 | 5.0E-50 |
sp|B5R3S0|FADI_SALEP | 3-ketoacyl-CoA thiolase OS=Salmonella enteritidis PT4 (strain P125109) GN=fadI PE=3 SV=1 | 16 | 387 | 5.0E-50 |
sp|B5FPN2|FADI_SALDC | 3-ketoacyl-CoA thiolase OS=Salmonella dublin (strain CT_02021853) GN=fadI PE=3 SV=1 | 16 | 387 | 5.0E-50 |
sp|B5EZS0|FADI_SALA4 | 3-ketoacyl-CoA thiolase OS=Salmonella agona (strain SL483) GN=fadI PE=3 SV=1 | 16 | 387 | 5.0E-50 |
sp|Q0HPB8|FADA_SHESM | 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-4) GN=fadA PE=3 SV=1 | 25 | 411 | 6.0E-50 |
sp|Q0I0T4|FADA_SHESR | 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-7) GN=fadA PE=3 SV=1 | 25 | 411 | 7.0E-50 |
sp|B5BBA0|FADI_SALPK | 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi A (strain AKU_12601) GN=fadI PE=3 SV=1 | 16 | 387 | 7.0E-50 |
sp|Q5PCX7|FADI_SALPA | 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadI PE=3 SV=1 | 16 | 387 | 7.0E-50 |
sp|Q83K95|FADI_SHIFL | 3-ketoacyl-CoA thiolase OS=Shigella flexneri GN=fadI PE=3 SV=1 | 16 | 387 | 7.0E-50 |
sp|Q8ZNA6|FADI_SALTY | 3-ketoacyl-CoA thiolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadI PE=3 SV=1 | 16 | 387 | 8.0E-50 |
sp|B4TCA9|FADI_SALHS | 3-ketoacyl-CoA thiolase OS=Salmonella heidelberg (strain SL476) GN=fadI PE=3 SV=1 | 16 | 387 | 9.0E-50 |
sp|B7N5V3|FADI_ECOLU | 3-ketoacyl-CoA thiolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadI PE=3 SV=1 | 16 | 387 | 9.0E-50 |
sp|P76503|FADI_ECOLI | 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12) GN=fadI PE=1 SV=1 | 16 | 387 | 9.0E-50 |
sp|B1X9L5|FADI_ECODH | 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12 / DH10B) GN=fadI PE=3 SV=1 | 16 | 387 | 9.0E-50 |
sp|C4ZVN3|FADI_ECOBW | 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadI PE=3 SV=1 | 16 | 387 | 9.0E-50 |
sp|Q8EKS0|FADA_SHEON | 3-ketoacyl-CoA thiolase OS=Shewanella oneidensis (strain MR-1) GN=fadA PE=3 SV=1 | 25 | 411 | 9.0E-50 |
sp|Q8Z4Y9|FADI_SALTI | 3-ketoacyl-CoA thiolase OS=Salmonella typhi GN=fadI PE=3 SV=1 | 16 | 387 | 1.0E-49 |
sp|Q0T2E5|FADI_SHIF8 | 3-ketoacyl-CoA thiolase OS=Shigella flexneri serotype 5b (strain 8401) GN=fadI PE=3 SV=1 | 16 | 387 | 1.0E-49 |
sp|B1LME8|FADI_ECOSM | 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadI PE=3 SV=1 | 16 | 387 | 1.0E-49 |
sp|B8CPY7|FADI_SHEPW | 3-ketoacyl-CoA thiolase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fadI PE=3 SV=1 | 12 | 387 | 1.0E-49 |
sp|Q5E3U0|FADI_VIBF1 | 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadI PE=3 SV=1 | 15 | 387 | 1.0E-49 |
sp|O53871|Y0859_MYCTU | Putative acyltransferase Rv0859 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadA PE=1 SV=1 | 27 | 411 | 2.0E-49 |
sp|A0KR49|FADA_SHESA | 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain ANA-3) GN=fadA PE=3 SV=1 | 25 | 411 | 2.0E-49 |
sp|Q8FFG3|FADI_ECOL6 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadI PE=3 SV=1 | 16 | 387 | 2.0E-49 |
sp|P34255|YKA3_CAEEL | Uncharacterized protein B0303.3 OS=Caenorhabditis elegans GN=B0303.3 PE=3 SV=1 | 3 | 409 | 2.0E-49 |
sp|Q07ZP7|FADI_SHEFN | 3-ketoacyl-CoA thiolase OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadI PE=3 SV=1 | 28 | 387 | 2.0E-49 |
sp|A8H5T2|FADI_SHEPA | 3-ketoacyl-CoA thiolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fadI PE=3 SV=1 | 28 | 387 | 3.0E-49 |
sp|A8ADP1|FADI_CITK8 | 3-ketoacyl-CoA thiolase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadI PE=3 SV=1 | 16 | 387 | 4.0E-49 |
sp|B7MY17|FADI_ECO81 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O81 (strain ED1a) GN=fadI PE=3 SV=1 | 16 | 387 | 4.0E-49 |
sp|C0PZX5|FADI_SALPC | 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi C (strain RKS4594) GN=fadI PE=3 SV=1 | 16 | 387 | 8.0E-49 |
sp|B0TL22|FADI_SHEHH | 3-ketoacyl-CoA thiolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadI PE=3 SV=1 | 28 | 387 | 8.0E-49 |
sp|B5YXY5|FADI_ECO5E | 3-ketoacyl-CoA thiolase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadI PE=3 SV=1 | 16 | 387 | 9.0E-49 |
sp|Q8XCN9|FADI_ECO57 | 3-ketoacyl-CoA thiolase OS=Escherichia coli O157:H7 GN=fadI PE=3 SV=1 | 16 | 387 | 9.0E-49 |
sp|Q31YB6|FADI_SHIBS | 3-ketoacyl-CoA thiolase OS=Shigella boydii serotype 4 (strain Sb227) GN=fadI PE=3 SV=1 | 16 | 387 | 1.0E-48 |
sp|Q15VA3|FADI_PSEA6 | 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=fadI PE=3 SV=1 | 28 | 386 | 1.0E-48 |
sp|B4RTU9|FADI_ALTMD | 3-ketoacyl-CoA thiolase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=fadI PE=3 SV=1 | 28 | 386 | 1.0E-48 |
sp|Q32DJ3|FADI_SHIDS | 3-ketoacyl-CoA thiolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadI PE=3 SV=1 | 16 | 387 | 2.0E-48 |
sp|A9R7W9|FADI_YERPG | 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fadI PE=3 SV=1 | 16 | 379 | 2.0E-48 |
sp|Q3YZM1|FADI_SHISS | 3-ketoacyl-CoA thiolase OS=Shigella sonnei (strain Ss046) GN=fadI PE=3 SV=1 | 16 | 387 | 2.0E-48 |
sp|A3M1H9|FADA_ACIBT | 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=fadA PE=3 SV=2 | 27 | 411 | 3.0E-48 |
sp|Q7A1P9|VRAB_STAAW | Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain MW2) GN=vraB PE=3 SV=1 | 27 | 411 | 3.0E-48 |
sp|Q7A768|VRAB_STAAN | Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain N315) GN=vraB PE=3 SV=1 | 27 | 411 | 3.0E-48 |
sp|Q7A2W9|VRAB_STAAM | Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=vraB PE=3 SV=1 | 27 | 411 | 3.0E-48 |
sp|Q9KWK4|VRAB_STAA1 | Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=vraB PE=3 SV=1 | 27 | 411 | 3.0E-48 |
sp|Q0HWN4|FADI_SHESR | 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-7) GN=fadI PE=3 SV=1 | 28 | 387 | 4.0E-48 |
sp|Q0HKD2|FADI_SHESM | 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-4) GN=fadI PE=3 SV=1 | 28 | 387 | 4.0E-48 |
sp|A0KV75|FADI_SHESA | 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain ANA-3) GN=fadI PE=3 SV=1 | 28 | 387 | 4.0E-48 |
sp|A4Y1B5|FADA_SHEPC | 3-ketoacyl-CoA thiolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-48 |
sp|A6WH99|FADA_SHEB8 | 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS185) GN=fadA PE=3 SV=1 | 25 | 411 | 4.0E-48 |
sp|Q6FF69|FADA_ACIAD | 3-ketoacyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-48 |
sp|Q6GBR1|VRAB_STAAS | Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain MSSA476) GN=vraB PE=3 SV=1 | 27 | 411 | 5.0E-48 |
sp|A7MH80|FADI_CROS8 | 3-ketoacyl-CoA thiolase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadI PE=3 SV=1 | 16 | 387 | 5.0E-48 |
sp|B0VE46|FADA_ACIBY | 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AYE) GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-48 |
sp|B0VLX5|FADA_ACIBS | 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain SDF) GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-48 |
sp|B2I2J8|FADA_ACIBC | 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ACICU) GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-48 |
sp|B7I3P0|FADA_ACIB5 | 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB0057) GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-48 |
sp|B7H1I1|FADA_ACIB3 | 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB307-0294) GN=fadA PE=3 SV=1 | 27 | 411 | 5.0E-48 |
sp|Q8ECP6|FADI_SHEON | 3-ketoacyl-CoA thiolase OS=Shewanella oneidensis (strain MR-1) GN=fadI PE=3 SV=1 | 28 | 387 | 9.0E-48 |
sp|Q12TB5|FADA_SHEDO | 3-ketoacyl-CoA thiolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fadA PE=3 SV=1 | 25 | 411 | 9.0E-48 |
sp|A3CYJ3|FADA_SHEB5 | 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadA PE=3 SV=1 | 25 | 411 | 9.0E-48 |
sp|Q7N287|FADI_PHOLL | 3-ketoacyl-CoA thiolase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadI PE=3 SV=1 | 14 | 409 | 1.0E-47 |
sp|Q5HIA0|VRAB_STAAC | Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain COL) GN=vraB PE=3 SV=1 | 27 | 411 | 1.0E-47 |
sp|B1JGG1|FADI_YERPY | 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fadI PE=3 SV=1 | 16 | 379 | 1.0E-47 |
sp|Q668V0|FADI_YERPS | 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadI PE=3 SV=1 | 16 | 379 | 1.0E-47 |
sp|A4TM83|FADI_YERPP | 3-ketoacyl-CoA thiolase OS=Yersinia pestis (strain Pestoides F) GN=fadI PE=3 SV=1 | 16 | 379 | 1.0E-47 |
sp|Q1CHK1|FADI_YERPN | 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadI PE=3 SV=1 | 16 | 379 | 1.0E-47 |
sp|Q8ZD46|FADI_YERPE | 3-ketoacyl-CoA thiolase OS=Yersinia pestis GN=fadI PE=3 SV=1 | 16 | 379 | 1.0E-47 |
sp|B2K8J6|FADI_YERPB | 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fadI PE=3 SV=1 | 16 | 379 | 1.0E-47 |
sp|Q1C659|FADI_YERPA | 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadI PE=3 SV=1 | 16 | 379 | 1.0E-47 |
sp|A7FGK0|FADI_YERP3 | 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadI PE=3 SV=1 | 16 | 379 | 1.0E-47 |
sp|Q08A40|FADA_SHEFN | 3-ketoacyl-CoA thiolase OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadA PE=3 SV=1 | 25 | 411 | 2.0E-47 |
sp|O07618|YHFS_BACSU | Putative acetyl-CoA C-acetyltransferase YhfS OS=Bacillus subtilis (strain 168) GN=yhfS PE=2 SV=1 | 29 | 387 | 3.0E-47 |
sp|A3QFP4|FADI_SHELP | 3-ketoacyl-CoA thiolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadI PE=3 SV=1 | 28 | 387 | 4.0E-47 |
sp|A1RDW3|FADA_SHESW | 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain W3-18-1) GN=fadA PE=3 SV=1 | 25 | 411 | 6.0E-47 |
sp|A1S7L7|FADI_SHEAM | 3-ketoacyl-CoA thiolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadI PE=3 SV=1 | 28 | 387 | 6.0E-47 |
sp|Q6D2L6|FADI_PECAS | 3-ketoacyl-CoA thiolase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadI PE=3 SV=1 | 16 | 379 | 8.0E-47 |
sp|A0KK76|FADI_AERHH | 3-ketoacyl-CoA thiolase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadI PE=3 SV=1 | 28 | 384 | 8.0E-47 |
sp|Q12P12|FADI_SHEDO | 3-ketoacyl-CoA thiolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fadI PE=3 SV=1 | 27 | 387 | 9.0E-47 |
sp|A1S1I7|FADA_SHEAM | 3-ketoacyl-CoA thiolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadA PE=3 SV=1 | 25 | 411 | 9.0E-47 |
sp|Q6GJ93|VRAB_STAAR | Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain MRSA252) GN=vraB PE=3 SV=1 | 27 | 411 | 1.0E-46 |
sp|A4SMT9|FADI_AERS4 | 3-ketoacyl-CoA thiolase OS=Aeromonas salmonicida (strain A449) GN=fadI PE=3 SV=1 | 28 | 384 | 1.0E-46 |
sp|C6DAL8|FADI_PECCP | 3-ketoacyl-CoA thiolase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadI PE=3 SV=1 | 16 | 379 | 2.0E-46 |
sp|Q6LTK4|FADI_PHOPR | 3-ketoacyl-CoA thiolase OS=Photobacterium profundum GN=fadI PE=3 SV=1 | 24 | 387 | 2.0E-46 |
sp|A5F2P1|FADI_VIBC3 | 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadI PE=3 SV=2 | 28 | 387 | 4.0E-46 |
sp|Q9KT59|FADI_VIBCH | 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadI PE=3 SV=2 | 28 | 387 | 6.0E-46 |
sp|B1KKT1|FADI_SHEWM | 3-ketoacyl-CoA thiolase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fadI PE=3 SV=1 | 28 | 387 | 7.0E-46 |
sp|Q5HRH3|VRAB_STAEQ | Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=vraB PE=3 SV=1 | 29 | 384 | 1.0E-45 |
sp|Q15ZF4|FADA_PSEA6 | 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=fadA PE=3 SV=1 | 25 | 411 | 3.0E-45 |
sp|A8FTR6|FADI_SHESH | 3-ketoacyl-CoA thiolase OS=Shewanella sediminis (strain HAW-EB3) GN=fadI PE=3 SV=1 | 28 | 387 | 4.0E-45 |
sp|Q1QUW9|FADA_CHRSD | 3-ketoacyl-CoA thiolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fadA PE=3 SV=1 | 27 | 411 | 7.0E-45 |
sp|Q8CTR0|VRAB_STAES | Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=vraB PE=3 SV=1 | 29 | 384 | 2.0E-44 |
sp|Q3IEE3|FADI_PSEHT | 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fadI PE=3 SV=1 | 28 | 387 | 1.0E-43 |
sp|Q5QXN5|FADI_IDILO | 3-ketoacyl-CoA thiolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadI PE=3 SV=1 | 28 | 387 | 2.0E-42 |
sp|Q87MM2|FADI_VIBPA | 3-ketoacyl-CoA thiolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadI PE=3 SV=1 | 28 | 387 | 3.0E-40 |
sp|Q8DB48|FADI_VIBVU | 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain CMCP6) GN=fadI PE=3 SV=1 | 24 | 387 | 2.0E-39 |
sp|Q7MIS4|FADI_VIBVY | 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain YJ016) GN=fadI PE=3 SV=1 | 24 | 387 | 7.0E-39 |
sp|Q4L3Q1|VRAB_STAHJ | Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus haemolyticus (strain JCSC1435) GN=vraB PE=3 SV=1 | 25 | 410 | 5.0E-38 |
sp|P45362|THL_PEPDI | Acetyl-CoA acetyltransferase (Fragment) OS=Peptoclostridium difficile GN=thi PE=3 SV=2 | 27 | 118 | 2.0E-19 |
sp|P32020|NLTP_MOUSE | Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 | 51 | 387 | 2.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0016747 | acyltransferase activity, transferring groups other than amino-acyl groups | Yes |
GO:0003674 | molecular_function | No |
GO:0016740 | transferase activity | No |
GO:0003824 | catalytic activity | No |
GO:0016746 | acyltransferase activity | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 41 | 0.45 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 757.60 | 367.17 | 1148.02 |
Initials | Initials knots | 489.08 | 259.72 | 718.43 |
Pileal_Stipeal_center | Stage I stipe center | 493.37 | 261.07 | 725.68 |
Pileal_Stipeal_shell | Stage I stipe shell | 456.40 | 244.56 | 668.25 |
DIF_stipe_center | Stage II stipe center | 526.58 | 275.73 | 777.42 |
DIF_stipe_shell | Stage II stipe shell | 541.61 | 282.52 | 800.71 |
DIF_stipe_skin | Stage II stipe skin | 479.94 | 255.59 | 704.29 |
DIF_cap_skin | Stage II cap skin | 470.56 | 250.49 | 690.62 |
DIF_cap_tissue | Stage II cap tissue | 442.84 | 238.88 | 646.81 |
DIF_gill_tissue | Stage II gill tissue | 436.97 | 235.77 | 638.16 |
YFB_stipe_center | Young fruiting body stipe center | 606.30 | 310.35 | 902.26 |
YFB_stipe_shell | Young fruiting body stipe shell | 620.80 | 315.47 | 926.13 |
YFB_stipe_skin | Young fruiting body stipe skin | 472.98 | 252.70 | 693.27 |
YFB_cap_skin | Young fruiting body cap skin | 492.24 | 261.51 | 722.97 |
YFB_cap_tissue | Young fruiting body cap tissue | 486.26 | 257.48 | 715.04 |
YFB_gill_tissue | Young fruiting body gill tissue | 509.33 | 267.20 | 751.46 |
YFB_veil | Young fruiting body veil | 509.24 | 267.36 | 751.13 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.107122 | no |
Casing | YFB_stipe_center | 0.638440 | no |
Casing | YFB_stipe_shell | 0.687700 | no |
Casing | YFB_stipe_skin | 0.183815 | no |
Casing | YFB_cap_skin | 0.229368 | no |
Casing | YFB_cap_tissue | 0.211006 | no |
Casing | YFB_gill_tissue | 0.295714 | no |
Casing | YFB_veil | 0.296112 | no |
Casing | Initials | 0.221143 | no |
Casing | Pileal_Stipeal_center | 0.231336 | no |
Casing | Pileal_Stipeal_shell | 0.141124 | no |
Casing | DIF_stipe_center | 0.354295 | no |
Casing | DIF_stipe_shell | 0.403765 | no |
Casing | DIF_stipe_skin | 0.194492 | no |
Casing | DIF_cap_skin | 0.173079 | no |
Casing | DIF_cap_tissue | 0.117937 | no |
DIF_gill_tissue | YFB_stipe_center | 0.399688 | no |
DIF_gill_tissue | YFB_stipe_shell | 0.357040 | no |
DIF_gill_tissue | YFB_stipe_skin | 0.890150 | no |
DIF_gill_tissue | YFB_cap_skin | 0.821524 | no |
DIF_gill_tissue | YFB_cap_tissue | 0.844496 | no |
DIF_gill_tissue | YFB_gill_tissue | 0.760331 | no |
DIF_gill_tissue | YFB_veil | 0.761766 | no |
YFB_stipe_center | YFB_stipe_shell | 0.971365 | no |
YFB_stipe_center | YFB_stipe_skin | 0.570244 | no |
YFB_stipe_center | YFB_cap_skin | 0.655383 | no |
YFB_stipe_center | YFB_cap_tissue | 0.625930 | no |
YFB_stipe_center | YFB_gill_tissue | 0.732372 | no |
YFB_stipe_center | YFB_veil | 0.733195 | no |
YFB_stipe_shell | YFB_stipe_skin | 0.518975 | no |
YFB_stipe_shell | YFB_cap_skin | 0.602045 | no |
YFB_stipe_shell | YFB_cap_tissue | 0.574237 | no |
YFB_stipe_shell | YFB_gill_tissue | 0.681619 | no |
YFB_stipe_shell | YFB_veil | 0.682837 | no |
YFB_stipe_skin | YFB_cap_skin | 0.948717 | no |
YFB_stipe_skin | YFB_cap_tissue | 0.963998 | no |
YFB_stipe_skin | YFB_gill_tissue | 0.898618 | no |
YFB_stipe_skin | YFB_veil | 0.900878 | no |
YFB_cap_skin | YFB_cap_tissue | 0.984005 | no |
YFB_cap_skin | YFB_gill_tissue | 0.956458 | no |
YFB_cap_skin | YFB_veil | 0.957125 | no |
YFB_cap_tissue | YFB_gill_tissue | 0.940125 | no |
YFB_cap_tissue | YFB_veil | 0.941234 | no |
YFB_gill_tissue | YFB_veil | 0.999519 | no |
Initials | DIF_gill_tissue | 0.833015 | no |
Initials | YFB_stipe_center | 0.637928 | no |
Initials | YFB_stipe_shell | 0.588583 | no |
Initials | YFB_stipe_skin | 0.956823 | no |
Initials | YFB_cap_skin | 0.991538 | no |
Initials | YFB_cap_tissue | 0.991942 | no |
Initials | YFB_gill_tissue | 0.948419 | no |
Initials | YFB_veil | 0.949626 | no |
Initials | Pileal_Stipeal_center | 0.988247 | no |
Initials | Pileal_Stipeal_shell | 0.907652 | no |
Initials | DIF_stipe_center | 0.901397 | no |
Initials | DIF_stipe_shell | 0.855284 | no |
Initials | DIF_stipe_skin | 0.975540 | no |
Initials | DIF_cap_skin | 0.950908 | no |
Initials | DIF_cap_tissue | 0.859259 | no |
Pileal_Stipeal_center | DIF_gill_tissue | 0.817971 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.656241 | no |
Pileal_Stipeal_center | YFB_stipe_shell | 0.605686 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 0.945370 | no |
Pileal_Stipeal_center | YFB_cap_skin | 0.996774 | no |
Pileal_Stipeal_center | YFB_cap_tissue | 0.981597 | no |
Pileal_Stipeal_center | YFB_gill_tissue | 0.959900 | no |
Pileal_Stipeal_center | YFB_veil | 0.960495 | no |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.892508 | no |
Pileal_Stipeal_center | DIF_stipe_center | 0.914572 | no |
Pileal_Stipeal_center | DIF_stipe_shell | 0.868132 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 0.964449 | no |
Pileal_Stipeal_center | DIF_cap_skin | 0.938842 | no |
Pileal_Stipeal_center | DIF_cap_tissue | 0.843154 | no |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.945195 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 0.493841 | no |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.443846 | no |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.954759 | no |
Pileal_Stipeal_shell | YFB_cap_skin | 0.897033 | no |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.916692 | no |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.843597 | no |
Pileal_Stipeal_shell | YFB_veil | 0.845475 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.780611 | no |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.721376 | no |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.934827 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 0.962101 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.963005 | no |
DIF_stipe_center | DIF_gill_tissue | 0.692582 | no |
DIF_stipe_center | YFB_stipe_center | 0.791010 | no |
DIF_stipe_center | YFB_stipe_shell | 0.748179 | no |
DIF_stipe_center | YFB_stipe_skin | 0.845596 | no |
DIF_stipe_center | YFB_cap_skin | 0.909784 | no |
DIF_stipe_center | YFB_cap_tissue | 0.891516 | no |
DIF_stipe_center | YFB_gill_tissue | 0.957888 | no |
DIF_stipe_center | YFB_veil | 0.958258 | no |
DIF_stipe_center | DIF_stipe_shell | 0.965297 | no |
DIF_stipe_center | DIF_stipe_skin | 0.868931 | no |
DIF_stipe_center | DIF_cap_skin | 0.837275 | no |
DIF_stipe_center | DIF_cap_tissue | 0.721333 | no |
DIF_stipe_shell | DIF_gill_tissue | 0.632488 | no |
DIF_stipe_shell | YFB_stipe_center | 0.840961 | no |
DIF_stipe_shell | YFB_stipe_shell | 0.799754 | no |
DIF_stipe_shell | YFB_stipe_skin | 0.791409 | no |
DIF_stipe_shell | YFB_cap_skin | 0.864023 | no |
DIF_stipe_shell | YFB_cap_tissue | 0.844001 | no |
DIF_stipe_shell | YFB_gill_tissue | 0.919996 | no |
DIF_stipe_shell | YFB_veil | 0.919799 | no |
DIF_stipe_shell | DIF_stipe_skin | 0.816519 | no |
DIF_stipe_shell | DIF_cap_skin | 0.782983 | no |
DIF_stipe_shell | DIF_cap_tissue | 0.663495 | no |
DIF_stipe_skin | DIF_gill_tissue | 0.868356 | no |
DIF_stipe_skin | YFB_stipe_center | 0.597981 | no |
DIF_stipe_skin | YFB_stipe_shell | 0.548260 | no |
DIF_stipe_skin | YFB_stipe_skin | 0.981085 | no |
DIF_stipe_skin | YFB_cap_skin | 0.968663 | no |
DIF_stipe_skin | YFB_cap_tissue | 0.982681 | no |
DIF_stipe_skin | YFB_gill_tissue | 0.923588 | no |
DIF_stipe_skin | YFB_veil | 0.923568 | no |
DIF_stipe_skin | DIF_cap_skin | 0.975164 | no |
DIF_stipe_skin | DIF_cap_tissue | 0.892377 | no |
DIF_cap_skin | DIF_gill_tissue | 0.899083 | no |
DIF_cap_skin | YFB_stipe_center | 0.554291 | no |
DIF_cap_skin | YFB_stipe_shell | 0.503380 | no |
DIF_cap_skin | YFB_stipe_skin | 0.992883 | no |
DIF_cap_skin | YFB_cap_skin | 0.942780 | no |
DIF_cap_skin | YFB_cap_tissue | 0.958391 | no |
DIF_cap_skin | YFB_gill_tissue | 0.891680 | no |
DIF_cap_skin | YFB_veil | 0.893058 | no |
DIF_cap_skin | DIF_cap_tissue | 0.920774 | no |
DIF_cap_tissue | DIF_gill_tissue | 0.983029 | no |
DIF_cap_tissue | YFB_stipe_center | 0.427053 | no |
DIF_cap_tissue | YFB_stipe_shell | 0.381332 | no |
DIF_cap_tissue | YFB_stipe_skin | 0.909899 | no |
DIF_cap_tissue | YFB_cap_skin | 0.846163 | no |
DIF_cap_tissue | YFB_cap_tissue | 0.868132 | no |
DIF_cap_tissue | YFB_gill_tissue | 0.786908 | no |
DIF_cap_tissue | YFB_veil | 0.787138 | no |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|073630 MLLARFVSASRIPSRPFLTRAMSQIPEVVIVSAVRTPVASFNGTLKSFTAPQLGTIALKGALEKGNVDPAIVEEI YFGNVVQAGVGQSPARQVALASGLKSSSDATTINKVCASGMKSIMLGAQSIQLGQRSVVAAGGMESMSNAPFLLP RQNPAFGKFTTRDSLEADGLWDVYNDFAMGNCGENAAEKYQIDRQSQDSHAIESYKRAARAWEAGAFDAEIIPIT VKGKKGDTIVREDEEYKRVIFDKVPSLRSAFKKDGTITAANSSPISDGASALILMSAEKASELGLKPLAKVISYA DAGTEPIDFPAAPTVALPIALERAGLTVNDISLFEINEAFSIVVRIAEKVLNIPAEKINVNGGAVALGHAIGNSG SRIIVSLVHALKPGQYGAAGICNGGGAASSLIIQRL* |
Coding | >AgabiH97|073630 ATGCTGCTTGCGCGTTTTGTTTCTGCATCTCGCATCCCCTCCCGTCCCTTCTTGACACGAGCCATGTCTCAAATT CCCGAAGTTGTCATTGTCTCTGCCGTTCGCACCCCAGTGGCCTCCTTTAACGGCACTTTGAAGTCATTTACAGCC CCTCAACTTGGGACTATCGCCCTGAAAGGCGCTTTAGAGAAAGGAAACGTTGATCCGGCCATAGTCGAGGAAATC TACTTTGGCAATGTGGTCCAGGCAGGTGTCGGTCAATCACCCGCTCGCCAAGTGGCTCTCGCTTCTGGTCTCAAG TCAAGTTCCGATGCCACAACAATCAACAAGGTCTGCGCGAGTGGAATGAAATCAATCATGTTGGGTGCTCAAAGC ATTCAACTTGGCCAACGTTCCGTCGTCGCCGCCGGTGGAATGGAAAGCATGAGCAATGCGCCCTTCCTCCTTCCT CGTCAAAACCCTGCATTCGGCAAGTTCACAACTCGAGATTCACTCGAGGCGGACGGGCTCTGGGATGTGTACAAT GATTTCGCCATGGGCAACTGTGGTGAGAATGCCGCAGAGAAATATCAAATCGATCGCCAATCTCAAGACTCGCAT GCTATCGAATCTTACAAGCGCGCAGCCCGCGCTTGGGAAGCCGGTGCATTTGACGCTGAAATCATTCCCATCACT GTGAAAGGAAAGAAGGGTGACACTATTGTGCGCGAAGACGAAGAGTACAAACGTGTCATCTTCGACAAAGTTCCT TCGTTGCGCTCCGCTTTCAAGAAAGATGGCACTATTACAGCGGCCAATTCTTCGCCTATCAGTGATGGTGCTTCG GCTCTTATTCTCATGTCGGCAGAAAAAGCTTCAGAGCTTGGTCTAAAACCCCTAGCCAAGGTCATTTCTTATGCC GATGCTGGCACTGAACCCATCGATTTCCCTGCCGCTCCCACTGTCGCTCTCCCAATTGCCCTCGAGAGAGCTGGC CTCACTGTCAACGATATTTCTCTCTTCGAAATCAACGAGGCTTTCTCCATCGTTGTTCGCATCGCTGAGAAAGTT CTCAACATTCCTGCAGAGAAGATTAACGTCAACGGTGGTGCTGTCGCCCTTGGTCATGCTATTGGCAACTCTGGC TCGCGTATCATCGTTTCCCTTGTGCATGCGTTGAAACCCGGACAATATGGTGCTGCTGGTATTTGCAATGGAGGG GGTGCCGCATCTTCTCTCATTATCCAAAGGCTCTGA |
Transcript | >AgabiH97|073630 ATGCTGCTTGCGCGTTTTGTTTCTGCATCTCGCATCCCCTCCCGTCCCTTCTTGACACGAGCCATGTCTCAAATT CCCGAAGTTGTCATTGTCTCTGCCGTTCGCACCCCAGTGGCCTCCTTTAACGGCACTTTGAAGTCATTTACAGCC CCTCAACTTGGGACTATCGCCCTGAAAGGCGCTTTAGAGAAAGGAAACGTTGATCCGGCCATAGTCGAGGAAATC TACTTTGGCAATGTGGTCCAGGCAGGTGTCGGTCAATCACCCGCTCGCCAAGTGGCTCTCGCTTCTGGTCTCAAG TCAAGTTCCGATGCCACAACAATCAACAAGGTCTGCGCGAGTGGAATGAAATCAATCATGTTGGGTGCTCAAAGC ATTCAACTTGGCCAACGTTCCGTCGTCGCCGCCGGTGGAATGGAAAGCATGAGCAATGCGCCCTTCCTCCTTCCT CGTCAAAACCCTGCATTCGGCAAGTTCACAACTCGAGATTCACTCGAGGCGGACGGGCTCTGGGATGTGTACAAT GATTTCGCCATGGGCAACTGTGGTGAGAATGCCGCAGAGAAATATCAAATCGATCGCCAATCTCAAGACTCGCAT GCTATCGAATCTTACAAGCGCGCAGCCCGCGCTTGGGAAGCCGGTGCATTTGACGCTGAAATCATTCCCATCACT GTGAAAGGAAAGAAGGGTGACACTATTGTGCGCGAAGACGAAGAGTACAAACGTGTCATCTTCGACAAAGTTCCT TCGTTGCGCTCCGCTTTCAAGAAAGATGGCACTATTACAGCGGCCAATTCTTCGCCTATCAGTGATGGTGCTTCG GCTCTTATTCTCATGTCGGCAGAAAAAGCTTCAGAGCTTGGTCTAAAACCCCTAGCCAAGGTCATTTCTTATGCC GATGCTGGCACTGAACCCATCGATTTCCCTGCCGCTCCCACTGTCGCTCTCCCAATTGCCCTCGAGAGAGCTGGC CTCACTGTCAACGATATTTCTCTCTTCGAAATCAACGAGGCTTTCTCCATCGTTGTTCGCATCGCTGAGAAAGTT CTCAACATTCCTGCAGAGAAGATTAACGTCAACGGTGGTGCTGTCGCCCTTGGTCATGCTATTGGCAACTCTGGC TCGCGTATCATCGTTTCCCTTGTGCATGCGTTGAAACCCGGACAATATGGTGCTGCTGGTATTTGCAATGGAGGG GGTGCCGCATCTTCTCTCATTATCCAAAGGCTCTGA |
Gene | >AgabiH97|073630 ATGCTGCTTGCGCGTTTTGTTTCTGCATCTCGCATCCCCTCCCGTCCCTTCTTGACACGAGCCATGGTACGTTTC CTCGATTGTACATCGTCCTGTATACTCATCCTTGTCTCCAGTCTCAAATTCCCGAAGTTGTCATTGTCTCTGCCG TTCGCACCCCAGTGGCCTCCTTTAACGGCACTTTGAAGTCATTTACAGCCCCTCAACTTGGGACTATCGCCCTGA AAGGCGCTTTAGAGAAAGGAAACGTTGATCCGGCCATAGTCGAGGAAATCTACTTTGGCAATGTGGTCCAGGCAG GTGTCGGTCAATCACCCGCTCGCCAAGTGGCTCTCGCTTCTGGTCTCAAGTCAAGTTCCGATGCCACAACAATCA ACAAGGTCTGCGCGAGTGGAATGAAATCAATCATGTTGGGTGCTCAAAGCATTCAACTTGGCCAACGTTCCGTCG TCGCCGCCGGTGGAATGGAAAGCATGAGCAATGCGCCGTAAGTCCTTTTAGTTACGACGATACCGCAATCTCTAA TGATCCACAGCTTCCTCCTTCCTCGTCAAAACCCTGCATTCGGCAAGTTCACAACTCGAGATTCACTCGAGGCGG ACGGGCTCTGGGATGTGTACAATGATTTCGCCATGGGCAACTGTGGTGAGAATGCCGCAGAGAAATATCAAATCG ATCGCCAATCTCAAGACTCGCATGCTATCGAATCTTACAAGCGCGCAGCCCGCGCTTGGGAAGCCGGTGCATTTG ACGCTGAAATCATTCCCATCACTGTGAAAGGAAAGAAGGGTGACACTATTGTGCGCGAAGACGAAGAGTACAAAC GTGTCATCTTCGACAAAGTTCCTTCGTTGCGCTCCGCTTTCAAGAAAGATGGCACTATTACAGCGGCCAATTCTT CGCCTATCAGTGATGGTGCTTCGGCTCTTATTCTCATGTCGGCAGAAAAAGCTTCAGAGCTTGGTCTAAAACCCC TAGCCAAGGTCATTTGTGAGTAGTAGGCTTTTCATCTAGTGTCTTTCAAGTTGTCCTCATCCATTCGTTTACCAG CTTATGCCGATGCTGGCACTGAACCCATCGATTTCCCTGCCGCTCCCACTGTCGCTCTCCCAATTGCCCTCGAGA GAGCTGGCCTCACTGTCAACGATATTTCTCTCTTCGAAATCAACGAGGCTTTCTCCATCGTTGTTCGCATCGCTG AGAAAGTTCTCAACATTCCTGCAGAGAAGATTAACGTCAACGGGTGAGTAATCCGAGCTACTGTTTAAGTCATCT TACTCAAGGATACGTAGTGGTGCTGTCGCCCTTGGTCATGCTATTGGCAACTCTGGCTCGCGTATCATCGTTTCC CTTGTGCATGCGTTGAAACCCGGACAATATGGTGCTGCTGGTATTTGCAATGGAGTAAGTGCATTCATGTAACAA TCAATCTACACTGCTGATTATGCGTTTCAGGGGGGTGCCGCATCTTCTCTCATTATCCAAAGGCTCTGA |