Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|073320
Gene name
Locationscaffold_4:1924234..1925568
Strand-
Gene length (bp)1334
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13445 zf-RING_UBOX RING-type zinc-finger 4.3E-06 46 96
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 5.7E-05 46 98

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|073320
MDQDSNLAAVQLVRDAFCLSATDRARQFAEKLPILSKDDIPLEDYCPICLVPFLEILSLTRDTLDDPGVTKLEGC
GHIFCRRDLIEWVKTQHGNCPTCRFQFMPPDMVFGDDGSSDGGEYIPPSEGDEDFDIDFDYAESEFWATEDYEDD
LAISTISPEENMRREAMMQLWDDEDDASIADEVQESDDHEVFGEMEEFDYDQDPIETTQEVSDPLEVEMAHEPEH
DPFSCFDPVDELQHDPDYTPDDVDVPDEIEALGLEDDGCSDSMDPNLGGEVDWGLADGEHAPDDVNIRDEIEALN
ALEADGCSDSIDPNLEGEVDWDGDYTPDDVNIRDEIEALNALEADGCSDSIDPNLEGEVEWGSTVEDLGDSSFNE
VW*
Coding >AgabiH97|073320
ATGGACCAGGACTCGAATCTCGCAGCTGTGCAGCTTGTCCGCGATGCTTTCTGTCTCTCCGCCACCGACCGTGCA
AGACAGTTCGCTGAGAAGCTCCCTATCTTATCCAAGGACGACATTCCGCTCGAGGACTATTGCCCAATCTGCCTG
GTTCCGTTTTTAGAAATATTGAGTCTTACACGGGATACGCTGGATGATCCAGGTGTCACCAAGCTCGAAGGTTGT
GGTCATATCTTCTGTCGCAGAGACTTGATAGAATGGGTCAAGACACAACATGGAAACTGCCCTACCTGTCGTTTT
CAATTTATGCCTCCTGATATGGTATTCGGAGATGATGGTTCGTCTGACGGTGGCGAATATATTCCACCATCCGAA
GGTGACGAAGATTTCGATATCGATTTTGACTATGCGGAGTCAGAATTCTGGGCTACTGAGGACTATGAGGACGAC
CTTGCAATATCCACCATTTCTCCCGAAGAAAACATGCGTCGTGAAGCTATGATGCAACTATGGGATGACGAAGAT
GACGCAAGCATTGCCGACGAAGTCCAGGAGTCTGATGACCATGAAGTTTTCGGAGAAATGGAAGAATTCGACTAT
GACCAGGACCCTATAGAAACCACTCAAGAGGTTTCAGATCCTTTGGAAGTGGAAATGGCACATGAACCGGAACAC
GATCCGTTTTCATGTTTTGATCCGGTAGATGAACTTCAGCATGATCCGGATTATACGCCGGACGACGTTGATGTT
CCTGACGAAATAGAAGCGCTTGGCCTCGAAGATGATGGTTGCTCAGACTCGATGGATCCAAACCTGGGGGGAGAA
GTTGACTGGGGTTTGGCCGATGGGGAGCATGCGCCAGACGACGTCAATATCCGTGACGAAATAGAAGCATTGAAC
GCCCTCGAAGCTGACGGCTGCTCAGACTCGATAGATCCAAACCTGGAGGGAGAAGTTGACTGGGATGGTGATTAT
ACGCCAGATGACGTCAATATCCGTGACGAAATAGAAGCATTGAACGCCCTCGAAGCTGACGGCTGCTCAGACTCA
ATAGATCCAAACTTGGAGGGAGAAGTTGAATGGGGTTCTACAGTCGAGGATCTGGGCGACTCTTCTTTTAATGAA
GTATGGTAG
Transcript >AgabiH97|073320
ATGGACCAGGACTCGAATCTCGCAGCTGTGCAGCTTGTCCGCGATGCTTTCTGTCTCTCCGCCACCGACCGTGCA
AGACAGTTCGCTGAGAAGCTCCCTATCTTATCCAAGGACGACATTCCGCTCGAGGACTATTGCCCAATCTGCCTG
GTTCCGTTTTTAGAAATATTGAGTCTTACACGGGATACGCTGGATGATCCAGGTGTCACCAAGCTCGAAGGTTGT
GGTCATATCTTCTGTCGCAGAGACTTGATAGAATGGGTCAAGACACAACATGGAAACTGCCCTACCTGTCGTTTT
CAATTTATGCCTCCTGATATGGTATTCGGAGATGATGGTTCGTCTGACGGTGGCGAATATATTCCACCATCCGAA
GGTGACGAAGATTTCGATATCGATTTTGACTATGCGGAGTCAGAATTCTGGGCTACTGAGGACTATGAGGACGAC
CTTGCAATATCCACCATTTCTCCCGAAGAAAACATGCGTCGTGAAGCTATGATGCAACTATGGGATGACGAAGAT
GACGCAAGCATTGCCGACGAAGTCCAGGAGTCTGATGACCATGAAGTTTTCGGAGAAATGGAAGAATTCGACTAT
GACCAGGACCCTATAGAAACCACTCAAGAGGTTTCAGATCCTTTGGAAGTGGAAATGGCACATGAACCGGAACAC
GATCCGTTTTCATGTTTTGATCCGGTAGATGAACTTCAGCATGATCCGGATTATACGCCGGACGACGTTGATGTT
CCTGACGAAATAGAAGCGCTTGGCCTCGAAGATGATGGTTGCTCAGACTCGATGGATCCAAACCTGGGGGGAGAA
GTTGACTGGGGTTTGGCCGATGGGGAGCATGCGCCAGACGACGTCAATATCCGTGACGAAATAGAAGCATTGAAC
GCCCTCGAAGCTGACGGCTGCTCAGACTCGATAGATCCAAACCTGGAGGGAGAAGTTGACTGGGATGGTGATTAT
ACGCCAGATGACGTCAATATCCGTGACGAAATAGAAGCATTGAACGCCCTCGAAGCTGACGGCTGCTCAGACTCA
ATAGATCCAAACTTGGAGGGAGAAGTTGAATGGGGTTCTACAGTCGAGGATCTGGGCGACTCTTCTTTTAATGAA
GTATGGTAG
Gene >AgabiH97|073320
ATGGACCAGGACTCGAATCTCGCAGCTGTGCAGCTTGTCCGCGATGCTTTCTGTCTCTCCGCCACCGACCGTGCA
AGACAGTTCGCTGAGAAGCTCCCTATCTTATCCAAGGACGACATTCCGCTCGAGGACTATTGCCCAATCTGCCTG
GTTCCGTTTTTAGAAATATTGAGTCTTACACGGGATACGCTGGATGATCCAGGTGTCACCAAGCTCGAAGGTTGT
GGTCATATCTTCTGTCGCAGAGAGTCAGTTGTGTTTGTTTTTACGTCTGTATCAAATTCATAACCCCGTGCCAGC
TTGATAGAATGGGTCAAGACACAAGTGCGTCTTTTCATCATTCTTTATCGCCAGGCTCTCATGTATACATAGCAT
GGAAACTGCCCTACCTGTCGTTTTCAATTTATGCCTCCTGATATGGTATTCGGAGATGATGGTTCGTCTGACGGT
GGCGAATATATTCCACCATCCGAAGGTGACGAAGATTTCGATATCGATTTTGACTATGCGGAGTCAGAATTCTGG
GCTACTGAGGACTATGAGGACGACCTTGCAATATCCACCATTTCTCCCGAAGAAAACATGCGTCGTGAAGCTATG
ATGCAACTATGGGATGACGAAGATGACGCAAGCATTGCCGACGAAGTCCAGGAGTCTGATGACCATGAAGTTTTC
GGAGAAATGGAAGAATTCGACTATGACCAGGACCCTATAGGTAAGGTCTTTGAGATGCGAATATGATATAGAGCT
CATCGTTGAGTAGAAACCACTCAAGAGGTTTCAGATCCTTTGGAAGTGGAAATGGCACATGAACCGGAACACGAT
CCGTTTTCATGTTTTGATCCGGTAGATGAACTTCAGCATGATCCGGATTATACGCCGGACGACGTTGATGTTCCT
GACGAAATAGAAGCGCTTGGCCTCGAAGATGATGGTTGCTCAGACTCGATGGATCCAAACCTGGGGGGAGAAGTT
GACTGGGGTTTGGCCGATGGGGAGCATGCGCCAGACGACGTCAATATCCGTGACGAAATAGAAGCATTGAACGCC
CTCGAAGCTGACGGCTGCTCAGACTCGATAGATCCAAACCTGGAGGGAGAAGTTGACTGGGATGGTGATTATACG
CCAGATGACGTCAATATCCGTGACGAAATAGAAGCATTGAACGCCCTCGAAGCTGACGGCTGCTCAGACTCAATA
GATCCAAACTTGGAGGGAGAAGTTGAATGGGGTTCTACAGTCGAGGATCTGGGCGACTCTTCTTTTAATGAAGTG
CGTTTATTTTCAGGTGTTCACACTGTCACTAACCCTTAATCTAATTGAAGGTATGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail