Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|073280
Gene name
Locationscaffold_4:1913876..1914831
Strand+
Gene length (bp)955
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 8.7E-44 11 171
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 4.7E-14 11 125
PF00025 Arf ADP-ribosylation factor family 2.2E-09 8 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94363|RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhb1 PE=3 SV=1 7 172 4.0E-63
sp|Q550Q4|RHEB_DICDI GTP-binding protein Rheb homolog OS=Dictyostelium discoideum GN=rheb PE=3 SV=1 8 172 2.0E-49
sp|Q921J2|RHEB_MOUSE GTP-binding protein Rheb OS=Mus musculus GN=Rheb PE=1 SV=1 8 172 2.0E-47
sp|Q15382|RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens GN=RHEB PE=1 SV=1 8 172 2.0E-47
sp|Q62639|RHEB_RAT GTP-binding protein Rheb OS=Rattus norvegicus GN=Rheb PE=1 SV=1 8 172 3.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94363|RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhb1 PE=3 SV=1 7 172 4.0E-63
sp|Q550Q4|RHEB_DICDI GTP-binding protein Rheb homolog OS=Dictyostelium discoideum GN=rheb PE=3 SV=1 8 172 2.0E-49
sp|Q921J2|RHEB_MOUSE GTP-binding protein Rheb OS=Mus musculus GN=Rheb PE=1 SV=1 8 172 2.0E-47
sp|Q15382|RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens GN=RHEB PE=1 SV=1 8 172 2.0E-47
sp|Q62639|RHEB_RAT GTP-binding protein Rheb OS=Rattus norvegicus GN=Rheb PE=1 SV=1 8 172 3.0E-47
sp|Q56JV3|RHEB_BOVIN GTP-binding protein Rheb OS=Bos taurus GN=RHEB PE=2 SV=1 8 172 1.0E-46
sp|Q9VND8|RHEB_DROME GTP-binding protein Rheb homolog OS=Drosophila melanogaster GN=Rheb PE=2 SV=1 8 171 6.0E-46
sp|P25378|RHEB_YEAST Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHB1 PE=1 SV=2 9 172 1.0E-38
sp|Q8TAI7|REBL1_HUMAN GTPase RhebL1 OS=Homo sapiens GN=RHEBL1 PE=1 SV=1 6 172 2.0E-38
sp|Q7TNZ5|REBL1_RAT GTPase RhebL1 OS=Rattus norvegicus GN=Rhebl1 PE=2 SV=1 6 172 1.0E-36
sp|Q9D8T3|REBL1_MOUSE GTPase RhebL1 OS=Mus musculus GN=Rhebl1 PE=2 SV=1 6 172 3.0E-36
sp|P32253|RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 11 172 2.0E-33
sp|Q18246|RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 7 172 5.0E-33
sp|Q7YS69|REBL1_BOVIN GTPase RhebL1 OS=Bos taurus GN=RHEBL1 PE=2 SV=1 21 172 9.0E-33
sp|Q640R7|RAP1B_XENTR Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 7 172 2.0E-31
sp|Q7ZXH7|RAP1B_XENLA Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 7 172 2.0E-31
sp|A6NIZ1|RP1BL_HUMAN Ras-related protein Rap-1b-like protein OS=Homo sapiens PE=2 SV=1 7 172 3.0E-31
sp|P22123|RAPA_DIPOM Ras-related protein O-Krev OS=Diplobatis ommata PE=2 SV=1 7 186 5.0E-31
sp|P32254|RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum GN=rasS PE=2 SV=1 11 172 7.0E-31
sp|P03967|RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum GN=rasD PE=2 SV=2 11 174 1.0E-30
sp|Q6TEN1|RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 7 172 1.0E-30
sp|Q9YH37|RAP1B_CYPCA Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 7 172 1.0E-30
sp|P08645|RAS3_DROME Ras-like protein 3 OS=Drosophila melanogaster GN=R PE=2 SV=2 7 170 1.0E-30
sp|P22279|RAS2_MUCCL Ras-like protein 2 OS=Mucor circinelloides f. lusitanicus GN=RAS2 PE=2 SV=2 7 172 1.0E-30
sp|Q5RDM6|RAP1B_PONAB Ras-related protein Rap-1b OS=Pongo abelii GN=RAP1B PE=2 SV=1 7 172 2.0E-30
sp|A5A6J7|RAP1B_PANTR Ras-related protein Rap-1b OS=Pan troglodytes GN=RAP1B PE=2 SV=1 7 172 2.0E-30
sp|Q99JI6|RAP1B_MOUSE Ras-related protein Rap-1b OS=Mus musculus GN=Rap1b PE=1 SV=2 7 172 2.0E-30
sp|Q4R9D4|RAP1B_MACFA Ras-related protein Rap-1b OS=Macaca fascicularis GN=RAP1B PE=2 SV=1 7 172 2.0E-30
sp|P61224|RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1 7 172 2.0E-30
sp|Q5ZHX1|RAP1B_CHICK Ras-related protein Rap-1b OS=Gallus gallus GN=RAP1B PE=2 SV=1 7 172 2.0E-30
sp|P61223|RAP1B_BOVIN Ras-related protein Rap-1b OS=Bos taurus GN=RAP1B PE=2 SV=1 7 172 2.0E-30
sp|Q94694|RAP1_PHYPO Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 7 172 3.0E-30
sp|P11233|RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1 5 170 4.0E-30
sp|P32252|RASB_DICDI Ras-like protein rasB OS=Dictyostelium discoideum GN=rasB PE=1 SV=1 22 174 7.0E-30
sp|P18613|RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 7 172 7.0E-30
sp|P15064|RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum GN=rasG PE=1 SV=1 11 172 7.0E-30
sp|P63320|RALA_SAGOE Ras-related protein Ral-A OS=Saguinus oedipus GN=RALA PE=1 SV=1 5 170 9.0E-30
sp|P63322|RALA_RAT Ras-related protein Ral-A OS=Rattus norvegicus GN=Rala PE=1 SV=1 5 170 9.0E-30
sp|P63321|RALA_MOUSE Ras-related protein Ral-A OS=Mus musculus GN=Rala PE=1 SV=1 5 170 9.0E-30
sp|P34726|RAS2_PHYPO Ras-like protein 2 OS=Physarum polycephalum GN=RAS-2 PE=2 SV=1 11 176 1.0E-29
sp|Q62636|RAP1B_RAT Ras-related protein Rap-1b OS=Rattus norvegicus GN=Rap1b PE=1 SV=2 7 172 1.0E-29
sp|Q5R4B8|RALB_PONAB Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 11 176 1.0E-29
sp|P11234|RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 11 176 1.0E-29
sp|Q4R379|RALB_MACFA Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 11 176 1.0E-29
sp|P34729|RAS1_PHYPO Ras-like protein 1 OS=Physarum polycephalum GN=RAS1 PE=2 SV=1 11 172 1.0E-29
sp|Q9YH09|RALBA_XENLA Ras-related protein ralB-A OS=Xenopus laevis GN=ralb-a PE=1 SV=1 11 176 2.0E-29
sp|P36860|RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus GN=Ralb PE=2 SV=1 11 176 2.0E-29
sp|Q9JIW9|RALB_MOUSE Ras-related protein Ral-B OS=Mus musculus GN=Ralb PE=1 SV=1 11 176 3.0E-29
sp|Q55CA9|RASZ_DICDI Ras-like protein rasZ OS=Dictyostelium discoideum GN=rasZ PE=3 SV=1 11 172 3.0E-29
sp|Q55CB7|RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 11 175 4.0E-29
sp|P62836|RAP1A_RAT Ras-related protein Rap-1A OS=Rattus norvegicus GN=Rap1a PE=1 SV=1 7 174 5.0E-29
sp|P62835|RAP1A_MOUSE Ras-related protein Rap-1A OS=Mus musculus GN=Rap1a PE=1 SV=1 7 174 5.0E-29
sp|P62834|RAP1A_HUMAN Ras-related protein Rap-1A OS=Homo sapiens GN=RAP1A PE=1 SV=1 7 174 5.0E-29
sp|P62833|RAP1A_BOVIN Ras-related protein Rap-1A OS=Bos taurus GN=RAP1A PE=1 SV=1 7 174 5.0E-29
sp|Q6IP71|RALBB_XENLA Ras-related protein ralB-B OS=Xenopus laevis GN=ralb-b PE=2 SV=1 11 176 6.0E-29
sp|Q5R6S2|DIRA2_PONAB GTP-binding protein Di-Ras2 OS=Pongo abelii GN=DIRAS2 PE=2 SV=1 11 167 1.0E-28
sp|P34443|RHEB1_CAEEL GTP-binding protein Rheb homolog 1 OS=Caenorhabditis elegans GN=rheb-1 PE=3 SV=1 10 171 1.0E-28
sp|Q55CB0|RASU_DICDI Ras-like protein rasU OS=Dictyostelium discoideum GN=rasU PE=3 SV=1 11 167 1.0E-28
sp|P10301|RRAS_HUMAN Ras-related protein R-Ras OS=Homo sapiens GN=RRAS PE=1 SV=1 22 172 1.0E-28
sp|P48555|RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster GN=Rala PE=2 SV=2 11 170 2.0E-28
sp|Q95KD9|DIRA2_MACFA GTP-binding protein Di-Ras2 OS=Macaca fascicularis GN=DIRAS2 PE=2 SV=1 11 167 5.0E-28
sp|P22124|RAL_DIPOM Ras-related protein O-RAL OS=Diplobatis ommata PE=2 SV=1 11 176 5.0E-28
sp|P70425|RIT2_MOUSE GTP-binding protein Rit2 OS=Mus musculus GN=Rit2 PE=1 SV=1 8 172 7.0E-28
sp|Q96HU8|DIRA2_HUMAN GTP-binding protein Di-Ras2 OS=Homo sapiens GN=DIRAS2 PE=1 SV=1 11 167 7.0E-28
sp|Q5BJQ5|RIT2_RAT GTP-binding protein Rit2 OS=Rattus norvegicus GN=Rit2 PE=2 SV=1 8 172 8.0E-28
sp|Q5PR73|DIRA2_MOUSE GTP-binding protein Di-Ras2 OS=Mus musculus GN=Diras2 PE=1 SV=1 11 167 1.0E-27
sp|Q99578|RIT2_HUMAN GTP-binding protein Rit2 OS=Homo sapiens GN=RIT2 PE=1 SV=1 8 172 1.0E-27
sp|P28775|RAS_LENED Ras-like protein OS=Lentinula edodes PE=3 SV=1 2 172 1.0E-27
sp|Q05058|RASL_COPCI 24 kDa Ras-like protein OS=Coprinopsis cinerea GN=CC-RAS PE=3 SV=1 2 172 2.0E-27
sp|A8NU18|RASL_COPC7 24 kDa Ras-like protein OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC-RAS PE=3 SV=3 2 172 2.0E-27
sp|Q55CC0|RASW_DICDI Ras-like protein rasW OS=Dictyostelium discoideum GN=rasW PE=3 SV=1 12 172 2.0E-27
sp|P08647|RAS_SCHPO Ras-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ras1 PE=3 SV=2 3 163 2.0E-27
sp|P38976|RAS2_HYDVU Ras-like protein RAS2 OS=Hydra vulgaris GN=RAS2 PE=2 SV=1 22 170 4.0E-27
sp|P0CQ42|RAS_CRYNJ Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAS1 PE=2 SV=1 1 163 4.0E-27
sp|P0CQ43|RAS_CRYNB Ras-like protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAS1 PE=3 SV=1 1 163 4.0E-27
sp|Q55CB8|RASX_DICDI Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 11 163 5.0E-27
sp|P22278|RAS1_MUCCL Ras-like protein 1 OS=Mucor circinelloides f. lusitanicus GN=RAS1 PE=2 SV=1 4 172 1.0E-26
sp|P22280|RAS3_MUCCL Ras-like protein 3 OS=Mucor circinelloides f. lusitanicus GN=RAS3 PE=2 SV=1 1 172 2.0E-26
sp|P23175|RASH_MSVNS GTPase HRas OS=Murine sarcoma virus NS.C58 GN=H-RAS PE=3 SV=1 11 175 3.0E-26
sp|P10833|RRAS_MOUSE Ras-related protein R-Ras OS=Mus musculus GN=Rras PE=1 SV=1 22 172 3.0E-26
sp|P70426|RIT1_MOUSE GTP-binding protein Rit1 OS=Mus musculus GN=Rit1 PE=1 SV=1 8 172 5.0E-26
sp|D3Z8L7|RRAS_RAT Ras-related protein R-Ras OS=Rattus norvegicus GN=Rras PE=1 SV=1 22 172 1.0E-25
sp|Q92963|RIT1_HUMAN GTP-binding protein Rit1 OS=Homo sapiens GN=RIT1 PE=1 SV=1 2 172 1.0E-25
sp|P01119|RAS1_YEAST Ras-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS1 PE=1 SV=2 7 163 2.0E-25
sp|C4YKT4|RAS1_CANAW Ras-like protein 1 OS=Candida albicans (strain WO-1) GN=RAS1 PE=3 SV=1 6 163 2.0E-25
sp|P0CY32|RAS1_CANAX Ras-like protein 1 OS=Candida albicans GN=RAS1 PE=3 SV=1 6 163 2.0E-25
sp|Q59XU5|RAS1_CANAL Ras-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAS1 PE=3 SV=1 6 163 2.0E-25
sp|P01115|RASH_MSVHA Transforming protein p29 OS=Harvey murine sarcoma virus GN=H-RAS PE=1 SV=1 11 172 3.0E-25
sp|A8XAD0|RHEB1_CAEBR GTP-binding protein Rheb homolog 1 OS=Caenorhabditis briggsae GN=rheb-1 PE=3 SV=1 10 171 3.0E-25
sp|P01114|RASH_RRASV Transforming protein p29 OS=Rasheed rat sarcoma virus GN=RAS PE=3 SV=1 11 172 3.0E-25
sp|P01113|RASH_MSVMO GTPase HRas OS=Moloney murine sarcoma virus GN=H-RAS PE=3 SV=1 11 172 5.0E-25
sp|P01120|RAS2_YEAST Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS2 PE=1 SV=4 1 170 5.0E-25
sp|P01117|RASK_MSVKI GTPase KRas OS=Kirsten murine sarcoma virus GN=K-RAS PE=1 SV=1 11 172 9.0E-25
sp|P18262|RAS_ARTSA Ras-like protein (Fragment) OS=Artemia salina PE=3 SV=1 19 172 1.0E-24
sp|P87018|RAS_BOTFU Ras-like protein OS=Botryotinia fuckeliana GN=ras1 PE=3 SV=1 4 172 2.0E-24
sp|Q55CB9|RASV_DICDI Ras-like protein rasV OS=Dictyostelium discoideum GN=rasV PE=3 SV=1 11 173 2.0E-24
sp|P62071|RRAS2_MOUSE Ras-related protein R-Ras2 OS=Mus musculus GN=Rras2 PE=1 SV=1 9 172 4.0E-24
sp|P62070|RRAS2_HUMAN Ras-related protein R-Ras2 OS=Homo sapiens GN=RRAS2 PE=1 SV=1 9 172 4.0E-24
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 11 172 6.0E-24
sp|Q12526|RAS_EMENI Ras-like protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rasA PE=2 SV=2 4 172 7.0E-24
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 11 172 8.0E-24
sp|O93856|RAS_LACBI Ras-like protein OS=Laccaria bicolor PE=2 SV=1 4 172 8.0E-24
sp|Q86L51|RAPB_DICDI Ras-related protein rapB OS=Dictyostelium discoideum GN=rapB PE=3 SV=1 12 163 1.0E-23
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 11 172 2.0E-23
sp|Q8BU31|RAP2C_MOUSE Ras-related protein Rap-2c OS=Mus musculus GN=Rap2c PE=1 SV=1 7 170 2.0E-23
sp|Q9Y3L5|RAP2C_HUMAN Ras-related protein Rap-2c OS=Homo sapiens GN=RAP2C PE=1 SV=1 7 170 2.0E-23
sp|Q08DI5|RAP2C_BOVIN Ras-related protein Rap-2c OS=Bos taurus GN=RAP2C PE=2 SV=1 7 170 2.0E-23
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 11 172 2.0E-23
sp|O42785|RASL_COLTR Ras-like protein OS=Colletotrichum trifolii GN=RAS PE=2 SV=1 4 172 2.0E-23
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 11 163 3.0E-23
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 11 172 4.0E-23
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 11 172 4.0E-23
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 11 172 5.0E-23
sp|Q5R988|RAP2A_PONAB Ras-related protein Rap-2a OS=Pongo abelii GN=RAP2A PE=2 SV=2 7 170 5.0E-23
sp|Q80ZJ1|RAP2A_MOUSE Ras-related protein Rap-2a OS=Mus musculus GN=Rap2a PE=1 SV=2 7 170 5.0E-23
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 11 172 5.0E-23
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 11 172 8.0E-23
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 11 180 1.0E-22
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 11 172 1.0E-22
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 11 172 1.0E-22
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 11 172 1.0E-22
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 11 172 2.0E-22
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 11 172 2.0E-22
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 11 172 2.0E-22
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 11 172 2.0E-22
sp|B4PUP5|RAS1_DROYA Ras-like protein 1 OS=Drosophila yakuba GN=Ras85D PE=3 SV=1 22 172 2.0E-22
sp|P83831|RAS1_DROSI Ras-like protein 1 OS=Drosophila simulans GN=Ras85D PE=3 SV=1 22 172 2.0E-22
sp|B4HKC7|RAS1_DROSE Ras-like protein 1 OS=Drosophila sechellia GN=Ras85D PE=3 SV=1 22 172 2.0E-22
sp|P08646|RAS1_DROME Ras-like protein 1 OS=Drosophila melanogaster GN=Ras85D PE=1 SV=2 22 172 2.0E-22
sp|P83832|RAS1_DROMA Ras-like protein 1 OS=Drosophila mauritiana GN=Ras85D PE=3 SV=1 22 172 2.0E-22
sp|B3NZR4|RAS1_DROER Ras-like protein 1 OS=Drosophila erecta GN=Ras85D PE=3 SV=1 22 172 2.0E-22
sp|B3M185|RAS1_DROAN Ras-like protein 1 OS=Drosophila ananassae GN=Ras85D PE=3 SV=1 22 172 2.0E-22
sp|B4NJ72|RAS1_DROWI Ras-like protein 1 OS=Drosophila willistoni GN=Ras85D PE=3 SV=1 22 172 2.0E-22
sp|P13856|RSR1_YEAST Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1 7 170 2.0E-22
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 11 172 3.0E-22
sp|P61227|RAP2B_RAT Ras-related protein Rap-2b OS=Rattus norvegicus GN=Rap2b PE=2 SV=1 7 170 3.0E-22
sp|P61226|RAP2B_MOUSE Ras-related protein Rap-2b OS=Mus musculus GN=Rap2b PE=1 SV=1 7 170 3.0E-22
sp|P61225|RAP2B_HUMAN Ras-related protein Rap-2b OS=Homo sapiens GN=RAP2B PE=1 SV=1 7 170 3.0E-22
sp|Q06AU2|RAP2A_PIG Ras-related protein Rap-2a OS=Sus scrofa GN=RAP2A PE=2 SV=1 7 170 3.0E-22
sp|Q295X7|RAS1_DROPS Ras-like protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=Ras85D PE=3 SV=1 22 172 3.0E-22
sp|B4GFJ8|RAS1_DROPE Ras-like protein 1 OS=Drosophila persimilis GN=Ras85D PE=3 SV=1 22 172 3.0E-22
sp|B4JFU8|RAS1_DROGR Ras-like protein 1 OS=Drosophila grimshawi GN=Ras85D PE=3 SV=1 22 172 3.0E-22
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 11 183 3.0E-22
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 11 163 4.0E-22
sp|B4LY29|RAS1_DROVI Ras-like protein 1 OS=Drosophila virilis GN=Ras85D PE=3 SV=1 22 172 4.0E-22
sp|Q01387|RAS2_NEUCR Protein ras-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-2 PE=3 SV=2 11 172 4.0E-22
sp|Q9Y272|RASD1_HUMAN Dexamethasone-induced Ras-related protein 1 OS=Homo sapiens GN=RASD1 PE=1 SV=1 11 173 4.0E-22
sp|P63033|RHES_RAT GTP-binding protein Rhes OS=Rattus norvegicus GN=Rasd2 PE=1 SV=1 11 163 5.0E-22
sp|P63032|RHES_MOUSE GTP-binding protein Rhes OS=Mus musculus GN=Rasd2 PE=2 SV=1 11 163 5.0E-22
sp|Q9YH38|RASK_CYPCA GTPase KRas OS=Cyprinus carpio GN=kras PE=2 SV=1 22 172 5.0E-22
sp|P79800|RASK_MELGA GTPase KRas OS=Meleagris gallopavo GN=KRAS PE=2 SV=1 22 172 6.0E-22
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 11 176 6.0E-22
sp|P08644|RASK_RAT GTPase KRas OS=Rattus norvegicus GN=Kras PE=1 SV=3 22 172 8.0E-22
sp|P32883|RASK_MOUSE GTPase KRas OS=Mus musculus GN=Kras PE=1 SV=1 22 172 8.0E-22
sp|Q96D21|RHES_HUMAN GTP-binding protein Rhes OS=Homo sapiens GN=RASD2 PE=1 SV=1 11 163 9.0E-22
sp|O42277|RASK_ORYLA GTPase KRas OS=Oryzias latipes GN=kras1 PE=2 SV=1 22 172 9.0E-22
sp|Q5EFX7|RASK_KRYMA GTPase KRas OS=Kryptolebias marmoratus GN=kras PE=2 SV=1 22 172 1.0E-21
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 11 176 1.0E-21
sp|Q559X6|RAB2B_DICDI Ras-related protein Rab-2B OS=Dictyostelium discoideum GN=rab2B PE=3 SV=1 11 176 1.0E-21
sp|P05774|RAS_CARAU Ras-like protein (Fragment) OS=Carassius auratus PE=3 SV=1 22 172 1.0E-21
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 11 176 1.0E-21
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 11 170 1.0E-21
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 11 170 1.0E-21
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 11 170 1.0E-21
sp|P01116|RASK_HUMAN GTPase KRas OS=Homo sapiens GN=KRAS PE=1 SV=1 22 172 1.0E-21
sp|Q5F352|RASN_CHICK GTPase NRas OS=Gallus gallus GN=NRAS PE=2 SV=1 22 172 2.0E-21
sp|Q9JKF8|RASD1_RAT Dexamethasone-induced Ras-related protein 1 OS=Rattus norvegicus GN=Rasd1 PE=1 SV=1 11 173 2.0E-21
sp|Q91806|RASN_XENLA GTPase NRas OS=Xenopus laevis GN=nras PE=2 SV=1 22 172 2.0E-21
sp|O35626|RASD1_MOUSE Dexamethasone-induced Ras-related protein 1 OS=Mus musculus GN=Rasd1 PE=1 SV=1 11 173 2.0E-21
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 11 174 2.0E-21
sp|O95057|DIRA1_HUMAN GTP-binding protein Di-Ras1 OS=Homo sapiens GN=DIRAS1 PE=1 SV=1 22 168 2.0E-21
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 11 174 3.0E-21
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 11 174 3.0E-21
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 11 174 3.0E-21
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 11 174 3.0E-21
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 11 172 3.0E-21
sp|P22126|RAS1_NEUCR Protein ras-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-1 PE=2 SV=1 22 172 4.0E-21
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 11 180 4.0E-21
sp|Q91Z61|DIRA1_MOUSE GTP-binding protein Di-Ras1 OS=Mus musculus GN=Diras1 PE=1 SV=1 22 168 5.0E-21
sp|Q04970|RASN_RAT GTPase NRas OS=Rattus norvegicus GN=Nras PE=1 SV=1 22 172 5.0E-21
sp|Q2MJK3|RASN_PIG GTPase NRas OS=Sus scrofa GN=NRAS PE=2 SV=1 22 172 6.0E-21
sp|P01111|RASN_HUMAN GTPase NRas OS=Homo sapiens GN=NRAS PE=1 SV=1 22 172 6.0E-21
sp|P08556|RASN_MOUSE GTPase NRas OS=Mus musculus GN=Nras PE=1 SV=1 22 172 6.0E-21
sp|P12825|RASN_CAVPO GTPase NRas OS=Cavia porcellus GN=NRAS PE=2 SV=1 22 172 6.0E-21
sp|P20171|RASH_RAT GTPase HRas OS=Rattus norvegicus GN=Hras PE=1 SV=2 22 175 6.0E-21
sp|Q61411|RASH_MOUSE GTPase HRas OS=Mus musculus GN=Hras PE=1 SV=2 22 175 6.0E-21
sp|P01112|RASH_HUMAN GTPase HRas OS=Homo sapiens GN=HRAS PE=1 SV=1 22 175 6.0E-21
sp|Q95ME4|RASN_MONDO GTPase NRas OS=Monodelphis domestica GN=NRAS PE=2 SV=1 22 172 6.0E-21
sp|Q07983|RASK_MONDO GTPase KRas OS=Monodelphis domestica GN=KRAS PE=1 SV=1 22 172 7.0E-21
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 11 163 7.0E-21
sp|Q86JP3|RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 1 172 1.0E-20
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 11 175 1.0E-20
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 11 176 1.0E-20
sp|P08642|RASH_CHICK GTPase HRas OS=Gallus gallus GN=HRAS PE=1 SV=1 22 172 1.0E-20
sp|Q5RD87|RASN_PONAB GTPase NRas OS=Pongo abelii GN=NRAS PE=2 SV=1 22 172 2.0E-20
sp|O14807|RASM_HUMAN Ras-related protein M-Ras OS=Homo sapiens GN=MRAS PE=1 SV=2 22 170 2.0E-20
sp|Q05147|RASK_XENLA GTPase KRas OS=Xenopus laevis GN=kras PE=2 SV=1 22 172 2.0E-20
sp|P04388|RAS2_DROME Ras-like protein 2 OS=Drosophila melanogaster GN=Ras64B PE=1 SV=2 22 170 2.0E-20
sp|Q9FGK5|RAA5A_ARATH Ras-related protein RABA5a OS=Arabidopsis thaliana GN=RABA5A PE=2 SV=1 11 170 2.0E-20
sp|P79737|RASN_DANRE GTPase NRas OS=Danio rerio GN=nras PE=2 SV=1 22 170 4.0E-20
sp|B4KB60|RAS1_DROMO Ras-like protein 1 OS=Drosophila mojavensis GN=Ras85D PE=3 SV=1 22 172 4.0E-20
sp|P25766|RLGP1_ORYSJ Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 11 174 5.0E-20
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 11 170 7.0E-20
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 11 172 7.0E-20
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 11 170 7.0E-20
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 11 170 7.0E-20
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 11 170 7.0E-20
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 11 170 7.0E-20
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 11 170 7.0E-20
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 11 170 7.0E-20
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 11 170 7.0E-20
sp|P97538|RASM_RAT Ras-related protein M-Ras OS=Rattus norvegicus GN=Mras PE=1 SV=2 22 174 9.0E-20
sp|O08989|RASM_MOUSE Ras-related protein M-Ras OS=Mus musculus GN=Mras PE=1 SV=1 22 174 1.0E-19
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 11 170 1.0E-19
sp|P22981|LET60_CAEEL Ras protein let-60 OS=Caenorhabditis elegans GN=let-60 PE=1 SV=1 22 172 1.0E-19
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 11 176 1.0E-19
sp|Q24192|RHOL_DROME Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 8 172 1.0E-19
sp|Q96A58|RERG_HUMAN Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens GN=RERG PE=1 SV=1 11 172 2.0E-19
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 11 180 2.0E-19
sp|Q0VCJ7|RERG_BOVIN Ras-related and estrogen-regulated growth inhibitor OS=Bos taurus GN=RERG PE=2 SV=1 11 172 2.0E-19
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 11 174 2.0E-19
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 11 180 2.0E-19
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 11 170 2.0E-19
sp|P10114|RAP2A_HUMAN Ras-related protein Rap-2a OS=Homo sapiens GN=RAP2A PE=1 SV=1 7 170 3.0E-19
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 11 174 4.0E-19
sp|Q6IMA3|RSLBA_RAT Ras-like protein family member 11A OS=Rattus norvegicus GN=Rasl11a PE=2 SV=2 11 189 4.0E-19
sp|Q8R367|RERG_MOUSE Ras-related and estrogen-regulated growth inhibitor OS=Mus musculus GN=Rerg PE=2 SV=1 11 172 4.0E-19
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 11 165 4.0E-19
sp|P19892|RAA5E_ARATH Ras-related protein RABA5e OS=Arabidopsis thaliana GN=RABA5E PE=2 SV=1 11 170 4.0E-19
sp|P51539|RAS1_HYDVU Ras-like protein RAS1 OS=Hydra vulgaris GN=RAS1 PE=2 SV=2 22 170 5.0E-19
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 11 174 6.0E-19
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 11 163 7.0E-19
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 11 176 7.0E-19
sp|Q6IMB1|RSLBA_MOUSE Ras-like protein family member 11A OS=Mus musculus GN=Rasl11a PE=1 SV=1 11 172 8.0E-19
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 7 163 8.0E-19
sp|Q9H0T7|RAB17_HUMAN Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 11 170 9.0E-19
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 11 170 1.0E-18
sp|Q9FE79|RAA4C_ARATH Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 11 174 1.0E-18
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 11 191 1.0E-18
sp|Q68EK7|RAB4B_DANRE Ras-related protein Rab-4B OS=Danio rerio GN=rab4b PE=2 SV=1 11 176 1.0E-18
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 11 176 1.0E-18
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 11 163 2.0E-18
sp|Q8MYF2|RABJ_DICDI Ras-related protein RabJ OS=Dictyostelium discoideum GN=rabJ PE=3 SV=1 1 163 2.0E-18
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 11 163 2.0E-18
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 11 163 2.0E-18
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 11 163 2.0E-18
sp|P61018|RAB4B_HUMAN Ras-related protein Rab-4B OS=Homo sapiens GN=RAB4B PE=1 SV=1 11 170 2.0E-18
sp|P61017|RAB4B_CANLF Ras-related protein Rab-4B OS=Canis lupus familiaris GN=RAB4B PE=2 SV=1 11 170 2.0E-18
sp|P51146|RAB4B_RAT Ras-related protein Rab-4B OS=Rattus norvegicus GN=Rab4b PE=2 SV=1 11 170 2.0E-18
sp|Q91ZR1|RAB4B_MOUSE Ras-related protein Rab-4B OS=Mus musculus GN=Rab4b PE=1 SV=2 11 170 2.0E-18
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 11 163 2.0E-18
sp|Q9CB01|RABF1_ARATH Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 11 176 2.0E-18
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 11 170 2.0E-18
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 11 170 2.0E-18
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 11 170 2.0E-18
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 11 167 2.0E-18
sp|P36412|RB11A_DICDI Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 11 170 3.0E-18
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 11 167 3.0E-18
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 11 167 3.0E-18
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 11 167 3.0E-18
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 11 167 3.0E-18
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 11 167 3.0E-18
sp|A1DZY4|RSLBL_DANRE Ras-like protein family member 11A-like OS=Danio rerio GN=zgc:110179 PE=2 SV=1 11 172 3.0E-18
sp|P35292|RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 11 170 3.0E-18
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 11 163 3.0E-18
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 11 179 3.0E-18
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 11 170 3.0E-18
sp|Q6T310|RSLBA_HUMAN Ras-like protein family member 11A OS=Homo sapiens GN=RASL11A PE=2 SV=1 11 172 3.0E-18
sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 11 170 3.0E-18
sp|Q9SIP0|RAA5D_ARATH Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 11 170 4.0E-18
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 9 163 4.0E-18
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 11 175 4.0E-18
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 11 170 4.0E-18
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 11 167 4.0E-18
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 11 167 5.0E-18
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 7 163 5.0E-18
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 11 163 5.0E-18
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 11 174 5.0E-18
sp|P28187|RAA5C_ARATH Ras-related protein RABA5c OS=Arabidopsis thaliana GN=RABA5C PE=1 SV=1 11 170 5.0E-18
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 11 171 5.0E-18
sp|Q6GQP4|RAB31_RAT Ras-related protein Rab-31 OS=Rattus norvegicus GN=Rab31 PE=1 SV=2 7 164 6.0E-18
sp|Q921E2|RAB31_MOUSE Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 7 164 6.0E-18
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 7 163 7.0E-18
sp|P52498|RSR1_CANAX Ras-related protein RSR1 OS=Candida albicans GN=RSR1 PE=3 SV=1 22 179 7.0E-18
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 11 175 8.0E-18
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 11 163 9.0E-18
sp|P56371|RAB4A_MOUSE Ras-related protein Rab-4A OS=Mus musculus GN=Rab4a PE=1 SV=2 11 170 9.0E-18
sp|Q1PEX3|RAA1H_ARATH Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 11 174 9.0E-18
sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 11 174 9.0E-18
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 11 178 9.0E-18
sp|Q63942|RAB3D_RAT GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 11 167 1.0E-17
sp|P05714|RAB4A_RAT Ras-related protein Rab-4A OS=Rattus norvegicus GN=Rab4a PE=1 SV=3 11 170 1.0E-17
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 11 167 1.0E-17
sp|Q13636|RAB31_HUMAN Ras-related protein Rab-31 OS=Homo sapiens GN=RAB31 PE=1 SV=1 7 164 1.0E-17
sp|P57735|RAB25_HUMAN Ras-related protein Rab-25 OS=Homo sapiens GN=RAB25 PE=1 SV=2 11 170 1.0E-17
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 11 174 1.0E-17
sp|Q58DW6|RAB25_BOVIN Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 PE=2 SV=1 11 170 1.0E-17
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 11 186 1.0E-17
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 11 163 1.0E-17
sp|E2RQ15|RAB25_CANLF Ras-related protein Rab-25 OS=Canis lupus familiaris GN=RAB25 PE=3 SV=1 11 170 2.0E-17
sp|P20338|RAB4A_HUMAN Ras-related protein Rab-4A OS=Homo sapiens GN=RAB4A PE=1 SV=3 11 170 2.0E-17
sp|Q2TBH7|RAB4A_BOVIN Ras-related protein Rab-4A OS=Bos taurus GN=RAB4A PE=2 SV=3 11 170 2.0E-17
sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 11 174 2.0E-17
sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 11 174 2.0E-17
sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 11 174 2.0E-17
sp|P61105|RAB2A_CANLF Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 11 174 2.0E-17
sp|P62824|RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 11 167 2.0E-17
sp|P62823|RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 11 167 2.0E-17
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 11 170 2.0E-17
sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 11 174 2.0E-17
sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 11 174 2.0E-17
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 11 172 2.0E-17
sp|Q40522|RB11D_TOBAC Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 11 170 2.0E-17
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 11 172 2.0E-17
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 11 172 2.0E-17
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 11 172 2.0E-17
sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 11 174 2.0E-17
sp|P46629|RAB25_RABIT Ras-related protein Rab-25 OS=Oryctolagus cuniculus GN=RAB25 PE=2 SV=1 11 170 2.0E-17
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 11 172 2.0E-17
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 11 172 2.0E-17
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 11 180 2.0E-17
sp|P35276|RAB3D_MOUSE Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 11 167 2.0E-17
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 11 170 3.0E-17
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 11 170 3.0E-17
sp|O95716|RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 11 167 3.0E-17
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 11 170 4.0E-17
sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 11 174 4.0E-17
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 11 172 5.0E-17
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 5 179 5.0E-17
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 9 174 5.0E-17
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 9 174 5.0E-17
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 11 170 5.0E-17
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 11 163 5.0E-17
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 11 163 5.0E-17
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 11 163 5.0E-17
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 11 170 6.0E-17
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 9 174 6.0E-17
sp|O18334|RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 5 170 6.0E-17
sp|Q9FJN8|RAA4A_ARATH Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 11 170 7.0E-17
sp|Q55BW0|RAPC_DICDI Ras-related protein rapC OS=Dictyostelium discoideum GN=rapC PE=3 SV=1 11 168 7.0E-17
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 11 170 8.0E-17
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 11 163 8.0E-17
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 11 163 9.0E-17
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 12 172 9.0E-17
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 9 174 9.0E-17
sp|Q9ULC3|RAB23_HUMAN Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 11 180 9.0E-17
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 11 163 9.0E-17
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 11 163 9.0E-17
sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 11 174 1.0E-16
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 11 174 1.0E-16
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 11 163 1.0E-16
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 11 163 1.0E-16
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 11 163 1.0E-16
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 11 163 1.0E-16
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 11 173 1.0E-16
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 11 170 1.0E-16
sp|Q5R8Z8|RAB14_PONAB Ras-related protein Rab-14 OS=Pongo abelii GN=RAB14 PE=2 SV=3 11 163 1.0E-16
sp|Q91V41|RAB14_MOUSE Ras-related protein Rab-14 OS=Mus musculus GN=Rab14 PE=1 SV=3 11 163 1.0E-16
sp|P61106|RAB14_HUMAN Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 11 163 1.0E-16
sp|Q5ZKU5|RAB14_CHICK Ras-related protein Rab-14 OS=Gallus gallus GN=RAB14 PE=2 SV=3 11 163 1.0E-16
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 11 172 1.0E-16
sp|P61107|RAB14_RAT Ras-related protein Rab-14 OS=Rattus norvegicus GN=Rab14 PE=1 SV=3 11 163 1.0E-16
sp|Q52NJ6|RAB14_PIG Ras-related protein Rab-14 OS=Sus scrofa GN=RAB14 PE=2 SV=3 11 163 1.0E-16
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 3 163 1.0E-16
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 11 163 1.0E-16
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 11 174 1.0E-16
sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 11 170 2.0E-16
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 11 163 2.0E-16
sp|Q1KME6|RAB6A_CHICK Ras-related protein Rab-6A OS=Gallus gallus GN=RAB6A PE=2 SV=3 5 170 2.0E-16
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 11 163 2.0E-16
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 11 163 2.0E-16
sp|Q99260|YPT6_YEAST GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 1 165 2.0E-16
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 11 163 2.0E-16
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 11 163 2.0E-16
sp|Q9WTL2|RAB25_MOUSE Ras-related protein Rab-25 OS=Mus musculus GN=Rab25 PE=1 SV=2 11 170 2.0E-16
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 11 163 2.0E-16
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 11 163 2.0E-16
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 11 163 2.0E-16
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 11 172 2.0E-16
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 11 172 2.0E-16
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 11 163 2.0E-16
sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 11 188 2.0E-16
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 11 163 2.0E-16
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 11 163 2.0E-16
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 11 163 2.0E-16
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 11 163 2.0E-16
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 11 163 3.0E-16
sp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 11 170 3.0E-16
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 11 172 3.0E-16
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 11 172 3.0E-16
sp|P36410|RAB14_DICDI Ras-related protein Rab-14 OS=Dictyostelium discoideum GN=rab14 PE=1 SV=2 11 163 3.0E-16
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 11 170 3.0E-16
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 11 172 3.0E-16
sp|P35288|RAB23_MOUSE Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 11 169 3.0E-16
sp|P59279|RAB2B_MOUSE Ras-related protein Rab-2B OS=Mus musculus GN=Rab2b PE=1 SV=1 11 174 3.0E-16
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 11 173 3.0E-16
sp|P36409|RAB2A_DICDI Ras-related protein Rab-2A OS=Dictyostelium discoideum GN=rab2A PE=2 SV=2 11 174 3.0E-16
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 11 163 3.0E-16
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 11 174 3.0E-16
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 11 170 3.0E-16
sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 11 188 4.0E-16
sp|Q5KTJ7|RAB3B_MESAU Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 11 188 4.0E-16
sp|P36863|YPTV4_VOLCA GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 11 174 4.0E-16
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 11 170 4.0E-16
sp|Q39570|YPTC4_CHLRE GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 11 174 4.0E-16
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 1 170 4.0E-16
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 11 170 4.0E-16
sp|Q8VEA8|RAB7B_MOUSE Ras-related protein Rab-7b OS=Mus musculus GN=Rab7b PE=1 SV=1 8 164 4.0E-16
sp|Q22782|RAB6B_CAEEL Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 5 165 5.0E-16
sp|P10948|RAB3B_BOVIN Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 11 170 5.0E-16
sp|O82480|RAC7_ARATH Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 11 173 5.0E-16
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 5 170 6.0E-16
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 5 170 6.0E-16
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 11 173 6.0E-16
sp|Q6PHI9|RAB4A_DANRE Ras-related protein Rab-4A OS=Danio rerio GN=rab4a PE=2 SV=2 11 170 6.0E-16
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 5 170 6.0E-16
sp|P35279|RAB6A_MOUSE Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 5 170 6.0E-16
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 11 163 7.0E-16
sp|O42825|RHO1_CANAL GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1 9 164 7.0E-16
sp|O80501|RAH1B_ARATH Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 1 170 7.0E-16
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 11 170 8.0E-16
sp|O82481|RAC10_ARATH Rac-like GTP-binding protein ARAC10 OS=Arabidopsis thaliana GN=ARAC10 PE=1 SV=1 11 175 8.0E-16
sp|Q54E92|RABG1_DICDI Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 11 170 8.0E-16
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 11 170 9.0E-16
sp|Q9HF56|CDC42_ASHGO Cell division control protein 42 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC42 PE=3 SV=1 11 175 9.0E-16
sp|Q08DE8|RAB7B_BOVIN Ras-related protein Rab-7b OS=Bos taurus GN=RAB7B PE=2 SV=1 8 164 9.0E-16
sp|Q40520|RB11C_TOBAC Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 11 170 1.0E-15
sp|Q0IIG8|RAB18_BOVIN Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 5 170 1.0E-15
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 11 163 1.0E-15
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 11 163 1.0E-15
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 11 163 1.0E-15
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 11 163 1.0E-15
sp|Q5ZLG1|RAB18_CHICK Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 5 170 1.0E-15
sp|P61294|RAB6B_MOUSE Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 5 170 1.0E-15
sp|Q9NRW1|RAB6B_HUMAN Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 5 170 1.0E-15
sp|A6QR46|RAB6B_BOVIN Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 5 170 1.0E-15
sp|Q5R5H5|RAB18_PONAB Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 5 170 1.0E-15
sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 5 170 1.0E-15
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 11 175 1.0E-15
sp|Q5EB77|RAB18_RAT Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 5 170 1.0E-15
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 11 170 1.0E-15
sp|Q96S79|RSLAB_HUMAN Ras-like protein family member 10B OS=Homo sapiens GN=RASL10B PE=2 SV=1 11 170 1.0E-15
sp|P35281|RAB10_RAT Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 11 163 1.0E-15
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 11 170 1.0E-15
sp|Q5SSG5|RSLAB_MOUSE Ras-like protein family member 10B OS=Mus musculus GN=Rasl10b PE=1 SV=1 11 170 1.0E-15
sp|P35293|RAB18_MOUSE Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 5 170 2.0E-15
sp|Q55ET3|RABQ_DICDI Ras-related protein RabQ OS=Dictyostelium discoideum GN=rabQ PE=3 SV=1 11 191 2.0E-15
sp|P24409|RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 11 163 2.0E-15
sp|Q9GP33|RAB4A_ECHMU Probable Ras-related protein Rab-4A OS=Echinococcus multilocularis PE=2 SV=1 11 167 2.0E-15
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 8 167 3.0E-15
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 11 170 3.0E-15
sp|P22127|RAB10_DIPOM Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 11 163 3.0E-15
sp|P34213|RAB6A_CAEEL Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 5 163 3.0E-15
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 2 164 3.0E-15
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 11 170 3.0E-15
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 11 163 3.0E-15
sp|Q7SZ59|RASLC_DANRE Ras-like protein family member 12 OS=Danio rerio GN=RASL12 PE=2 SV=1 12 172 4.0E-15
sp|Q96AH8|RAB7B_HUMAN Ras-related protein Rab-7b OS=Homo sapiens GN=RAB7B PE=2 SV=1 8 164 6.0E-15
sp|Q92737|RSLAA_HUMAN Ras-like protein family member 10A OS=Homo sapiens GN=RASL10A PE=1 SV=1 11 167 6.0E-15
sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1 11 170 7.0E-15
sp|P19073|CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2 11 175 8.0E-15
sp|Q3T0F5|RAB7A_BOVIN Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 2 164 8.0E-15
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 11 170 8.0E-15
sp|P09527|RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 2 164 9.0E-15
sp|Q32NQ0|RAB19_XENLA Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1 11 163 9.0E-15
sp|P34147|RACA_DICDI Rho-related protein racA OS=Dictyostelium discoideum GN=racA PE=1 SV=2 11 173 9.0E-15
sp|Q5R9Y4|RAB7A_PONAB Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 2 164 9.0E-15
sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 2 164 9.0E-15
sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 2 164 9.0E-15
sp|P18067|RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 2 164 9.0E-15
sp|Q8BHH2|RAB9B_MOUSE Ras-related protein Rab-9B OS=Mus musculus GN=Rab9b PE=1 SV=1 1 170 1.0E-14
sp|Q05976|RB18A_LYMST Ras-related protein Rab-18A OS=Lymnaea stagnalis GN=RAB18A PE=2 SV=1 16 170 1.0E-14
sp|Q54FL2|RABG2_DICDI Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 11 170 1.0E-14
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 11 173 1.0E-14
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 11 173 1.0E-14
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 11 163 1.0E-14
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 11 174 1.0E-14
sp|Q38902|RAC1_ARATH Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 8 167 2.0E-14
sp|Q39435|RAC1_BETVU Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 8 167 2.0E-14
sp|P34142|RAB21_DICDI Ras-related protein Rab-21 OS=Dictyostelium discoideum GN=rab21 PE=1 SV=2 11 163 2.0E-14
sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 11 170 2.0E-14
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 2 164 2.0E-14
sp|Q28IZ3|RAB19_XENTR Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1 11 163 2.0E-14
sp|Q99P75|RAB9A_RAT Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 11 170 2.0E-14
sp|Q38922|RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 11 170 2.0E-14
sp|Q14088|RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens GN=RAB33A PE=1 SV=2 7 168 2.0E-14
sp|Q9LNK1|RABA3_ARATH Ras-related protein RABA3 OS=Arabidopsis thaliana GN=RABA3 PE=2 SV=1 11 170 2.0E-14
sp|P97950|RB33A_MOUSE Ras-related protein Rab-33A OS=Mus musculus GN=Rab33a PE=2 SV=1 7 168 3.0E-14
sp|O23561|RAB1A_ARATH Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 11 174 3.0E-14
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 11 163 3.0E-14
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 11 163 3.0E-14
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 11 163 3.0E-14
sp|P91580|RAB33_CIOIN Putative Ras-related protein Rab-33 OS=Ciona intestinalis GN=COS41.2 PE=3 SV=1 11 162 3.0E-14
sp|Q67VP4|RAC4_ORYSJ Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 11 173 3.0E-14
sp|Q8CG50|RAB43_MOUSE Ras-related protein Rab-43 OS=Mus musculus GN=Rab43 PE=1 SV=1 11 170 4.0E-14
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 11 174 4.0E-14
sp|Q9NP90|RAB9B_HUMAN Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1 1 170 4.0E-14
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 8 167 4.0E-14
sp|Q5R4W9|RAB9B_PONAB Ras-related protein Rab-9B OS=Pongo abelii GN=RAB9B PE=2 SV=1 1 170 4.0E-14
sp|Q8BYP3|RHOF_MOUSE Rho-related GTP-binding protein RhoF OS=Mus musculus GN=Rhof PE=1 SV=1 11 163 4.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|073280
MSRTNILRKKRIVVLGSRSVGKSALILQYLENQFVENYYPTIEGSFQRCIKYNGTEYDCEIIDTAGQDEYSLVNA
KHTIGTHGYIFVYSVASRNSFDVVKVLYDRVLDFSGFQQVPCVIVGSKSDLDQFRQIDSSEAQQFAQLNNAAWIE
TSAKKNVNVAQVFEHCLAEIEKPVLSCSSTWLLATLYPQTI*
Coding >AgabiH97|073280
ATGTCTCGTACAAATATCCTCAGGAAAAAACGCATCGTTGTTCTTGGCTCCCGCTCTGTTGGAAAATCCGCCCTT
ATCCTCCAATACCTTGAAAACCAGTTCGTCGAAAACTATTATCCCACCATCGAGGGCTCCTTTCAACGGTGCATT
AAATACAATGGCACTGAATACGACTGCGAGATAATCGATACCGCGGGCCAAGATGAATATTCCCTAGTCAACGCG
AAACATACTATTGGAACGCATGGCTATATCTTTGTCTACTCTGTGGCGTCCCGCAATTCTTTTGATGTGGTGAAA
GTGTTGTATGATAGAGTTCTTGACTTTTCCGGATTTCAACAAGTCCCTTGTGTGATCGTCGGGTCCAAATCAGAC
TTGGACCAGTTCCGTCAAATTGATTCAAGCGAAGCTCAACAGTTTGCTCAGCTAAATAACGCTGCCTGGATAGAA
ACTAGCGCGAAGAAAAACGTCAACGTTGCTCAAGTATTCGAGCATTGTCTCGCCGAAATTGAAAAGCCTGTATTA
TCATGTAGCTCCACTTGGCTTCTAGCAACCCTCTATCCCCAAACTATCTGA
Transcript >AgabiH97|073280
ATGTCTCGTACAAATATCCTCAGGAAAAAACGCATCGTTGTTCTTGGCTCCCGCTCTGTTGGAAAATCCGCCCTT
ATCCTCCAATACCTTGAAAACCAGTTCGTCGAAAACTATTATCCCACCATCGAGGGCTCCTTTCAACGGTGCATT
AAATACAATGGCACTGAATACGACTGCGAGATAATCGATACCGCGGGCCAAGATGAATATTCCCTAGTCAACGCG
AAACATACTATTGGAACGCATGGCTATATCTTTGTCTACTCTGTGGCGTCCCGCAATTCTTTTGATGTGGTGAAA
GTGTTGTATGATAGAGTTCTTGACTTTTCCGGATTTCAACAAGTCCCTTGTGTGATCGTCGGGTCCAAATCAGAC
TTGGACCAGTTCCGTCAAATTGATTCAAGCGAAGCTCAACAGTTTGCTCAGCTAAATAACGCTGCCTGGATAGAA
ACTAGCGCGAAGAAAAACGTCAACGTTGCTCAAGTATTCGAGCATTGTCTCGCCGAAATTGAAAAGCCTGTATTA
TCATGTAGCTCCACTTGGCTTCTAGCAACCCTCTATCCCCAAACTATCTGA
Gene >AgabiH97|073280
ATGTCTCGTACAAATATCCTCAGGAAAAAACGCATCGTTGTTCTTGGCTCCCGCTCTGTTGGTACGTTATAAATC
TCAGCGTATTTCTGTTTCTTACCTCTTCTCGCTTTTCTCAGGAAAATCCGCCCTTATCCTCCAATACCTTGAAAA
CCAGTTCGTCGAAAACTATTATCCCACCATCGAGGGCTCCTTTCAACGGTGCATTAAATACAATGGCACTGAATA
CGACTGCGAGATAATCGATACCGCGGGCCAAGTAAGTCAGATTGCCTCGTGTCCCCATACCCCCCGCCCTGATCA
AGCAACGCGTACATCAATCATCAAGGATGAATATTCCCTAGTCAACGCGAAACATACTATTGGAACGCATGGCTA
TATCTTTGTCTACTCTGTGGCGTCCCGCAATTCTTTTGATGTGGTGAAAGTGTTGTATGATAGAGTTCTTGACTT
TTCCGGATTTCAACAAGTCCCTTGTGTGATCGTCGGGTCCAAATCAGACTTGGACCAGTTGTGAATATCTCCTTT
GTATTTGTCTTGACAAACCGCTGACTTCCCTTCCAGCCGTCAAATTGATTCAAGCGAAGCTCAACAGTTTGCTCA
GCTAAATAACGCTGCCTGGATAGAAACTAGCGCGAAGAAAAACGTCAACGTTGGTGAGCACCAAGTCTGCCCAAC
TATGATCGTTGATCCTGATTTTCGTACAGCTCAAGTATTCGAGCATTGTCTCGCCGAAATTGAAAAGCGTTCAAC
CCAAAACGCTACCTTCAACTCACCCCCACCGACGAGTAATCGTAGCTGTATTATCATGTAGCTCCGTACGTGCTT
TGATCTCCGCCATCTCCATTGCTCACGATTCCGCCGGCTGCATGGCGCATGATCGCTCCTCTTCACATCTCTTCA
CGCTTCCGCCGTTTAGACTTGGCTTCTAGCAACCCTCTATCCCCAAACTATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail