Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|073630
Gene name
Locationscaffold_4:1983663..1985157
Strand-
Gene length (bp)1494
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 1.4E-89 28 282
PF02803 Thiolase_C Thiolase, C-terminal domain 1.5E-38 290 410

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6AZA0|THIL_DANRE Acetyl-CoA acetyltransferase, mitochondrial OS=Danio rerio GN=acat1 PE=2 SV=1 11 411 1.0E-149
sp|Q6GN02|THILB_XENLA Acetyl-CoA acetyltransferase B, mitochondrial OS=Xenopus laevis GN=acat1-b PE=2 SV=1 27 411 1.0E-147
sp|P24752|THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens GN=ACAT1 PE=1 SV=1 2 411 2.0E-147
sp|Q6NU46|THILA_XENLA Acetyl-CoA acetyltransferase A, mitochondrial OS=Xenopus laevis GN=acat1-a PE=2 SV=1 27 411 5.0E-147
sp|Q8HXY6|THIL_MACFA Acetyl-CoA acetyltransferase, mitochondrial OS=Macaca fascicularis GN=ACAT1 PE=2 SV=1 2 411 7.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6AZA0|THIL_DANRE Acetyl-CoA acetyltransferase, mitochondrial OS=Danio rerio GN=acat1 PE=2 SV=1 11 411 1.0E-149
sp|Q6GN02|THILB_XENLA Acetyl-CoA acetyltransferase B, mitochondrial OS=Xenopus laevis GN=acat1-b PE=2 SV=1 27 411 1.0E-147
sp|P24752|THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens GN=ACAT1 PE=1 SV=1 2 411 2.0E-147
sp|Q6NU46|THILA_XENLA Acetyl-CoA acetyltransferase A, mitochondrial OS=Xenopus laevis GN=acat1-a PE=2 SV=1 27 411 5.0E-147
sp|Q8HXY6|THIL_MACFA Acetyl-CoA acetyltransferase, mitochondrial OS=Macaca fascicularis GN=ACAT1 PE=2 SV=1 2 411 7.0E-147
sp|Q8QZT1|THIL_MOUSE Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus GN=Acat1 PE=1 SV=1 2 411 2.0E-145
sp|Q29RZ0|THIL_BOVIN Acetyl-CoA acetyltransferase, mitochondrial OS=Bos taurus GN=ACAT1 PE=2 SV=1 2 411 4.0E-145
sp|Q5BKN8|THIL_XENTR Acetyl-CoA acetyltransferase, mitochondrial OS=Xenopus tropicalis GN=acat1 PE=2 SV=1 27 411 2.0E-144
sp|P17764|THIL_RAT Acetyl-CoA acetyltransferase, mitochondrial OS=Rattus norvegicus GN=Acat1 PE=1 SV=1 2 411 2.0E-141
sp|Q22100|THILH_CAEEL Acetyl-CoA acetyltransferase homolog, mitochondrial OS=Caenorhabditis elegans GN=kat-1 PE=1 SV=2 15 411 8.0E-138
sp|Q6L8K7|THIL_YARLI Acetyl-CoA acetyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAT1 PE=3 SV=1 30 411 1.0E-131
sp|Q9UQW6|THIL_SCHPO Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg10 PE=2 SV=1 27 411 4.0E-131
sp|Q86AD9|THIL1_DICDI Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum GN=DDB_G0271544 PE=2 SV=1 24 411 5.0E-131
sp|Q9FIK7|THIC2_ARATH Probable acetyl-CoA acetyltransferase, cytosolic 2 OS=Arabidopsis thaliana GN=At5g47720 PE=2 SV=1 24 409 8.0E-129
sp|Q8S4Y1|THIC1_ARATH Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabidopsis thaliana GN=AAT1 PE=2 SV=1 27 411 8.0E-123
sp|Q04677|THIB_CANTR Acetyl-CoA acetyltransferase IB OS=Candida tropicalis GN=PACTB PE=1 SV=3 25 411 6.0E-122
sp|Q12598|THIA_CANTR Acetyl-CoA acetyltransferase IA OS=Candida tropicalis GN=PACTA PE=1 SV=3 25 411 3.0E-121
sp|P41338|THIL_YEAST Acetyl-CoA acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG10 PE=1 SV=3 22 411 1.0E-120
sp|P44873|ATOB_HAEIN Acetyl-CoA acetyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atoB PE=3 SV=1 25 411 3.0E-116
sp|P45359|THLA_CLOAB Acetyl-CoA acetyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thlA PE=1 SV=1 25 410 2.0E-111
sp|P10551|THIL_SACMO Acetyl-CoA acetyltransferase OS=Saccharomyces pastorianus (strain ATCC 76670 / Carlsberg bottom yeast no.2 / CBS 1503 / CLIB 180 / NBRC 10610 / NRRL Y-1525) GN=ERG10 PE=3 SV=1 22 411 5.0E-111
sp|Q18AR0|THLA_PEPD6 Acetyl-CoA acetyltransferase OS=Peptoclostridium difficile (strain 630) GN=thlA PE=1 SV=1 27 410 1.0E-108
sp|Q8CQN7|THLA_STAES Probable acetyl-CoA acyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2384 PE=3 SV=1 28 410 7.0E-107
sp|Q5HS07|THLA_STAEQ Probable acetyl-CoA acyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0032 PE=3 SV=1 28 410 7.0E-107
sp|P14611|THIL_CUPNH Acetyl-CoA acetyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbA PE=1 SV=1 25 410 6.0E-102
sp|Q5HIU0|THLA_STAAC Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain COL) GN=SACOL0426 PE=3 SV=1 28 410 2.0E-100
sp|P45369|THIL_ALLVD Acetyl-CoA acetyltransferase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbA PE=3 SV=2 28 411 2.0E-100
sp|Q9I2A8|ATOB_PSEAE Acetyl-CoA acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atoB PE=3 SV=1 25 410 5.0E-100
sp|Q2G124|THLA_STAA8 Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00336 PE=3 SV=1 28 410 6.0E-100
sp|Q2FJQ9|THLA_STAA3 Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0355 PE=3 SV=1 28 410 6.0E-100
sp|Q6GJW4|THLA_STAAR Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0351 PE=3 SV=1 28 410 1.0E-99
sp|Q7A7L2|THLA_STAAN Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain N315) GN=SA0342 PE=1 SV=1 28 410 1.0E-99
sp|Q99WM3|THLA_STAAM Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0354 PE=3 SV=1 28 410 1.0E-99
sp|Q8NY95|THLA_STAAW Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain MW2) GN=MW0330 PE=3 SV=1 28 410 2.0E-99
sp|Q6GCB8|THLA_STAAS Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0330 PE=3 SV=1 28 410 2.0E-99
sp|Q2YVF5|THLA_STAAB Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0304 PE=3 SV=1 28 410 4.0E-99
sp|P54810|THIL_PARDE Acetyl-CoA acetyltransferase OS=Paracoccus denitrificans GN=phaA PE=3 SV=1 25 410 3.0E-97
sp|P45855|THL_BACSU Acetyl-CoA acetyltransferase OS=Bacillus subtilis (strain 168) GN=mmgA PE=2 SV=2 27 409 5.0E-97
sp|Q9ZHI1|THIL_CHRVO Acetyl-CoA acetyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=phaA PE=3 SV=2 27 410 1.0E-96
sp|Q8CAY6|THIC_MOUSE Acetyl-CoA acetyltransferase, cytosolic OS=Mus musculus GN=Acat2 PE=1 SV=2 28 410 1.0E-95
sp|Q5XI22|THIC_RAT Acetyl-CoA acetyltransferase, cytosolic OS=Rattus norvegicus GN=Acat2 PE=1 SV=1 28 410 4.0E-95
sp|P76461|ATOB_ECOLI Acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) GN=atoB PE=1 SV=1 25 411 9.0E-95
sp|P45363|THIL_THIVI Acetyl-CoA acetyltransferase OS=Thiocystis violacea GN=phbA PE=3 SV=1 28 411 1.0E-94
sp|P50174|THIL_RHIME Acetyl-CoA acetyltransferase OS=Rhizobium meliloti (strain 1021) GN=phbA PE=3 SV=1 26 411 4.0E-93
sp|Q46939|YQEF_ECOLI Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) GN=yqeF PE=3 SV=2 25 410 6.0E-93
sp|Q9BWD1|THIC_HUMAN Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens GN=ACAT2 PE=1 SV=2 28 410 8.0E-92
sp|A0R1Y7|FADA4_MYCS2 Probable acetyl-CoA acetyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_4920 PE=1 SV=2 29 410 2.0E-91
sp|P07097|THIL_ZOORA Acetyl-CoA acetyltransferase OS=Zoogloea ramigera GN=phbA PE=1 SV=4 26 411 3.0E-88
sp|Q8BWT1|THIM_MOUSE 3-ketoacyl-CoA thiolase, mitochondrial OS=Mus musculus GN=Acaa2 PE=1 SV=3 22 409 4.0E-83
sp|P46707|FADA4_MYCLE Probable acetyl-CoA acetyltransferase OS=Mycobacterium leprae (strain TN) GN=fadA4 PE=3 SV=1 29 409 1.0E-82
sp|P42765|THIM_HUMAN 3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens GN=ACAA2 PE=1 SV=2 22 409 2.0E-82
sp|P13437|THIM_RAT 3-ketoacyl-CoA thiolase, mitochondrial OS=Rattus norvegicus GN=Acaa2 PE=2 SV=1 22 409 2.0E-81
sp|P9WG69|FADA4_MYCTU Probable acetyl-CoA acetyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadA4 PE=1 SV=1 29 409 3.0E-81
sp|P9WG68|FADA4_MYCTO Probable acetyl-CoA acetyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadA4 PE=3 SV=1 29 409 3.0E-81
sp|P66927|FADA4_MYCBO Probable acetyl-CoA acetyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadA4 PE=3 SV=1 29 409 3.0E-81
sp|Q5RES5|THIM_PONAB 3-ketoacyl-CoA thiolase, mitochondrial OS=Pongo abelii GN=ACAA2 PE=2 SV=1 22 409 4.0E-81
sp|Q0KBP1|BKTB_CUPNH Beta-ketothiolase BktB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=bktB PE=1 SV=1 27 411 4.0E-80
sp|Q3T0R7|THIM_BOVIN 3-ketoacyl-CoA thiolase, mitochondrial OS=Bos taurus GN=ACAA2 PE=2 SV=1 22 409 1.0E-79
sp|Q9I6R0|PCAF_PSEAE Beta-ketoadipyl-CoA thiolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaF PE=3 SV=1 27 411 8.0E-72
sp|Q8VPF1|PCAF_PSEKB Beta-ketoadipyl-CoA thiolase OS=Pseudomonas knackmussii (strain DSM 6978 / LMG 23759 / B13) GN=pcaF PE=1 SV=1 27 411 4.0E-71
sp|Q8SVA6|THIK_ENCCU 3-ketoacyl-CoA thiolase, peroxisomal OS=Encephalitozoon cuniculi (strain GB-M1) GN=FOX3 PE=1 SV=1 27 410 2.0E-69
sp|P33291|THIKB_CANTR 3-ketoacyl-CoA thiolase B, peroxisomal OS=Candida tropicalis PE=3 SV=1 27 410 3.0E-69
sp|O32177|FADA_BACSU 3-ketoacyl-CoA thiolase OS=Bacillus subtilis (strain 168) GN=fadA PE=2 SV=1 25 409 4.0E-69
sp|P0C7L2|PAAJ_ECOLI 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase OS=Escherichia coli (strain K12) GN=paaJ PE=1 SV=1 27 411 2.0E-68
sp|P0C7L3|PAAJ_ECOLX Beta-ketoadipyl-CoA thiolase OS=Escherichia coli GN=paaJ PE=3 SV=1 27 411 6.0E-68
sp|B6EGU1|FADA_ALISL 3-ketoacyl-CoA thiolase OS=Aliivibrio salmonicida (strain LFI1238) GN=fadA PE=3 SV=1 25 410 9.0E-68
sp|P09110|THIK_HUMAN 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens GN=ACAA1 PE=1 SV=2 27 409 8.0E-67
sp|P21775|THIKA_RAT 3-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus norvegicus GN=Acaa1a PE=1 SV=2 27 409 2.0E-66
sp|P07871|THIKB_RAT 3-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus norvegicus GN=Acaa1b PE=1 SV=2 27 409 6.0E-66
sp|Q8VCH0|THIKB_MOUSE 3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus GN=Acaa1b PE=1 SV=1 27 409 2.0E-65
sp|Q921H8|THIKA_MOUSE 3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus GN=Acaa1a PE=1 SV=1 27 409 3.0E-65
sp|B5FEW7|FADA_VIBFM 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain MJ11) GN=fadA PE=3 SV=1 25 410 6.0E-65
sp|Q5E8X7|FADA_VIBF1 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadA PE=3 SV=2 25 410 6.0E-65
sp|P33290|THIKA_CANTR 3-ketoacyl-CoA thiolase A, peroxisomal OS=Candida tropicalis PE=3 SV=1 27 410 9.0E-64
sp|Q43974|PCAF_ACIAD Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaF PE=1 SV=1 30 411 1.0E-63
sp|Q43935|CATF_ACIAD Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catF PE=3 SV=1 30 411 3.0E-63
sp|Q0VNZ7|FADA_ALCBS 3-ketoacyl-CoA thiolase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=fadA PE=3 SV=1 27 411 6.0E-63
sp|Q51956|PCAF_PSEPU Beta-ketoadipyl-CoA thiolase OS=Pseudomonas putida GN=pcaF PE=3 SV=1 27 411 7.0E-63
sp|Q2SD23|FADA_HAHCH 3-ketoacyl-CoA thiolase OS=Hahella chejuensis (strain KCTC 2396) GN=fadA PE=3 SV=1 27 411 1.0E-61
sp|A1TZR8|FADA_MARHV 3-ketoacyl-CoA thiolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=fadA PE=3 SV=1 42 411 3.0E-61
sp|Q56WD9|THIK2_ARATH 3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana GN=PED1 PE=1 SV=2 27 410 7.0E-60
sp|B2VFE0|FADA_ERWT9 3-ketoacyl-CoA thiolase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=fadA PE=3 SV=1 25 411 4.0E-59
sp|Q8LF48|THIK1_ARATH 3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana GN=KAT1 PE=2 SV=2 27 410 9.0E-59
sp|A6VVM8|FADA_MARMS 3-ketoacyl-CoA thiolase OS=Marinomonas sp. (strain MWYL1) GN=fadA PE=3 SV=1 27 411 9.0E-59
sp|Q9F0Y6|FADA_ENTCL 3-ketoacyl-CoA thiolase OS=Enterobacter cloacae GN=fadA PE=3 SV=1 25 411 3.0E-58
sp|A6TGM3|FADA_KLEP7 3-ketoacyl-CoA thiolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadA PE=3 SV=1 25 411 3.0E-58
sp|A8G8D0|FADA_SERP5 3-ketoacyl-CoA thiolase OS=Serratia proteamaculans (strain 568) GN=fadA PE=3 SV=1 25 411 1.0E-57
sp|Q5QXH8|FADA_IDILO 3-ketoacyl-CoA thiolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadA PE=3 SV=1 25 411 1.0E-57
sp|P0A2H7|FADA_SALTY 3-ketoacyl-CoA thiolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadA PE=1 SV=1 25 411 2.0E-57
sp|P0A2H8|FADA_SALTI 3-ketoacyl-CoA thiolase OS=Salmonella typhi GN=fadA PE=3 SV=1 25 411 2.0E-57
sp|Q5PKQ3|FADA_SALPA 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadA PE=3 SV=1 25 411 2.0E-57
sp|Q1Q8K0|FADA_PSYCK 3-ketoacyl-CoA thiolase OS=Psychrobacter cryohalolentis (strain K5) GN=fadA PE=3 SV=1 27 411 2.0E-57
sp|Q8X8J4|FADA_ECO57 3-ketoacyl-CoA thiolase OS=Escherichia coli O157:H7 GN=fadA PE=3 SV=1 25 411 2.0E-57
sp|Q6DAP6|FADA_PECAS 3-ketoacyl-CoA thiolase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadA PE=3 SV=1 25 410 2.0E-57
sp|A7ZU50|FADA_ECO24 3-ketoacyl-CoA thiolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadA PE=3 SV=1 25 411 4.0E-57
sp|Q57HM7|FADA_SALCH 3-ketoacyl-CoA thiolase OS=Salmonella choleraesuis (strain SC-B67) GN=fadA PE=3 SV=1 25 411 5.0E-57
sp|Q4FQC7|FADA_PSYA2 3-ketoacyl-CoA thiolase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fadA PE=3 SV=1 27 411 5.0E-57
sp|Q3IJ24|FADA_PSEHT 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fadA PE=3 SV=1 29 411 8.0E-57
sp|Q6LW07|FADA_PHOPR 3-ketoacyl-CoA thiolase OS=Photobacterium profundum GN=fadA PE=3 SV=1 28 411 9.0E-57
sp|B7LTZ0|FADA_ESCF3 3-ketoacyl-CoA thiolase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadA PE=3 SV=1 25 411 1.0E-56
sp|A7MQM5|FADA_CROS8 3-ketoacyl-CoA thiolase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadA PE=3 SV=1 25 411 1.0E-56
sp|Q32A20|FADA_SHIDS 3-ketoacyl-CoA thiolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadA PE=3 SV=1 25 411 2.0E-56
sp|Q31UE3|FADA_SHIBS 3-ketoacyl-CoA thiolase OS=Shigella boydii serotype 4 (strain Sb227) GN=fadA PE=3 SV=1 25 411 2.0E-56
sp|A4STF3|FADA_AERS4 3-ketoacyl-CoA thiolase OS=Aeromonas salmonicida (strain A449) GN=fadA PE=3 SV=1 25 411 2.0E-56
sp|A1AI32|FADA_ECOK1 3-ketoacyl-CoA thiolase OS=Escherichia coli O1:K1 / APEC GN=fadA PE=3 SV=1 25 411 2.0E-56
sp|Q1R467|FADA_ECOUT 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain UTI89 / UPEC) GN=fadA PE=3 SV=1 25 411 4.0E-56
sp|Q570C8|THIK5_ARATH 3-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidopsis thaliana GN=KAT5 PE=2 SV=2 27 410 4.0E-56
sp|Q3K9D9|FADA_PSEPF 3-ketoacyl-CoA thiolase OS=Pseudomonas fluorescens (strain Pf0-1) GN=fadA PE=3 SV=1 27 411 5.0E-56
sp|A8ACZ3|FADA_CITK8 3-ketoacyl-CoA thiolase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadA PE=3 SV=1 25 411 6.0E-56
sp|A8A6V0|FADA_ECOHS 3-ketoacyl-CoA thiolase OS=Escherichia coli O9:H4 (strain HS) GN=fadA PE=3 SV=1 25 411 8.0E-56
sp|Q3YVC2|FADA_SHISS 3-ketoacyl-CoA thiolase OS=Shigella sonnei (strain Ss046) GN=fadA PE=3 SV=1 25 411 9.0E-56
sp|A1JIG3|FADA_YERE8 3-ketoacyl-CoA thiolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadA PE=3 SV=1 25 411 1.0E-55
sp|C6DI66|FADA_PECCP 3-ketoacyl-CoA thiolase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadA PE=3 SV=1 25 411 1.0E-55
sp|A0KEL0|FADA_AERHH 3-ketoacyl-CoA thiolase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadA PE=3 SV=1 25 411 1.0E-55
sp|Q4KFC3|FADA_PSEF5 3-ketoacyl-CoA thiolase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fadA PE=3 SV=1 27 411 3.0E-55
sp|Q0TAL1|FADA_ECOL5 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadA PE=3 SV=1 25 411 3.0E-55
sp|Q66FR9|FADA_YERPS 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadA PE=3 SV=1 25 411 4.0E-55
sp|A4TR28|FADA_YERPP 3-ketoacyl-CoA thiolase OS=Yersinia pestis (strain Pestoides F) GN=fadA PE=3 SV=1 25 411 4.0E-55
sp|Q1CNA0|FADA_YERPN 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadA PE=3 SV=1 25 411 4.0E-55
sp|Q8ZAM9|FADA_YERPE 3-ketoacyl-CoA thiolase OS=Yersinia pestis GN=fadA PE=3 SV=1 25 411 4.0E-55
sp|Q1C2C3|FADA_YERPA 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadA PE=3 SV=1 25 411 4.0E-55
sp|A7FDF1|FADA_YERP3 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadA PE=3 SV=1 25 411 4.0E-55
sp|Q8FBI3|FADA_ECOL6 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadA PE=3 SV=1 25 411 4.0E-55
sp|Q83PG2|FADA_SHIFL 3-ketoacyl-CoA thiolase OS=Shigella flexneri GN=fadA PE=3 SV=1 25 411 4.0E-55
sp|Q0SZ35|FADA_SHIF8 3-ketoacyl-CoA thiolase OS=Shigella flexneri serotype 5b (strain 8401) GN=fadA PE=3 SV=1 25 411 4.0E-55
sp|P21151|FADA_ECOLI 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12) GN=fadA PE=1 SV=3 25 411 5.0E-55
sp|A5WH98|FADA_PSYWF 3-ketoacyl-CoA thiolase OS=Psychrobacter sp. (strain PRwf-1) GN=fadA PE=3 SV=1 27 411 6.0E-55
sp|Q87ZB3|FADA_PSESM 3-ketoacyl-CoA thiolase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadA PE=3 SV=1 27 411 6.0E-55
sp|A4WFX5|FADA_ENT38 3-ketoacyl-CoA thiolase OS=Enterobacter sp. (strain 638) GN=fadA PE=3 SV=1 25 411 1.0E-54
sp|Q7MZ91|FADA_PHOLL 3-ketoacyl-CoA thiolase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadA PE=3 SV=1 25 411 2.0E-54
sp|P28790|FADA_PSEFR 3-ketoacyl-CoA thiolase OS=Pseudomonas fragi GN=fadA PE=1 SV=2 27 411 3.0E-54
sp|Q48GW4|FADA_PSE14 3-ketoacyl-CoA thiolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadA PE=3 SV=1 27 411 5.0E-54
sp|Q4ZRA1|FADA_PSEU2 3-ketoacyl-CoA thiolase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadA PE=3 SV=1 27 411 5.0E-54
sp|Q9HZJ3|FADA_PSEAE 3-ketoacyl-CoA thiolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadA PE=3 SV=1 27 411 2.0E-53
sp|Q02PH7|FADA_PSEAB 3-ketoacyl-CoA thiolase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadA PE=3 SV=1 27 411 2.0E-53
sp|A6V383|FADA_PSEA7 3-ketoacyl-CoA thiolase OS=Pseudomonas aeruginosa (strain PA7) GN=fadA PE=3 SV=1 27 411 2.0E-53
sp|B2VJ10|FADI_ERWT9 3-ketoacyl-CoA thiolase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=fadI PE=3 SV=1 16 379 6.0E-53
sp|Q489W4|FADA_COLP3 3-ketoacyl-CoA thiolase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fadA PE=3 SV=1 27 411 8.0E-53
sp|O46629|ECHB_BOVIN Trifunctional enzyme subunit beta, mitochondrial OS=Bos taurus GN=HADHB PE=2 SV=1 19 409 8.0E-53
sp|Q5R1W7|ECHB_PANTR Trifunctional enzyme subunit beta, mitochondrial OS=Pan troglodytes GN=HADHB PE=2 SV=1 19 409 8.0E-53
sp|A5W6G9|FADA_PSEP1 3-ketoacyl-CoA thiolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fadA PE=3 SV=1 27 411 9.0E-53
sp|P55084|ECHB_HUMAN Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens GN=HADHB PE=1 SV=3 19 409 1.0E-52
sp|Q88L01|FADA_PSEPK 3-ketoacyl-CoA thiolase OS=Pseudomonas putida (strain KT2440) GN=fadA PE=3 SV=1 27 411 1.0E-52
sp|Q8DDK5|FADA_VIBVU 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain CMCP6) GN=fadA PE=3 SV=1 28 410 1.0E-52
sp|Q8HXX4|ECHB_MACFA Trifunctional enzyme subunit beta, mitochondrial OS=Macaca fascicularis GN=HADHB PE=2 SV=1 19 409 1.0E-52
sp|Q7MQI0|FADA_VIBVY 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain YJ016) GN=fadA PE=3 SV=1 28 410 2.0E-52
sp|A1JK23|FADI_YERE8 3-ketoacyl-CoA thiolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadI PE=3 SV=1 16 379 2.0E-52
sp|Q87TP0|FADA_VIBPA 3-ketoacyl-CoA thiolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadA PE=3 SV=1 23 410 2.0E-52
sp|Q21KB1|FADA_SACD2 3-ketoacyl-CoA thiolase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=fadA PE=3 SV=1 22 411 3.0E-52
sp|A4VKA4|FADA_PSEU5 3-ketoacyl-CoA thiolase OS=Pseudomonas stutzeri (strain A1501) GN=fadA PE=3 SV=1 27 411 4.0E-52
sp|Q93Q11|FADA_PSEOL 3-ketoacyl-CoA thiolase OS=Pseudomonas oleovorans GN=fadA PE=3 SV=1 27 411 4.0E-52
sp|Q9R9W0|FADA_PSEPU 3-ketoacyl-CoA thiolase OS=Pseudomonas putida GN=fadA PE=3 SV=1 27 411 5.0E-52
sp|A3Q8U3|FADA_SHELP 3-ketoacyl-CoA thiolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadA PE=3 SV=1 25 410 9.0E-52
sp|Q1I7D5|FADA_PSEE4 3-ketoacyl-CoA thiolase OS=Pseudomonas entomophila (strain L48) GN=fadA PE=3 SV=1 27 411 9.0E-52
sp|Q99JY0|ECHB_MOUSE Trifunctional enzyme subunit beta, mitochondrial OS=Mus musculus GN=Hadhb PE=1 SV=1 4 409 1.0E-51
sp|A1RI91|FADI_SHESW 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain W3-18-1) GN=fadI PE=3 SV=1 28 409 2.0E-51
sp|A9KTW7|FADI_SHEB9 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS195) GN=fadI PE=3 SV=1 28 409 2.0E-51
sp|A3D685|FADI_SHEB5 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadI PE=3 SV=1 28 409 2.0E-51
sp|B8EE97|FADI_SHEB2 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS223) GN=fadI PE=3 SV=1 28 409 2.0E-51
sp|A6WQ26|FADI_SHEB8 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS185) GN=fadI PE=3 SV=1 28 409 3.0E-51
sp|P27796|THIK_YEAST 3-ketoacyl-CoA thiolase, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POT1 PE=1 SV=1 27 408 3.0E-51
sp|A8GH87|FADI_SERP5 3-ketoacyl-CoA thiolase OS=Serratia proteamaculans (strain 568) GN=fadI PE=3 SV=1 16 387 3.0E-51
sp|Q05493|THIK_YARLI 3-ketoacyl-CoA thiolase, peroxisomal OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=POT1 PE=3 SV=1 27 408 4.0E-51
sp|A4Y898|FADI_SHEPC 3-ketoacyl-CoA thiolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadI PE=3 SV=1 28 409 5.0E-51
sp|Q60587|ECHB_RAT Trifunctional enzyme subunit beta, mitochondrial OS=Rattus norvegicus GN=Hadhb PE=1 SV=1 8 409 5.0E-51
sp|A4XSM9|FADA_PSEMY 3-ketoacyl-CoA thiolase OS=Pseudomonas mendocina (strain ymp) GN=fadA PE=3 SV=1 27 411 7.0E-51
sp|A6TC20|FADI_KLEP7 3-ketoacyl-CoA thiolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadI PE=3 SV=1 16 387 1.0E-50
sp|Q47ZB6|FADI_COLP3 3-ketoacyl-CoA thiolase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fadI PE=3 SV=1 28 386 1.0E-50
sp|B7LLC9|FADI_ESCF3 3-ketoacyl-CoA thiolase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadI PE=3 SV=1 16 387 1.0E-50
sp|B7NP25|FADI_ECO7I 3-ketoacyl-CoA thiolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadI PE=3 SV=1 16 387 2.0E-50
sp|Q57LW5|FADI_SALCH 3-ketoacyl-CoA thiolase OS=Salmonella choleraesuis (strain SC-B67) GN=fadI PE=3 SV=1 16 387 2.0E-50
sp|B6I6Q5|FADI_ECOSE 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain SE11) GN=fadI PE=3 SV=1 16 387 2.0E-50
sp|B7M6M3|FADI_ECO8A 3-ketoacyl-CoA thiolase OS=Escherichia coli O8 (strain IAI1) GN=fadI PE=3 SV=1 16 387 2.0E-50
sp|A7ZPF9|FADI_ECO24 3-ketoacyl-CoA thiolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadI PE=3 SV=1 16 387 2.0E-50
sp|B5XVW1|FADI_KLEP3 3-ketoacyl-CoA thiolase OS=Klebsiella pneumoniae (strain 342) GN=fadI PE=3 SV=1 16 387 2.0E-50
sp|A4WCW7|FADI_ENT38 3-ketoacyl-CoA thiolase OS=Enterobacter sp. (strain 638) GN=fadI PE=3 SV=1 16 387 2.0E-50
sp|A8A2L1|FADI_ECOHS 3-ketoacyl-CoA thiolase OS=Escherichia coli O9:H4 (strain HS) GN=fadI PE=3 SV=1 16 387 3.0E-50
sp|B7LBJ6|FADI_ECO55 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain 55989 / EAEC) GN=fadI PE=3 SV=1 16 387 3.0E-50
sp|A9MJ36|FADI_SALAR 3-ketoacyl-CoA thiolase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=fadI PE=3 SV=1 16 387 3.0E-50
sp|B2TWV5|FADI_SHIB3 3-ketoacyl-CoA thiolase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadI PE=3 SV=1 16 387 3.0E-50
sp|A5F464|FADA_VIBC3 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadA PE=3 SV=1 28 410 3.0E-50
sp|B7UFZ9|FADI_ECO27 3-ketoacyl-CoA thiolase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadI PE=3 SV=1 16 387 4.0E-50
sp|B5FGB5|FADI_VIBFM 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain MJ11) GN=fadI PE=3 SV=1 15 387 4.0E-50
sp|Q1R971|FADI_ECOUT 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain UTI89 / UPEC) GN=fadI PE=3 SV=1 16 387 4.0E-50
sp|Q0TFA5|FADI_ECOL5 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadI PE=3 SV=1 16 387 4.0E-50
sp|A1ADI9|FADI_ECOK1 3-ketoacyl-CoA thiolase OS=Escherichia coli O1:K1 / APEC GN=fadI PE=3 SV=1 16 387 4.0E-50
sp|B7MGV8|FADI_ECO45 3-ketoacyl-CoA thiolase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadI PE=3 SV=1 16 387 4.0E-50
sp|B4SZR1|FADI_SALNS 3-ketoacyl-CoA thiolase OS=Salmonella newport (strain SL254) GN=fadI PE=3 SV=1 16 387 4.0E-50
sp|Q9KNI0|FADA_VIBCH 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadA PE=3 SV=1 28 410 4.0E-50
sp|B4TQC3|FADI_SALSV 3-ketoacyl-CoA thiolase OS=Salmonella schwarzengrund (strain CVM19633) GN=fadI PE=3 SV=1 16 387 5.0E-50
sp|A9N452|FADI_SALPB 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadI PE=3 SV=1 16 387 5.0E-50
sp|B1IXA4|FADI_ECOLC 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadI PE=3 SV=1 16 387 5.0E-50
sp|B5R3S0|FADI_SALEP 3-ketoacyl-CoA thiolase OS=Salmonella enteritidis PT4 (strain P125109) GN=fadI PE=3 SV=1 16 387 5.0E-50
sp|B5FPN2|FADI_SALDC 3-ketoacyl-CoA thiolase OS=Salmonella dublin (strain CT_02021853) GN=fadI PE=3 SV=1 16 387 5.0E-50
sp|B5EZS0|FADI_SALA4 3-ketoacyl-CoA thiolase OS=Salmonella agona (strain SL483) GN=fadI PE=3 SV=1 16 387 5.0E-50
sp|Q0HPB8|FADA_SHESM 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-4) GN=fadA PE=3 SV=1 25 411 6.0E-50
sp|Q0I0T4|FADA_SHESR 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-7) GN=fadA PE=3 SV=1 25 411 7.0E-50
sp|B5BBA0|FADI_SALPK 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi A (strain AKU_12601) GN=fadI PE=3 SV=1 16 387 7.0E-50
sp|Q5PCX7|FADI_SALPA 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadI PE=3 SV=1 16 387 7.0E-50
sp|Q83K95|FADI_SHIFL 3-ketoacyl-CoA thiolase OS=Shigella flexneri GN=fadI PE=3 SV=1 16 387 7.0E-50
sp|Q8ZNA6|FADI_SALTY 3-ketoacyl-CoA thiolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadI PE=3 SV=1 16 387 8.0E-50
sp|B4TCA9|FADI_SALHS 3-ketoacyl-CoA thiolase OS=Salmonella heidelberg (strain SL476) GN=fadI PE=3 SV=1 16 387 9.0E-50
sp|B7N5V3|FADI_ECOLU 3-ketoacyl-CoA thiolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadI PE=3 SV=1 16 387 9.0E-50
sp|P76503|FADI_ECOLI 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12) GN=fadI PE=1 SV=1 16 387 9.0E-50
sp|B1X9L5|FADI_ECODH 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12 / DH10B) GN=fadI PE=3 SV=1 16 387 9.0E-50
sp|C4ZVN3|FADI_ECOBW 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadI PE=3 SV=1 16 387 9.0E-50
sp|Q8EKS0|FADA_SHEON 3-ketoacyl-CoA thiolase OS=Shewanella oneidensis (strain MR-1) GN=fadA PE=3 SV=1 25 411 9.0E-50
sp|Q8Z4Y9|FADI_SALTI 3-ketoacyl-CoA thiolase OS=Salmonella typhi GN=fadI PE=3 SV=1 16 387 1.0E-49
sp|Q0T2E5|FADI_SHIF8 3-ketoacyl-CoA thiolase OS=Shigella flexneri serotype 5b (strain 8401) GN=fadI PE=3 SV=1 16 387 1.0E-49
sp|B1LME8|FADI_ECOSM 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadI PE=3 SV=1 16 387 1.0E-49
sp|B8CPY7|FADI_SHEPW 3-ketoacyl-CoA thiolase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fadI PE=3 SV=1 12 387 1.0E-49
sp|Q5E3U0|FADI_VIBF1 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadI PE=3 SV=1 15 387 1.0E-49
sp|O53871|Y0859_MYCTU Putative acyltransferase Rv0859 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadA PE=1 SV=1 27 411 2.0E-49
sp|A0KR49|FADA_SHESA 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain ANA-3) GN=fadA PE=3 SV=1 25 411 2.0E-49
sp|Q8FFG3|FADI_ECOL6 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadI PE=3 SV=1 16 387 2.0E-49
sp|P34255|YKA3_CAEEL Uncharacterized protein B0303.3 OS=Caenorhabditis elegans GN=B0303.3 PE=3 SV=1 3 409 2.0E-49
sp|Q07ZP7|FADI_SHEFN 3-ketoacyl-CoA thiolase OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadI PE=3 SV=1 28 387 2.0E-49
sp|A8H5T2|FADI_SHEPA 3-ketoacyl-CoA thiolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fadI PE=3 SV=1 28 387 3.0E-49
sp|A8ADP1|FADI_CITK8 3-ketoacyl-CoA thiolase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadI PE=3 SV=1 16 387 4.0E-49
sp|B7MY17|FADI_ECO81 3-ketoacyl-CoA thiolase OS=Escherichia coli O81 (strain ED1a) GN=fadI PE=3 SV=1 16 387 4.0E-49
sp|C0PZX5|FADI_SALPC 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi C (strain RKS4594) GN=fadI PE=3 SV=1 16 387 8.0E-49
sp|B0TL22|FADI_SHEHH 3-ketoacyl-CoA thiolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadI PE=3 SV=1 28 387 8.0E-49
sp|B5YXY5|FADI_ECO5E 3-ketoacyl-CoA thiolase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadI PE=3 SV=1 16 387 9.0E-49
sp|Q8XCN9|FADI_ECO57 3-ketoacyl-CoA thiolase OS=Escherichia coli O157:H7 GN=fadI PE=3 SV=1 16 387 9.0E-49
sp|Q31YB6|FADI_SHIBS 3-ketoacyl-CoA thiolase OS=Shigella boydii serotype 4 (strain Sb227) GN=fadI PE=3 SV=1 16 387 1.0E-48
sp|Q15VA3|FADI_PSEA6 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=fadI PE=3 SV=1 28 386 1.0E-48
sp|B4RTU9|FADI_ALTMD 3-ketoacyl-CoA thiolase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=fadI PE=3 SV=1 28 386 1.0E-48
sp|Q32DJ3|FADI_SHIDS 3-ketoacyl-CoA thiolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadI PE=3 SV=1 16 387 2.0E-48
sp|A9R7W9|FADI_YERPG 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fadI PE=3 SV=1 16 379 2.0E-48
sp|Q3YZM1|FADI_SHISS 3-ketoacyl-CoA thiolase OS=Shigella sonnei (strain Ss046) GN=fadI PE=3 SV=1 16 387 2.0E-48
sp|A3M1H9|FADA_ACIBT 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=fadA PE=3 SV=2 27 411 3.0E-48
sp|Q7A1P9|VRAB_STAAW Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain MW2) GN=vraB PE=3 SV=1 27 411 3.0E-48
sp|Q7A768|VRAB_STAAN Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain N315) GN=vraB PE=3 SV=1 27 411 3.0E-48
sp|Q7A2W9|VRAB_STAAM Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=vraB PE=3 SV=1 27 411 3.0E-48
sp|Q9KWK4|VRAB_STAA1 Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=vraB PE=3 SV=1 27 411 3.0E-48
sp|Q0HWN4|FADI_SHESR 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-7) GN=fadI PE=3 SV=1 28 387 4.0E-48
sp|Q0HKD2|FADI_SHESM 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-4) GN=fadI PE=3 SV=1 28 387 4.0E-48
sp|A0KV75|FADI_SHESA 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain ANA-3) GN=fadI PE=3 SV=1 28 387 4.0E-48
sp|A4Y1B5|FADA_SHEPC 3-ketoacyl-CoA thiolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadA PE=3 SV=1 25 411 4.0E-48
sp|A6WH99|FADA_SHEB8 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS185) GN=fadA PE=3 SV=1 25 411 4.0E-48
sp|Q6FF69|FADA_ACIAD 3-ketoacyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fadA PE=3 SV=1 27 411 5.0E-48
sp|Q6GBR1|VRAB_STAAS Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain MSSA476) GN=vraB PE=3 SV=1 27 411 5.0E-48
sp|A7MH80|FADI_CROS8 3-ketoacyl-CoA thiolase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadI PE=3 SV=1 16 387 5.0E-48
sp|B0VE46|FADA_ACIBY 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AYE) GN=fadA PE=3 SV=1 27 411 5.0E-48
sp|B0VLX5|FADA_ACIBS 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain SDF) GN=fadA PE=3 SV=1 27 411 5.0E-48
sp|B2I2J8|FADA_ACIBC 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ACICU) GN=fadA PE=3 SV=1 27 411 5.0E-48
sp|B7I3P0|FADA_ACIB5 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB0057) GN=fadA PE=3 SV=1 27 411 5.0E-48
sp|B7H1I1|FADA_ACIB3 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB307-0294) GN=fadA PE=3 SV=1 27 411 5.0E-48
sp|Q8ECP6|FADI_SHEON 3-ketoacyl-CoA thiolase OS=Shewanella oneidensis (strain MR-1) GN=fadI PE=3 SV=1 28 387 9.0E-48
sp|Q12TB5|FADA_SHEDO 3-ketoacyl-CoA thiolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fadA PE=3 SV=1 25 411 9.0E-48
sp|A3CYJ3|FADA_SHEB5 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadA PE=3 SV=1 25 411 9.0E-48
sp|Q7N287|FADI_PHOLL 3-ketoacyl-CoA thiolase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadI PE=3 SV=1 14 409 1.0E-47
sp|Q5HIA0|VRAB_STAAC Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain COL) GN=vraB PE=3 SV=1 27 411 1.0E-47
sp|B1JGG1|FADI_YERPY 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fadI PE=3 SV=1 16 379 1.0E-47
sp|Q668V0|FADI_YERPS 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadI PE=3 SV=1 16 379 1.0E-47
sp|A4TM83|FADI_YERPP 3-ketoacyl-CoA thiolase OS=Yersinia pestis (strain Pestoides F) GN=fadI PE=3 SV=1 16 379 1.0E-47
sp|Q1CHK1|FADI_YERPN 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadI PE=3 SV=1 16 379 1.0E-47
sp|Q8ZD46|FADI_YERPE 3-ketoacyl-CoA thiolase OS=Yersinia pestis GN=fadI PE=3 SV=1 16 379 1.0E-47
sp|B2K8J6|FADI_YERPB 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fadI PE=3 SV=1 16 379 1.0E-47
sp|Q1C659|FADI_YERPA 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadI PE=3 SV=1 16 379 1.0E-47
sp|A7FGK0|FADI_YERP3 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadI PE=3 SV=1 16 379 1.0E-47
sp|Q08A40|FADA_SHEFN 3-ketoacyl-CoA thiolase OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadA PE=3 SV=1 25 411 2.0E-47
sp|O07618|YHFS_BACSU Putative acetyl-CoA C-acetyltransferase YhfS OS=Bacillus subtilis (strain 168) GN=yhfS PE=2 SV=1 29 387 3.0E-47
sp|A3QFP4|FADI_SHELP 3-ketoacyl-CoA thiolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadI PE=3 SV=1 28 387 4.0E-47
sp|A1RDW3|FADA_SHESW 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain W3-18-1) GN=fadA PE=3 SV=1 25 411 6.0E-47
sp|A1S7L7|FADI_SHEAM 3-ketoacyl-CoA thiolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadI PE=3 SV=1 28 387 6.0E-47
sp|Q6D2L6|FADI_PECAS 3-ketoacyl-CoA thiolase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadI PE=3 SV=1 16 379 8.0E-47
sp|A0KK76|FADI_AERHH 3-ketoacyl-CoA thiolase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadI PE=3 SV=1 28 384 8.0E-47
sp|Q12P12|FADI_SHEDO 3-ketoacyl-CoA thiolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fadI PE=3 SV=1 27 387 9.0E-47
sp|A1S1I7|FADA_SHEAM 3-ketoacyl-CoA thiolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadA PE=3 SV=1 25 411 9.0E-47
sp|Q6GJ93|VRAB_STAAR Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain MRSA252) GN=vraB PE=3 SV=1 27 411 1.0E-46
sp|A4SMT9|FADI_AERS4 3-ketoacyl-CoA thiolase OS=Aeromonas salmonicida (strain A449) GN=fadI PE=3 SV=1 28 384 1.0E-46
sp|C6DAL8|FADI_PECCP 3-ketoacyl-CoA thiolase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadI PE=3 SV=1 16 379 2.0E-46
sp|Q6LTK4|FADI_PHOPR 3-ketoacyl-CoA thiolase OS=Photobacterium profundum GN=fadI PE=3 SV=1 24 387 2.0E-46
sp|A5F2P1|FADI_VIBC3 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadI PE=3 SV=2 28 387 4.0E-46
sp|Q9KT59|FADI_VIBCH 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadI PE=3 SV=2 28 387 6.0E-46
sp|B1KKT1|FADI_SHEWM 3-ketoacyl-CoA thiolase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fadI PE=3 SV=1 28 387 7.0E-46
sp|Q5HRH3|VRAB_STAEQ Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=vraB PE=3 SV=1 29 384 1.0E-45
sp|Q15ZF4|FADA_PSEA6 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=fadA PE=3 SV=1 25 411 3.0E-45
sp|A8FTR6|FADI_SHESH 3-ketoacyl-CoA thiolase OS=Shewanella sediminis (strain HAW-EB3) GN=fadI PE=3 SV=1 28 387 4.0E-45
sp|Q1QUW9|FADA_CHRSD 3-ketoacyl-CoA thiolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fadA PE=3 SV=1 27 411 7.0E-45
sp|Q8CTR0|VRAB_STAES Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=vraB PE=3 SV=1 29 384 2.0E-44
sp|Q3IEE3|FADI_PSEHT 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fadI PE=3 SV=1 28 387 1.0E-43
sp|Q5QXN5|FADI_IDILO 3-ketoacyl-CoA thiolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadI PE=3 SV=1 28 387 2.0E-42
sp|Q87MM2|FADI_VIBPA 3-ketoacyl-CoA thiolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadI PE=3 SV=1 28 387 3.0E-40
sp|Q8DB48|FADI_VIBVU 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain CMCP6) GN=fadI PE=3 SV=1 24 387 2.0E-39
sp|Q7MIS4|FADI_VIBVY 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain YJ016) GN=fadI PE=3 SV=1 24 387 7.0E-39
sp|Q4L3Q1|VRAB_STAHJ Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus haemolyticus (strain JCSC1435) GN=vraB PE=3 SV=1 25 410 5.0E-38
sp|P45362|THL_PEPDI Acetyl-CoA acetyltransferase (Fragment) OS=Peptoclostridium difficile GN=thi PE=3 SV=2 27 118 2.0E-19
sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 51 387 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|073630
MLLARFVSASRIPSRPFLTRAMSQIPEVVIVSAVRTPVASFNGTLKSFTAPQLGTIALKGALEKGNVDPAIVEEI
YFGNVVQAGVGQSPARQVALASGLKSSSDATTINKVCASGMKSIMLGAQSIQLGQRSVVAAGGMESMSNAPFLLP
RQNPAFGKFTTRDSLEADGLWDVYNDFAMGNCGENAAEKYQIDRQSQDSHAIESYKRAARAWEAGAFDAEIIPIT
VKGKKGDTIVREDEEYKRVIFDKVPSLRSAFKKDGTITAANSSPISDGASALILMSAEKASELGLKPLAKVISYA
DAGTEPIDFPAAPTVALPIALERAGLTVNDISLFEINEAFSIVVRIAEKVLNIPAEKINVNGGAVALGHAIGNSG
SRIIVSLVHALKPGQYGAAGICNGGGAASSLIIQRL*
Coding >AgabiH97|073630
ATGCTGCTTGCGCGTTTTGTTTCTGCATCTCGCATCCCCTCCCGTCCCTTCTTGACACGAGCCATGTCTCAAATT
CCCGAAGTTGTCATTGTCTCTGCCGTTCGCACCCCAGTGGCCTCCTTTAACGGCACTTTGAAGTCATTTACAGCC
CCTCAACTTGGGACTATCGCCCTGAAAGGCGCTTTAGAGAAAGGAAACGTTGATCCGGCCATAGTCGAGGAAATC
TACTTTGGCAATGTGGTCCAGGCAGGTGTCGGTCAATCACCCGCTCGCCAAGTGGCTCTCGCTTCTGGTCTCAAG
TCAAGTTCCGATGCCACAACAATCAACAAGGTCTGCGCGAGTGGAATGAAATCAATCATGTTGGGTGCTCAAAGC
ATTCAACTTGGCCAACGTTCCGTCGTCGCCGCCGGTGGAATGGAAAGCATGAGCAATGCGCCCTTCCTCCTTCCT
CGTCAAAACCCTGCATTCGGCAAGTTCACAACTCGAGATTCACTCGAGGCGGACGGGCTCTGGGATGTGTACAAT
GATTTCGCCATGGGCAACTGTGGTGAGAATGCCGCAGAGAAATATCAAATCGATCGCCAATCTCAAGACTCGCAT
GCTATCGAATCTTACAAGCGCGCAGCCCGCGCTTGGGAAGCCGGTGCATTTGACGCTGAAATCATTCCCATCACT
GTGAAAGGAAAGAAGGGTGACACTATTGTGCGCGAAGACGAAGAGTACAAACGTGTCATCTTCGACAAAGTTCCT
TCGTTGCGCTCCGCTTTCAAGAAAGATGGCACTATTACAGCGGCCAATTCTTCGCCTATCAGTGATGGTGCTTCG
GCTCTTATTCTCATGTCGGCAGAAAAAGCTTCAGAGCTTGGTCTAAAACCCCTAGCCAAGGTCATTTCTTATGCC
GATGCTGGCACTGAACCCATCGATTTCCCTGCCGCTCCCACTGTCGCTCTCCCAATTGCCCTCGAGAGAGCTGGC
CTCACTGTCAACGATATTTCTCTCTTCGAAATCAACGAGGCTTTCTCCATCGTTGTTCGCATCGCTGAGAAAGTT
CTCAACATTCCTGCAGAGAAGATTAACGTCAACGGTGGTGCTGTCGCCCTTGGTCATGCTATTGGCAACTCTGGC
TCGCGTATCATCGTTTCCCTTGTGCATGCGTTGAAACCCGGACAATATGGTGCTGCTGGTATTTGCAATGGAGGG
GGTGCCGCATCTTCTCTCATTATCCAAAGGCTCTGA
Transcript >AgabiH97|073630
ATGCTGCTTGCGCGTTTTGTTTCTGCATCTCGCATCCCCTCCCGTCCCTTCTTGACACGAGCCATGTCTCAAATT
CCCGAAGTTGTCATTGTCTCTGCCGTTCGCACCCCAGTGGCCTCCTTTAACGGCACTTTGAAGTCATTTACAGCC
CCTCAACTTGGGACTATCGCCCTGAAAGGCGCTTTAGAGAAAGGAAACGTTGATCCGGCCATAGTCGAGGAAATC
TACTTTGGCAATGTGGTCCAGGCAGGTGTCGGTCAATCACCCGCTCGCCAAGTGGCTCTCGCTTCTGGTCTCAAG
TCAAGTTCCGATGCCACAACAATCAACAAGGTCTGCGCGAGTGGAATGAAATCAATCATGTTGGGTGCTCAAAGC
ATTCAACTTGGCCAACGTTCCGTCGTCGCCGCCGGTGGAATGGAAAGCATGAGCAATGCGCCCTTCCTCCTTCCT
CGTCAAAACCCTGCATTCGGCAAGTTCACAACTCGAGATTCACTCGAGGCGGACGGGCTCTGGGATGTGTACAAT
GATTTCGCCATGGGCAACTGTGGTGAGAATGCCGCAGAGAAATATCAAATCGATCGCCAATCTCAAGACTCGCAT
GCTATCGAATCTTACAAGCGCGCAGCCCGCGCTTGGGAAGCCGGTGCATTTGACGCTGAAATCATTCCCATCACT
GTGAAAGGAAAGAAGGGTGACACTATTGTGCGCGAAGACGAAGAGTACAAACGTGTCATCTTCGACAAAGTTCCT
TCGTTGCGCTCCGCTTTCAAGAAAGATGGCACTATTACAGCGGCCAATTCTTCGCCTATCAGTGATGGTGCTTCG
GCTCTTATTCTCATGTCGGCAGAAAAAGCTTCAGAGCTTGGTCTAAAACCCCTAGCCAAGGTCATTTCTTATGCC
GATGCTGGCACTGAACCCATCGATTTCCCTGCCGCTCCCACTGTCGCTCTCCCAATTGCCCTCGAGAGAGCTGGC
CTCACTGTCAACGATATTTCTCTCTTCGAAATCAACGAGGCTTTCTCCATCGTTGTTCGCATCGCTGAGAAAGTT
CTCAACATTCCTGCAGAGAAGATTAACGTCAACGGTGGTGCTGTCGCCCTTGGTCATGCTATTGGCAACTCTGGC
TCGCGTATCATCGTTTCCCTTGTGCATGCGTTGAAACCCGGACAATATGGTGCTGCTGGTATTTGCAATGGAGGG
GGTGCCGCATCTTCTCTCATTATCCAAAGGCTCTGA
Gene >AgabiH97|073630
ATGCTGCTTGCGCGTTTTGTTTCTGCATCTCGCATCCCCTCCCGTCCCTTCTTGACACGAGCCATGGTACGTTTC
CTCGATTGTACATCGTCCTGTATACTCATCCTTGTCTCCAGTCTCAAATTCCCGAAGTTGTCATTGTCTCTGCCG
TTCGCACCCCAGTGGCCTCCTTTAACGGCACTTTGAAGTCATTTACAGCCCCTCAACTTGGGACTATCGCCCTGA
AAGGCGCTTTAGAGAAAGGAAACGTTGATCCGGCCATAGTCGAGGAAATCTACTTTGGCAATGTGGTCCAGGCAG
GTGTCGGTCAATCACCCGCTCGCCAAGTGGCTCTCGCTTCTGGTCTCAAGTCAAGTTCCGATGCCACAACAATCA
ACAAGGTCTGCGCGAGTGGAATGAAATCAATCATGTTGGGTGCTCAAAGCATTCAACTTGGCCAACGTTCCGTCG
TCGCCGCCGGTGGAATGGAAAGCATGAGCAATGCGCCGTAAGTCCTTTTAGTTACGACGATACCGCAATCTCTAA
TGATCCACAGCTTCCTCCTTCCTCGTCAAAACCCTGCATTCGGCAAGTTCACAACTCGAGATTCACTCGAGGCGG
ACGGGCTCTGGGATGTGTACAATGATTTCGCCATGGGCAACTGTGGTGAGAATGCCGCAGAGAAATATCAAATCG
ATCGCCAATCTCAAGACTCGCATGCTATCGAATCTTACAAGCGCGCAGCCCGCGCTTGGGAAGCCGGTGCATTTG
ACGCTGAAATCATTCCCATCACTGTGAAAGGAAAGAAGGGTGACACTATTGTGCGCGAAGACGAAGAGTACAAAC
GTGTCATCTTCGACAAAGTTCCTTCGTTGCGCTCCGCTTTCAAGAAAGATGGCACTATTACAGCGGCCAATTCTT
CGCCTATCAGTGATGGTGCTTCGGCTCTTATTCTCATGTCGGCAGAAAAAGCTTCAGAGCTTGGTCTAAAACCCC
TAGCCAAGGTCATTTGTGAGTAGTAGGCTTTTCATCTAGTGTCTTTCAAGTTGTCCTCATCCATTCGTTTACCAG
CTTATGCCGATGCTGGCACTGAACCCATCGATTTCCCTGCCGCTCCCACTGTCGCTCTCCCAATTGCCCTCGAGA
GAGCTGGCCTCACTGTCAACGATATTTCTCTCTTCGAAATCAACGAGGCTTTCTCCATCGTTGTTCGCATCGCTG
AGAAAGTTCTCAACATTCCTGCAGAGAAGATTAACGTCAACGGGTGAGTAATCCGAGCTACTGTTTAAGTCATCT
TACTCAAGGATACGTAGTGGTGCTGTCGCCCTTGGTCATGCTATTGGCAACTCTGGCTCGCGTATCATCGTTTCC
CTTGTGCATGCGTTGAAACCCGGACAATATGGTGCTGCTGGTATTTGCAATGGAGTAAGTGCATTCATGTAACAA
TCAATCTACACTGCTGATTATGCGTTTCAGGGGGGTGCCGCATCTTCTCTCATTATCCAAAGGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail