Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|073230
Gene name
Locationscaffold_4:1904567..1905315
Strand+
Gene length (bp)748
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03364 Polyketide_cyc Polyketide cyclase / dehydrase and lipid transport 9.7E-22 50 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PBN4|CQ10X_DANRE Coenzyme Q-binding protein COQ10 homolog, mitochondrial OS=Danio rerio GN=zgc:73324 PE=2 SV=2 21 205 1.0E-27
sp|Q96MF6|CQ10A_HUMAN Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Homo sapiens GN=COQ10A PE=2 SV=2 25 204 5.0E-23
sp|Q6DFA6|CQ10A_XENLA Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Xenopus laevis GN=coq10b-a PE=2 SV=1 30 204 4.0E-22
sp|Q6GNP0|CQ10B_XENLA Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Xenopus laevis GN=coq10b PE=2 SV=1 10 206 5.0E-22
sp|Q9H8M1|CQ10B_HUMAN Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Homo sapiens GN=COQ10B PE=2 SV=1 33 204 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6PBN4|CQ10X_DANRE Coenzyme Q-binding protein COQ10 homolog, mitochondrial OS=Danio rerio GN=zgc:73324 PE=2 SV=2 21 205 1.0E-27
sp|Q96MF6|CQ10A_HUMAN Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Homo sapiens GN=COQ10A PE=2 SV=2 25 204 5.0E-23
sp|Q6DFA6|CQ10A_XENLA Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Xenopus laevis GN=coq10b-a PE=2 SV=1 30 204 4.0E-22
sp|Q6GNP0|CQ10B_XENLA Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Xenopus laevis GN=coq10b PE=2 SV=1 10 206 5.0E-22
sp|Q9H8M1|CQ10B_HUMAN Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Homo sapiens GN=COQ10B PE=2 SV=1 33 204 4.0E-20
sp|Q5RD79|CQ10B_PONAB Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Pongo abelii GN=COQ10B PE=2 SV=1 33 204 5.0E-20
sp|Q567E6|CQ10B_DANRE Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Danio rerio GN=coq10b PE=2 SV=1 27 204 5.0E-20
sp|Q556V1|COQ10_DICDI Coenzyme Q-binding protein COQ10, mitochondrial OS=Dictyostelium discoideum GN=coq10-1 PE=3 SV=1 21 203 7.0E-20
sp|Q5I0I9|CQ10B_RAT Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Rattus norvegicus GN=Coq10b PE=2 SV=2 39 204 8.0E-20
sp|Q3THF9|CQ10B_MOUSE Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Mus musculus GN=Coq10b PE=1 SV=1 39 204 9.0E-20
sp|Q9USM9|COQ10_SCHPO Coenzyme Q-binding protein coq10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq10 PE=3 SV=1 44 194 1.0E-16
sp|Q75CC1|COQ10_ASHGO Coenzyme Q-binding protein COQ10, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COQ10 PE=3 SV=1 39 197 3.0E-16
sp|O68560|RATA_PSEAE Ribosome association toxin RatA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ratA PE=3 SV=1 49 203 3.0E-15
sp|Q8MLL3|COQ10_DROME Coenzyme Q-binding protein COQ10, mitochondrial OS=Drosophila melanogaster GN=Coq10 PE=2 SV=1 35 204 1.0E-13
sp|Q8FEY4|PAST_ECOL6 Persistence and stress-resistance toxin PasT OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pasT PE=1 SV=1 49 202 3.0E-13
sp|Q08058|COQ10_YEAST Coenzyme Q-binding protein COQ10, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ10 PE=1 SV=1 20 197 5.0E-13
sp|P0AGL6|RATA_SHIFL Ribosome association toxin RatA OS=Shigella flexneri GN=ratA PE=3 SV=1 49 202 7.0E-13
sp|P0AGL5|RATA_ECOLI Ribosome association toxin RatA OS=Escherichia coli (strain K12) GN=ratA PE=1 SV=1 49 202 7.0E-13
sp|Q9ZDZ7|RATA_RICPR Ribosome association toxin RatA OS=Rickettsia prowazekii (strain Madrid E) GN=ratA PE=3 SV=1 44 201 1.0E-11
sp|P0C6Q0|RATA_VIBCH Ribosome association toxin RatA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ratA PE=3 SV=1 49 203 8.0E-07
sp|A5F376|RATA_VIBC3 Ribosome association toxin RatA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ratA PE=3 SV=2 49 203 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|073230
MFVRPVARIRLPRYQTHASRRSLFGLPDPSFMSPFITTSETQKYNERRVLPYSPRQLYDVVSNVSTYPQFVPFCT
GSHILRPLIPEPGSERFSMEAELTVGFLSFKESYVSKVTCLPYESVEAVASSATSLFKTLTTTWRFQPVSSYPSA
RIDGEEYGRTLVILDLAYAFTNPLHASVSAAFFGQISKLMIQAFENRCQSIYGPGE*
Coding >AgabiH97|073230
ATGTTCGTCCGTCCCGTCGCTCGAATACGATTACCTCGATACCAGACGCACGCGTCAAGACGTTCTCTTTTTGGC
CTTCCCGATCCTTCTTTTATGTCACCCTTTATCACTACCTCAGAAACTCAGAAATACAATGAACGCAGAGTTCTT
CCATATTCCCCAAGACAGCTGTATGATGTCGTATCAAACGTCTCTACATATCCTCAATTTGTCCCATTTTGCACC
GGCTCTCACATTCTCAGACCCCTAATCCCGGAACCAGGCTCAGAACGGTTTTCCATGGAGGCTGAGTTGACTGTG
GGATTCTTATCCTTTAAGGAGAGCTACGTCAGCAAGGTGACTTGTCTACCATATGAGTCCGTGGAGGCGGTTGCT
TCTTCAGCCACTAGCCTCTTTAAGACTCTAACAACTACTTGGAGATTCCAACCCGTCTCATCGTATCCGTCTGCG
AGAATCGATGGGGAAGAATATGGTCGTACTCTCGTGATACTGGATCTAGCCTACGCCTTCACAAACCCTTTACAC
GCTAGTGTTTCGGCAGCGTTTTTTGGTCAGATATCAAAGCTCATGATCCAAGCTTTTGAGAATCGGTGTCAGTCT
ATCTACGGACCTGGTGAATAA
Transcript >AgabiH97|073230
ATGTTCGTCCGTCCCGTCGCTCGAATACGATTACCTCGATACCAGACGCACGCGTCAAGACGTTCTCTTTTTGGC
CTTCCCGATCCTTCTTTTATGTCACCCTTTATCACTACCTCAGAAACTCAGAAATACAATGAACGCAGAGTTCTT
CCATATTCCCCAAGACAGCTGTATGATGTCGTATCAAACGTCTCTACATATCCTCAATTTGTCCCATTTTGCACC
GGCTCTCACATTCTCAGACCCCTAATCCCGGAACCAGGCTCAGAACGGTTTTCCATGGAGGCTGAGTTGACTGTG
GGATTCTTATCCTTTAAGGAGAGCTACGTCAGCAAGGTGACTTGTCTACCATATGAGTCCGTGGAGGCGGTTGCT
TCTTCAGCCACTAGCCTCTTTAAGACTCTAACAACTACTTGGAGATTCCAACCCGTCTCATCGTATCCGTCTGCG
AGAATCGATGGGGAAGAATATGGTCGTACTCTCGTGATACTGGATCTAGCCTACGCCTTCACAAACCCTTTACAC
GCTAGTGTTTCGGCAGCGTTTTTTGGTCAGATATCAAAGCTCATGATCCAAGCTTTTGAGAATCGGTGTCAGTCT
ATCTACGGACCTGGTGAATAA
Gene >AgabiH97|073230
ATGTTCGTCCGTCCCGTCGCTCGAATACGATTACCTCGATACCAGACGCACGCGTCAAGACGTTCTCTTTTTGGC
CTTCCCGATCCTTCTTTTATGTCACCCTTTATCACTACCTCAGAAACTCAGAAATACAATGAACGCAGAGTTCTT
CCGTGTGTAGGTGGCCAGGCCACCCTTCCATACTGGCAACATACAGATACTAATTCACCGGCGTCTGCAGATATT
CCCCAAGACAGCTGTATGATGTCGTATCAAACGTCTCTACATATCCTCAATTTGTCCCATTTTGCACCGGCTCTC
ACATTCTCAGACCCCTAATCCCGGAACCAGGCTCAGAACGGTTTTCCATGGAGGCTGAGTTGACTGTGGGATTCT
TATCCTTTAAGGAGAGCTACGTCAGCAAGGTGACTTGTCTACCATATGAGTCCGTGGAGGTCAGCACATCCTGTC
TTCGACCAAAAGTACCCTTTCTGATGCCCCCGTCGCCTTCTAGGCGGTTGCTTCTTCAGCCACTAGCCTCTTTAA
GACTCTAACAACTACTTGGAGATTCCAACCCGTCTCATCGTATCCGTCTGCGAGAATCGATGGGGAAGAATATGG
TCGTACTCTCGTGATACTGGATCTAGCCTACGCCTTCACAAACCCTTTACACGCTAGTGTTTCGGCAGCGTTTTT
TGGTCAGATATCAAAGCTCATGATCCAAGCTTTTGAGAATCGGTGTCAGTCTATCTACGGACCTGGTGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail