Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|073360
Gene name
Locationscaffold_4:1931364..1932350
Strand-
Gene length (bp)986
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 7.6E-33 22 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR55|SNF7_CRYNB Vacuolar-sorting protein SNF7 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SNF7 PE=3 SV=1 2 219 1.0E-62
sp|P0CR54|SNF7_CRYNJ Vacuolar-sorting protein SNF7 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SNF7 PE=3 SV=1 2 219 1.0E-62
sp|Q9P7F7|SNF7_SCHPO Vacuolar-sorting protein snf7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf7 PE=3 SV=1 2 219 2.0E-39
sp|Q871Y8|SNF7_NEUCR Vacuolar-sorting protein snf7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vsp-3 PE=3 SV=1 2 219 1.0E-34
sp|P0C149|SNF7_MAGO7 Vacuolar-sorting protein SNF7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SNF7 PE=3 SV=1 2 219 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR55|SNF7_CRYNB Vacuolar-sorting protein SNF7 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SNF7 PE=3 SV=1 2 219 1.0E-62
sp|P0CR54|SNF7_CRYNJ Vacuolar-sorting protein SNF7 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SNF7 PE=3 SV=1 2 219 1.0E-62
sp|Q9P7F7|SNF7_SCHPO Vacuolar-sorting protein snf7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf7 PE=3 SV=1 2 219 2.0E-39
sp|Q871Y8|SNF7_NEUCR Vacuolar-sorting protein snf7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vsp-3 PE=3 SV=1 2 219 1.0E-34
sp|P0C149|SNF7_MAGO7 Vacuolar-sorting protein SNF7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SNF7 PE=3 SV=1 2 219 3.0E-34
sp|Q6BSH2|SNF7_DEBHA Vacuolar-sorting protein SNF7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SNF7 PE=3 SV=2 2 219 3.0E-32
sp|Q6FW96|SNF7_CANGA Vacuolar-sorting protein SNF7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF7 PE=3 SV=1 5 156 7.0E-26
sp|P39929|SNF7_YEAST Vacuolar-sorting protein SNF7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF7 PE=1 SV=1 1 147 5.0E-25
sp|Q753W3|SNF7_ASHGO Vacuolar-sorting protein SNF7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SNF7 PE=3 SV=1 2 156 9.0E-25
sp|Q5B5E0|SNF7_EMENI Vacuolar-sorting protein snf7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=snf7 PE=1 SV=1 5 184 3.0E-24
sp|Q5ABD0|SNF7_CANAL Vacuolar-sorting protein SNF7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SNF7 PE=3 SV=1 5 147 2.0E-23
sp|Q6CBS3|SNF7_YARLI Vacuolar-sorting protein SNF7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SNF7 PE=3 SV=1 5 219 7.0E-23
sp|Q6CJL0|SNF7_KLULA Vacuolar-sorting protein SNF7 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SNF7 PE=3 SV=1 5 147 2.0E-21
sp|Q6IQ73|CHM4C_DANRE Charged multivesicular body protein 4c OS=Danio rerio GN=chmp4c PE=2 SV=1 20 147 1.0E-19
sp|Q5ZHP5|CHM4B_CHICK Charged multivesicular body protein 4b OS=Gallus gallus GN=CHMP4B PE=2 SV=1 18 147 2.0E-19
sp|Q9H444|CHM4B_HUMAN Charged multivesicular body protein 4b OS=Homo sapiens GN=CHMP4B PE=1 SV=1 20 147 4.0E-19
sp|Q9D8B3|CHM4B_MOUSE Charged multivesicular body protein 4b OS=Mus musculus GN=Chmp4b PE=1 SV=2 20 147 4.0E-19
sp|Q7ZVC4|CHM4B_DANRE Charged multivesicular body protein 4b OS=Danio rerio GN=chmp4b PE=2 SV=1 20 147 5.0E-19
sp|Q6GL11|CHM4B_XENTR Charged multivesicular body protein 4b OS=Xenopus tropicalis GN=chmp4b PE=2 SV=1 10 147 1.0E-18
sp|Q5XGW6|CHM4B_XENLA Charged multivesicular body protein 4b OS=Xenopus laevis GN=chmp4b PE=2 SV=1 10 147 1.0E-18
sp|Q6GNN8|CHM4C_XENLA Charged multivesicular body protein 4c OS=Xenopus laevis GN=chmp4c PE=2 SV=1 11 147 2.0E-18
sp|O82197|VP321_ARATH Vacuolar protein sorting-associated protein 32 homolog 1 OS=Arabidopsis thaliana GN=VPS32.1 PE=1 SV=1 5 219 4.0E-18
sp|Q86H98|CHMP4_DICDI Charged multivesicular body protein 4 OS=Dictyostelium discoideum GN=chmp4 PE=3 SV=1 6 147 3.0E-17
sp|Q9D7F7|CHM4C_MOUSE Charged multivesicular body protein 4c OS=Mus musculus GN=Chmp4c PE=2 SV=1 2 147 5.0E-17
sp|Q96CF2|CHM4C_HUMAN Charged multivesicular body protein 4c OS=Homo sapiens GN=CHMP4C PE=1 SV=1 2 147 1.0E-16
sp|Q569C1|CHM4C_RAT Charged multivesicular body protein 4c OS=Rattus norvegicus GN=Chmp4c PE=2 SV=1 2 147 2.0E-16
sp|A2VDY3|CHM4A_BOVIN Charged multivesicular body protein 4a OS=Bos taurus GN=CHMP4A PE=2 SV=1 2 147 6.0E-16
sp|Q9BY43|CHM4A_HUMAN Charged multivesicular body protein 4a OS=Homo sapiens GN=CHMP4A PE=1 SV=3 2 147 1.0E-15
sp|P59074|CHM4P_HUMAN Putative charged multivesicular body protein 4B-like protein CHMP4BP1 OS=Homo sapiens GN=CHMP4BP1 PE=5 SV=1 32 147 1.0E-11
sp|Q9SZE4|VP322_ARATH Vacuolar protein sorting-associated protein 32 homolog 2 OS=Arabidopsis thaliana GN=VPS32.2 PE=1 SV=1 58 219 5.0E-09
sp|Q9VVI9|CHMP5_DROME Charged multivesicular body protein 5 OS=Drosophila melanogaster GN=Vps60 PE=1 SV=2 6 206 2.0E-07
sp|P0C0A3|CHMP6_MOUSE Charged multivesicular body protein 6 OS=Mus musculus GN=Chmp6 PE=1 SV=2 7 199 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|073360
MMASFMSYFGGRRDPKQAARDAIVGLRQQLQLLEKKEEHLQKKIDDEMVKARANAVSNKAAATAALKRKKAAELE
LDRLSATRLQLELQVNTLESANLNAETMAAMKKGADALKVIHGGTTPDKVADTMDSIHAEREVANEISTAIAANP
YADPTEDAELLQELNALEEDVLNERLAGADHVPVHVPPGAVKAPEAPKKVTVEDDEEAQLRELQAQLAL*
Coding >AgabiH97|073360
ATGATGGCTAGCTTTATGAGCTACTTTGGAGGACGCAGAGACCCCAAACAGGCTGCGCGAGACGCCATAGTTGGT
CTCCGACAGCAGTTACAACTTTTGGAGAAGAAAGAGGAACATCTCCAGAAGAAGATAGACGACGAGATGGTGAAA
GCGCGGGCTAATGCTGTTTCCAACAAAGCTGCCGCAACAGCAGCTCTCAAACGCAAAAAGGCCGCCGAACTCGAA
CTCGATCGTCTAAGTGCAACACGACTACAACTTGAACTCCAAGTAAACACCCTCGAATCAGCCAATCTCAATGCC
GAAACCATGGCAGCGATGAAGAAAGGCGCCGATGCGCTCAAAGTTATCCATGGAGGAACCACCCCCGATAAAGTT
GCCGATACTATGGATTCTATTCACGCAGAACGAGAAGTTGCGAATGAGATTTCGACGGCTATTGCAGCTAATCCT
TATGCTGACCCTACGGAAGATGCGGAATTACTCCAAGAGCTCAATGCGCTCGAGGAAGATGTGCTTAATGAACGT
TTGGCAGGCGCAGATCATGTTCCCGTGCATGTACCACCTGGCGCAGTCAAAGCCCCAGAAGCTCCGAAGAAGGTT
ACAGTGGAAGACGACGAGGAAGCTCAACTACGAGAACTACAAGCCCAATTAGCATTGTAA
Transcript >AgabiH97|073360
ATGATGGCTAGCTTTATGAGCTACTTTGGAGGACGCAGAGACCCCAAACAGGCTGCGCGAGACGCCATAGTTGGT
CTCCGACAGCAGTTACAACTTTTGGAGAAGAAAGAGGAACATCTCCAGAAGAAGATAGACGACGAGATGGTGAAA
GCGCGGGCTAATGCTGTTTCCAACAAAGCTGCCGCAACAGCAGCTCTCAAACGCAAAAAGGCCGCCGAACTCGAA
CTCGATCGTCTAAGTGCAACACGACTACAACTTGAACTCCAAGTAAACACCCTCGAATCAGCCAATCTCAATGCC
GAAACCATGGCAGCGATGAAGAAAGGCGCCGATGCGCTCAAAGTTATCCATGGAGGAACCACCCCCGATAAAGTT
GCCGATACTATGGATTCTATTCACGCAGAACGAGAAGTTGCGAATGAGATTTCGACGGCTATTGCAGCTAATCCT
TATGCTGACCCTACGGAAGATGCGGAATTACTCCAAGAGCTCAATGCGCTCGAGGAAGATGTGCTTAATGAACGT
TTGGCAGGCGCAGATCATGTTCCCGTGCATGTACCACCTGGCGCAGTCAAAGCCCCAGAAGCTCCGAAGAAGGTT
ACAGTGGAAGACGACGAGGAAGCTCAACTACGAGAACTACAAGCCCAATTAGCATTGTAA
Gene >AgabiH97|073360
ATGATGGCTAGCTTTATGAGCTACTTTGGAGGACGCAGAGACCCCAAACAGGCTGCGCGAGACGCCATAGTTGGT
CTCCGACAGCAGTTACAACTTTTGGAGAAGAAAGAGGAACATCTCCAGAAGAAGATAGACGACGAGATGGTGAAA
GCGCGGGCTAATGCTGTTTCCAACAAAGCTGGTGAGTTCCTTCACGCTACCATGGAATCTTGGTCGTGTTCTCGG
TGTACCGTCACTAACTCTCCATCCCTTTCAACCGCCGCCTTCTCGCAATTTATCCTTTGGATTGCTCTTGCTTCT
TTATCCACATCCTCGTACCGTACCTCCGGATTCTCGCATGAACACTACGTCTAAACCACACACTTCGGTCCACTG
CCATCAACAAAACAGCCGCAACAGCAGCTCTCAAACGCAAAAAGGCCGCCGAACTCGAACTCGATCGTCTAAGTG
CAACACGACTACAACTTGAACTCCAAGTAAACACCCTCGAATCAGCCAATCTCAATGCCGAAACCATGGCAGCGA
TGAAGAAAGGCGCCGATGCGCTCAAAGTTATCCATGGAGGAACCACCCCCGATAAAGTTGCCGATACTATGGATT
CTATTCACGCAGAACGAGAAGTTGCGAATGAGATTTCGACGGCTATTGCAGCTAATCCTTATGCTGACCCTACGG
AAGATGTGAGAAGTTCTCCCGCTCTTTCTTTCGTTCTTATCATTGAACGGTTTATCAGGCGGAATTACTCCAAGA
GCTCAATGCGCTCGAGGAAGATGTGCTTAATGAACGTTTGGCAGGCGCAGATCATGTTCCCGTGCATGTACCACC
TGGCGCAGTCAAAGCCCCAGAAGGTAAGCTCTCATATAGTACCGTCTTCATAAGCTACTGCCTCGTGTATTCACA
TCTTTTATCAAGCTCCGAAGAAGGTTACAGTGGAAGACGACGAGGAAGCTCAACTACGAGAACTACAAGCCCAAT
TAGCATTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail