© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|073150 |
| Gene name | |
| Location | scaffold_4:1883753..1885770 |
| Strand | - |
| Gene length (bp) | 2017 |
| Transcript length (bp) | 1743 |
| Coding sequence length (bp) | 1743 |
| Protein length (aa) | 581 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 1.1E-43 | 135 | 341 |
| PF03143 | GTP_EFTU_D3 | Elongation factor Tu C-terminal domain | 2.0E-27 | 452 | 560 |
| PF03144 | GTP_EFTU_D2 | Elongation factor Tu domain 2 | 1.9E-11 | 379 | 447 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P23637|ERF3_OGAPI | Eukaryotic peptide chain release factor GTP-binding subunit OS=Ogataea pini GN=SUP2 PE=3 SV=1 | 60 | 561 | 0.0E+00 |
| sp|Q9HGI8|ERF3_KLULA | Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 | 34 | 563 | 0.0E+00 |
| sp|Q9HGI6|ERF3_DEBHA | Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUP35 PE=3 SV=4 | 54 | 561 | 0.0E+00 |
| sp|O13354|ERF3_CANAX | Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 | 62 | 561 | 0.0E+00 |
| sp|Q9HGI4|ERF3_ZYGRO | Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 | 65 | 562 | 0.0E+00 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P23637|ERF3_OGAPI | Eukaryotic peptide chain release factor GTP-binding subunit OS=Ogataea pini GN=SUP2 PE=3 SV=1 | 60 | 561 | 0.0E+00 |
| sp|Q9HGI8|ERF3_KLULA | Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 | 34 | 563 | 0.0E+00 |
| sp|Q9HGI6|ERF3_DEBHA | Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUP35 PE=3 SV=4 | 54 | 561 | 0.0E+00 |
| sp|O13354|ERF3_CANAX | Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 | 62 | 561 | 0.0E+00 |
| sp|Q9HGI4|ERF3_ZYGRO | Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 | 65 | 562 | 0.0E+00 |
| sp|O74718|ERF3_SCHPO | Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup35 PE=1 SV=2 | 33 | 562 | 0.0E+00 |
| sp|Q9HGI7|ERF3_CANMA | Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 | 135 | 561 | 0.0E+00 |
| sp|P05453|ERF3_YEAST | Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUP35 PE=1 SV=1 | 91 | 562 | 0.0E+00 |
| sp|Q5R4B3|ERF3B_PONAB | Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Pongo abelii GN=GSPT2 PE=2 SV=1 | 135 | 561 | 0.0E+00 |
| sp|Q8IYD1|ERF3B_HUMAN | Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2 | 135 | 561 | 0.0E+00 |
| sp|Q149F3|ERF3B_MOUSE | Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Mus musculus GN=Gspt2 PE=1 SV=1 | 135 | 561 | 0.0E+00 |
| sp|P15170|ERF3A_HUMAN | Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens GN=GSPT1 PE=1 SV=1 | 135 | 561 | 0.0E+00 |
| sp|Q8R050|ERF3A_MOUSE | Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus GN=Gspt1 PE=1 SV=2 | 135 | 561 | 0.0E+00 |
| sp|Q7YZN9|ERF3_DICDI | Eukaryotic peptide chain release factor GTP-binding subunit OS=Dictyostelium discoideum GN=erf3 PE=2 SV=1 | 126 | 560 | 8.0E-129 |
| sp|Q5R6Y0|HBS1L_PONAB | HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1 | 58 | 562 | 4.0E-117 |
| sp|Q9Y450|HBS1L_HUMAN | HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1 | 41 | 562 | 4.0E-117 |
| sp|Q69ZS7|HBS1L_MOUSE | HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2 | 15 | 562 | 1.0E-113 |
| sp|A1RXW9|EF1A_THEPD | Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1 | 135 | 557 | 4.0E-113 |
| sp|Q6AXM7|HBS1L_RAT | HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=1 SV=1 | 15 | 562 | 9.0E-113 |
| sp|Q2KHZ2|HBS1L_BOVIN | HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 | 124 | 560 | 2.0E-110 |
| sp|A3DMQ1|EF1A_STAMF | Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=tuf PE=3 SV=1 | 135 | 558 | 1.0E-106 |
| sp|P41203|EF1A_DESMO | Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1 | 135 | 560 | 2.0E-106 |
| sp|A4YCR6|EF1A_METS5 | Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1 | 135 | 558 | 2.0E-105 |
| sp|A8ABM5|EF1A_IGNH4 | Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1 | 135 | 558 | 3.0E-104 |
| sp|P35021|EF1A_SULSO | Elongation factor 1-alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tuf PE=1 SV=3 | 135 | 555 | 4.0E-104 |
| sp|O93729|EF1A_PYRAE | Elongation factor 1-alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tuf PE=3 SV=1 | 135 | 560 | 2.0E-102 |
| sp|A1RRJ3|EF1A_PYRIL | Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tuf PE=3 SV=1 | 135 | 560 | 5.0E-102 |
| sp|Q9YAV0|EF1A_AERPE | Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tuf PE=1 SV=1 | 135 | 560 | 9.0E-102 |
| sp|A8MAJ1|EF1A_CALMQ | Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tuf PE=3 SV=1 | 135 | 560 | 6.0E-101 |
| sp|P50256|EF1AC_PORPU | Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1 | 132 | 567 | 1.0E-100 |
| sp|A4WKK8|EF1A_PYRAR | Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1 | 135 | 560 | 1.0E-100 |
| sp|Q04634|EF1A_TETPY | Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1 | 132 | 560 | 3.0E-100 |
| sp|P0CY35|EF1A1_CANAL | Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 | 132 | 562 | 1.0E-99 |
| sp|A3MV69|EF1A_PYRCJ | Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1 | 135 | 560 | 2.0E-99 |
| sp|Q8LPC4|EF1A_PYRYE | Elongation factor 1-alpha OS=Pyropia yezoensis PE=2 SV=1 | 132 | 567 | 4.0E-99 |
| sp|Q09069|EF1A_SORMA | Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1 | 135 | 557 | 4.0E-99 |
| sp|Q01372|EF1A_NEUCR | Elongation factor 1-alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tef-1 PE=3 SV=2 | 135 | 565 | 7.0E-99 |
| sp|P0CT55|EF1A3_SCHPO | Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef103 PE=1 SV=1 | 132 | 562 | 1.0E-98 |
| sp|P0CT54|EF1A2_SCHPO | Elongation factor 1-alpha-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef102 PE=1 SV=1 | 132 | 562 | 1.0E-98 |
| sp|Q27139|EF1A1_EUPCR | Elongation factor 1-alpha 1 OS=Euplotes crassus GN=EFA1 PE=3 SV=1 | 132 | 565 | 1.0E-98 |
| sp|P34825|EF1A_HYPJE | Elongation factor 1-alpha OS=Hypocrea jecorina GN=tef1 PE=3 SV=1 | 135 | 562 | 1.0E-98 |
| sp|Q00251|EF1A_AURPU | Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1 | 132 | 563 | 2.0E-98 |
| sp|Q59QD6|EF1A2_CANAL | Elongation factor 1-alpha 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF2 PE=3 SV=1 | 132 | 562 | 2.0E-98 |
| sp|P0CT53|EF1A1_SCHPO | Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef101 PE=1 SV=1 | 132 | 562 | 2.0E-98 |
| sp|P31018|EF1A_ENTHI | Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1 | 135 | 557 | 3.0E-98 |
| sp|Q01520|EF1A_PODAS | Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 | 135 | 560 | 3.0E-98 |
| sp|A5DPE3|EF1A_PICGU | Elongation factor 1-alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TEF1 PE=3 SV=2 | 132 | 562 | 3.0E-98 |
| sp|A2BN41|EF1A_HYPBU | Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=tuf PE=3 SV=1 | 135 | 558 | 6.0E-98 |
| sp|Q01765|EF1A_PODCU | Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 | 135 | 560 | 7.0E-98 |
| sp|P17196|EF1A_SULAC | Elongation factor 1-alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tuf PE=3 SV=1 | 135 | 555 | 3.0E-97 |
| sp|P40911|EF1A_AJECG | Elongation factor 1-alpha OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TEF PE=2 SV=1 | 135 | 563 | 4.0E-97 |
| sp|P19486|EF1A_THEAC | Elongation factor 1-alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tuf PE=3 SV=2 | 135 | 560 | 2.0E-96 |
| sp|A2STF0|EF1A_METLZ | Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1 | 135 | 557 | 2.0E-96 |
| sp|P54959|EF1A_BLAHO | Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1 | 132 | 563 | 3.0E-96 |
| sp|O59949|EF1A_YARLI | Elongation factor 1-alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEF PE=2 SV=2 | 132 | 562 | 6.0E-96 |
| sp|Q2HJN8|EF1A2_OSCTI | Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1 | 132 | 557 | 1.0E-95 |
| sp|P41752|EF1A_ASHGO | Elongation factor 1-alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF PE=3 SV=1 | 132 | 563 | 2.0E-95 |
| sp|P05303|EF1A2_DROME | Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2 | 132 | 572 | 2.0E-95 |
| sp|P14864|EF1A2_MUCCL | Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-2 PE=3 SV=1 | 132 | 562 | 4.0E-95 |
| sp|P25166|EF1A_STYLE | Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1 | 135 | 562 | 8.0E-95 |
| sp|P14963|EF1A_EUGGR | Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1 | 132 | 573 | 9.0E-95 |
| sp|P06805|EF1A1_MUCCL | Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-1 PE=3 SV=1 | 132 | 562 | 1.0E-94 |
| sp|P0CT32|EF1A2_DICDI | Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a2 PE=1 SV=1 | 132 | 562 | 2.0E-94 |
| sp|P0CT31|EF1A1_DICDI | Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=1 | 132 | 562 | 2.0E-94 |
| sp|Q90835|EF1A_CHICK | Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1 | 132 | 557 | 3.0E-94 |
| sp|P28295|EF1A_ABSGL | Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1 | 132 | 562 | 3.0E-94 |
| sp|P51554|EF1A_HYDVU | Elongation factor 1-alpha OS=Hydra vulgaris PE=2 SV=1 | 134 | 560 | 4.0E-94 |
| sp|P62630|EF1A1_RAT | Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1 | 132 | 557 | 4.0E-94 |
| sp|P10126|EF1A1_MOUSE | Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3 | 132 | 557 | 4.0E-94 |
| sp|P62629|EF1A1_CRIGR | Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1 | 132 | 557 | 4.0E-94 |
| sp|P68105|EF1A1_RABIT | Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1 | 132 | 557 | 4.0E-94 |
| sp|Q5R4R8|EF1A1_PONAB | Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2 | 132 | 557 | 4.0E-94 |
| sp|Q5R1X2|EF1A1_PANTR | Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1 | 132 | 557 | 4.0E-94 |
| sp|P68104|EF1A1_HUMAN | Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1 | 132 | 557 | 4.0E-94 |
| sp|Q66RN5|EF1A1_FELCA | Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1 | 132 | 557 | 4.0E-94 |
| sp|P68103|EF1A1_BOVIN | Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=1 SV=1 | 132 | 557 | 4.0E-94 |
| sp|P86939|EF1A2_TRYB2 | Elongation factor 1-alpha 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.5670 PE=1 SV=1 | 132 | 555 | 5.0E-94 |
| sp|P86934|EF1A1_TRYB2 | Elongation factor 1-alpha 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=TEF1 PE=1 SV=1 | 132 | 555 | 5.0E-94 |
| sp|Q2HJN4|EF1A1_OSCTI | Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1 | 132 | 557 | 5.0E-94 |
| sp|P43643|EF1A_TOBAC | Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1 | 132 | 557 | 8.0E-94 |
| sp|Q976B1|EF1A_SULTO | Elongation factor 1-alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tuf PE=3 SV=1 | 135 | 557 | 1.0E-93 |
| sp|P02993|EF1A_ARTSA | Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 | 132 | 572 | 1.0E-93 |
| sp|P02994|EF1A_YEAST | Elongation factor 1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF1 PE=1 SV=1 | 132 | 557 | 1.0E-93 |
| sp|Q2HJN6|EF1A3_OSCTI | Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1 | 132 | 572 | 1.0E-93 |
| sp|Q5VTE0|EF1A3_HUMAN | Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1A1P5 PE=5 SV=1 | 132 | 557 | 2.0E-93 |
| sp|Q9HDF6|EF1A_PIRIN | Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1 | 132 | 562 | 2.0E-93 |
| sp|A0RUM4|EF1A_CENSY | Elongation factor 1-alpha OS=Cenarchaeum symbiosum (strain A) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-93 |
| sp|Q96WZ1|EF1A_COCIM | Elongation factor 1-alpha OS=Coccidioides immitis (strain RS) GN=TEF PE=2 SV=2 | 135 | 562 | 2.0E-93 |
| sp|Q8GTY0|EF1A4_ARATH | Elongation factor 1-alpha 4 OS=Arabidopsis thaliana GN=A4 PE=1 SV=2 | 132 | 557 | 2.0E-93 |
| sp|Q0WL56|EF1A3_ARATH | Elongation factor 1-alpha 3 OS=Arabidopsis thaliana GN=A3 PE=1 SV=2 | 132 | 557 | 2.0E-93 |
| sp|Q8W4H7|EF1A2_ARATH | Elongation factor 1-alpha 2 OS=Arabidopsis thaliana GN=A2 PE=1 SV=2 | 132 | 557 | 2.0E-93 |
| sp|P0DH99|EF1A1_ARATH | Elongation factor 1-alpha 1 OS=Arabidopsis thaliana GN=A1 PE=1 SV=1 | 132 | 557 | 2.0E-93 |
| sp|Q2HJN9|EF1A4_OSCTI | Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1 | 132 | 557 | 3.0E-93 |
| sp|Q0W8G2|EF1A_METAR | Elongation factor 1-alpha OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=tuf PE=3 SV=1 | 135 | 560 | 3.0E-93 |
| sp|Q979T1|EF1A_THEVO | Elongation factor 1-alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tuf PE=3 SV=2 | 135 | 560 | 3.0E-93 |
| sp|P13549|EF1A0_XENLA | Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1 | 132 | 562 | 3.0E-93 |
| sp|Q8TRC4|EF1A_METAC | Elongation factor 1-alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tuf PE=3 SV=1 | 135 | 555 | 4.0E-93 |
| sp|P08736|EF1A1_DROME | Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 | 132 | 557 | 4.0E-93 |
| sp|P27592|EF1A_ONCVO | Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1 | 132 | 563 | 4.0E-93 |
| sp|P53013|EF1A_CAEEL | Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=3 SV=1 | 132 | 562 | 4.0E-93 |
| sp|Q71V39|EF1A2_RABIT | Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1 | 132 | 562 | 5.0E-93 |
| sp|Q05639|EF1A2_HUMAN | Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1 | 132 | 562 | 5.0E-93 |
| sp|Q32PH8|EF1A2_BOVIN | Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1 | 132 | 562 | 5.0E-93 |
| sp|P14865|EF1A3_MUCCL | Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-3 PE=3 SV=1 | 132 | 562 | 5.0E-93 |
| sp|O64937|EF1A_ORYSJ | Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2 | 132 | 562 | 5.0E-93 |
| sp|P29520|EF1A_BOMMO | Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 | 132 | 564 | 5.0E-93 |
| sp|A2Q0Z0|EF1A1_HORSE | Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1 | 132 | 557 | 6.0E-93 |
| sp|Q9YIC0|EF1A_ORYLA | Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 | 132 | 570 | 1.0E-92 |
| sp|P86933|EF1A_TRYBB | Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=2 SV=1 | 132 | 555 | 1.0E-92 |
| sp|P62632|EF1A2_RAT | Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=1 SV=1 | 132 | 562 | 1.0E-92 |
| sp|P62631|EF1A2_MOUSE | Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 | 132 | 562 | 1.0E-92 |
| sp|Q6L202|EF1A_PICTO | Elongation factor 1-alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tuf PE=3 SV=1 | 135 | 560 | 3.0E-92 |
| sp|Q9Y713|EF1A_ASPOR | Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tef1 PE=3 SV=1 | 135 | 565 | 3.0E-92 |
| sp|P19039|EF1A_APIME | Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 | 132 | 573 | 3.0E-92 |
| sp|Q03033|EF1A_WHEAT | Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1 | 132 | 557 | 3.0E-92 |
| sp|P41745|EF1A_BLAAD | Elongation factor 1-alpha OS=Blastobotrys adeninivorans GN=TEF PE=3 SV=1 | 132 | 562 | 3.0E-92 |
| sp|P17508|EF1A3_XENLA | Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2 | 132 | 569 | 4.0E-92 |
| sp|O29325|EF1A_ARCFU | Elongation factor 1-alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tuf PE=3 SV=1 | 135 | 560 | 5.0E-92 |
| sp|Q41803|EF1A_MAIZE | Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1 | 132 | 562 | 7.0E-92 |
| sp|O49169|EF1A_MANES | Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1 | 132 | 562 | 7.0E-92 |
| sp|P29521|EF1A1_DAUCA | Elongation factor 1-alpha OS=Daucus carota PE=1 SV=1 | 132 | 562 | 7.0E-92 |
| sp|P17786|EF1A_SOLLC | Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1 | 132 | 557 | 7.0E-92 |
| sp|P0CN30|EF1A_CRYNJ | Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEF1 PE=3 SV=1 | 132 | 557 | 9.0E-92 |
| sp|P0CN31|EF1A_CRYNB | Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEF1 PE=2 SV=1 | 132 | 557 | 9.0E-92 |
| sp|O42820|EF1A_SCHCO | Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1 | 132 | 555 | 1.0E-91 |
| sp|P17507|EF1A2_XENLA | Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1 | 132 | 557 | 1.0E-91 |
| sp|O24534|EF1A_VICFA | Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1 | 132 | 562 | 3.0E-91 |
| sp|Q41011|EF1A_PEA | Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1 | 132 | 562 | 4.0E-91 |
| sp|P25698|EF1A_SOYBN | Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2 | 132 | 562 | 5.0E-91 |
| sp|P90519|EF1A_CRYPV | Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1 | 132 | 571 | 8.0E-91 |
| sp|Q00080|EF1A_PLAFK | Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1 | 132 | 560 | 9.0E-91 |
| sp|P34823|EF1A2_DAUCA | Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1 | 132 | 562 | 9.0E-91 |
| sp|P32186|EF1A_PUCGR | Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2 | 132 | 562 | 3.0E-90 |
| sp|Q92005|EF1A_DANRE | Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1 | 132 | 562 | 1.0E-89 |
| sp|P17506|EF1A1_XENLA | Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2 | 135 | 557 | 2.0E-89 |
| sp|Q40034|EF1A2_HORVU | Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1 | 132 | 562 | 2.0E-89 |
| sp|P34824|EF1A1_HORVU | Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1 | 132 | 562 | 4.0E-89 |
| sp|Q18EY5|EF1A_HALWD | Elongation factor 1-alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=tuf PE=3 SV=1 | 135 | 562 | 6.0E-89 |
| sp|A7I656|EF1A_METB6 | Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1 | 135 | 555 | 1.0E-88 |
| sp|Q3IUD8|EF1A_NATPD | Elongation factor 1-alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-88 |
| sp|A0B7D6|EF1A_METTP | Elongation factor 1-alpha OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tuf PE=3 SV=1 | 133 | 555 | 7.0E-88 |
| sp|Q27140|EF1A2_EUPCR | Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1 | 135 | 561 | 2.0E-87 |
| sp|Q57770|EF1A_METJA | Elongation factor 1-alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tuf PE=3 SV=1 | 138 | 555 | 2.0E-87 |
| sp|Q9HM89|EF1A_HALSA | Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tuf PE=3 SV=1 | 137 | 563 | 2.0E-87 |
| sp|B0R8C3|EF1A_HALS3 | Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=tuf PE=3 SV=1 | 137 | 563 | 2.0E-87 |
| sp|B8GIQ3|EF1A_METPE | Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1 | 135 | 555 | 4.0E-87 |
| sp|Q12WT3|EF1A_METBU | Elongation factor 1-alpha OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=tuf PE=3 SV=1 | 135 | 555 | 2.0E-86 |
| sp|Q8PUR8|EF1A_METMA | Elongation factor 1-alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tuf PE=3 SV=1 | 135 | 555 | 5.0E-86 |
| sp|Q2FRI3|EF1A_METHJ | Elongation factor 1-alpha OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-85 |
| sp|Q464Z4|EF1A_METBF | Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1 | 135 | 555 | 3.0E-85 |
| sp|Q8TYP6|EF1A_METKA | Elongation factor 1-alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tuf PE=3 SV=1 | 135 | 560 | 5.0E-85 |
| sp|P16018|EF1A_HALMA | Elongation factor 1-alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tuf PE=1 SV=2 | 135 | 562 | 1.0E-84 |
| sp|C6A4R7|EF1A_THESM | Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1 | 135 | 560 | 3.0E-84 |
| sp|A3CTG3|EF1A_METMJ | Elongation factor 1-alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tuf PE=3 SV=1 | 135 | 555 | 1.0E-83 |
| sp|A5ULM5|EF1A_METS3 | Elongation factor 1-alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tuf PE=3 SV=2 | 135 | 555 | 2.0E-83 |
| sp|Q08046|EF1A_GIAIN | Elongation factor 1-alpha (Fragment) OS=Giardia intestinalis GN=TEF1 PE=2 SV=1 | 151 | 546 | 2.0E-82 |
| sp|Q9V0V7|EF1A_PYRAB | Elongation factor 1-alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tuf PE=3 SV=1 | 135 | 560 | 3.0E-82 |
| sp|Q8U152|EF1A_PYRFU | Elongation factor 1-alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tuf PE=3 SV=1 | 135 | 560 | 7.0E-82 |
| sp|Q26487|EF1A_SPOFR | Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 | 145 | 546 | 7.0E-82 |
| sp|P26751|EF1A_PYRWO | Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1 | 135 | 560 | 1.0E-81 |
| sp|P84316|EF1A_HELZE | Elongation factor 1-alpha (Fragment) OS=Helicoverpa zea PE=3 SV=1 | 145 | 546 | 1.0E-80 |
| sp|P84315|EF1A_HELVI | Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1 | 145 | 546 | 1.0E-80 |
| sp|P84318|EF1A_HELGL | Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1 | 145 | 546 | 1.0E-80 |
| sp|P84320|EF1A_HELDI | Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1 | 145 | 546 | 1.0E-80 |
| sp|P84317|EF1A_HELAM | Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1 | 145 | 546 | 1.0E-80 |
| sp|P84319|EF1A_HELAL | Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1 | 145 | 546 | 1.0E-80 |
| sp|P84322|EF1A_ANIIF | Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1 | 145 | 546 | 1.0E-80 |
| sp|P84321|EF1A_ADIBE | Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1 | 145 | 546 | 1.0E-80 |
| sp|Q2NEL1|EF1A_METST | Elongation factor 1-alpha OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tuf PE=3 SV=1 | 135 | 563 | 3.0E-80 |
| sp|A6UV43|EF1A_META3 | Elongation factor 1-alpha OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tuf PE=3 SV=1 | 138 | 555 | 6.0E-80 |
| sp|A6VGV6|EF1A_METM7 | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tuf PE=3 SV=1 | 138 | 555 | 9.0E-80 |
| sp|O59153|EF1A_PYRHO | Elongation factor 1-alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tuf PE=1 SV=1 | 135 | 560 | 3.0E-79 |
| sp|A4FWE9|EF1A_METM5 | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tuf PE=3 SV=1 | 138 | 555 | 5.0E-79 |
| sp|Q6LXI1|EF1A_METMP | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=tuf PE=3 SV=1 | 138 | 555 | 6.0E-79 |
| sp|O27132|EF1A_METTH | Elongation factor 1-alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tuf PE=1 SV=1 | 135 | 561 | 6.0E-79 |
| sp|A6UQ14|EF1A_METVS | Elongation factor 1-alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tuf PE=3 SV=1 | 138 | 555 | 6.0E-79 |
| sp|A9A9U3|EF1A_METM6 | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tuf PE=3 SV=1 | 138 | 555 | 6.0E-79 |
| sp|B6YVG2|EF1A_THEON | Elongation factor 1-alpha OS=Thermococcus onnurineus (strain NA1) GN=tuf PE=3 SV=1 | 135 | 560 | 3.0E-78 |
| sp|P07810|EF1A_METVA | Elongation factor 1-alpha OS=Methanococcus vannielii GN=tuf PE=3 SV=1 | 138 | 555 | 3.0E-78 |
| sp|P17197|EF1A_THECE | Elongation factor 1-alpha OS=Thermococcus celer GN=tuf PE=3 SV=1 | 135 | 560 | 5.0E-78 |
| sp|Q5JFZ4|EF1A_THEKO | Elongation factor 1-alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tuf PE=3 SV=1 | 135 | 560 | 1.0E-77 |
| sp|Q74MI6|EF1A_NANEQ | Elongation factor 1-alpha OS=Nanoarchaeum equitans (strain Kin4-M) GN=tuf PE=3 SV=1 | 135 | 555 | 3.0E-77 |
| sp|C5A5P4|EF1A_THEGJ | Elongation factor 1-alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=tuf PE=3 SV=1 | 135 | 560 | 7.0E-77 |
| sp|O74774|HBS1_SCHPO | Elongation factor 1 alpha-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hbs1 PE=1 SV=4 | 138 | 560 | 3.0E-73 |
| sp|P50257|EF1AS_PORPU | Elongation factor 1-alpha S OS=Porphyra purpurea GN=TEF-S PE=2 SV=1 | 132 | 557 | 3.0E-70 |
| sp|P32769|HBS1_YEAST | Elongation factor 1 alpha-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HBS1 PE=1 SV=2 | 137 | 562 | 3.0E-68 |
| sp|P27634|EF1A_RHYAM | Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1 | 183 | 561 | 4.0E-68 |
| sp|Q07051|EF1A_EIMBO | Elongation factor 1-alpha (Fragment) OS=Eimeria bovis PE=2 SV=1 | 235 | 562 | 6.0E-55 |
| sp|Q8SS29|EF1A_ENCCU | Elongation factor 1-alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TEF1 PE=1 SV=2 | 133 | 557 | 1.0E-47 |
| sp|Q20EU5|EFTU_OLTVI | Elongation factor Tu, chloroplastic OS=Oltmannsiellopsis viridis GN=tufA PE=3 SV=1 | 135 | 561 | 8.0E-44 |
| sp|Q7V500|EFTU_PROMM | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-43 |
| sp|B2J5B1|EFTU_NOSP7 | Elongation factor Tu OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tuf PE=3 SV=1 | 135 | 562 | 8.0E-43 |
| sp|P50064|EFTU_GLOVI | Elongation factor Tu OS=Gloeobacter violaceus (strain PCC 7421) GN=tufA PE=3 SV=2 | 135 | 562 | 1.0E-42 |
| sp|B0CCD0|EFTU_ACAM1 | Elongation factor Tu OS=Acaryochloris marina (strain MBIC 11017) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-42 |
| sp|Q2JUX4|EFTU_SYNJA | Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-42 |
| sp|P02991|EFTU_EUGGR | Elongation factor Tu, chloroplastic OS=Euglena gracilis GN=tufA PE=1 SV=1 | 135 | 562 | 3.0E-42 |
| sp|A2CC87|EFTU_PROM3 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-42 |
| sp|Q4G342|EFTU_EMIHU | Elongation factor Tu, chloroplastic OS=Emiliania huxleyi GN=tufA PE=3 SV=1 | 135 | 562 | 4.0E-42 |
| sp|A5GIP0|EFTU_SYNPW | Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-42 |
| sp|Q85FT7|EFTU_CYAME | Elongation factor Tu, chloroplastic OS=Cyanidioschyzon merolae GN=tufA PE=3 SV=1 | 135 | 562 | 8.0E-42 |
| sp|Q1ACI3|EFTU_CHAVU | Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1 | 128 | 563 | 1.0E-41 |
| sp|A9BCK0|EFTU_PROM4 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-41 |
| sp|P50371|EFTU_CHACO | Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1 | 128 | 559 | 2.0E-41 |
| sp|Q83ES6|EFTU_COXBU | Elongation factor Tu OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tufA PE=1 SV=1 | 135 | 562 | 3.0E-41 |
| sp|A9NAK7|EFTU_COXBR | Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1 | 135 | 562 | 3.0E-41 |
| sp|A9KD33|EFTU_COXBN | Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1 | 135 | 562 | 3.0E-41 |
| sp|Q3MDM5|EFTU_ANAVT | Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1 | 135 | 562 | 5.0E-41 |
| sp|B1WQY4|EFTU_CYAA5 | Elongation factor Tu OS=Cyanothece sp. (strain ATCC 51142) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-41 |
| sp|Q1XDK1|EFTU_PYRYE | Elongation factor Tu, chloroplastic OS=Pyropia yezoensis GN=tufA PE=3 SV=1 | 135 | 562 | 1.0E-40 |
| sp|Q3AMT6|EFTU_SYNSC | Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-40 |
| sp|Q8YP63|EFTU_NOSS1 | Elongation factor Tu OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tuf PE=1 SV=1 | 135 | 562 | 1.0E-40 |
| sp|A5GW14|EFTU_SYNR3 | Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-40 |
| sp|A9WFP3|EFTU_CHLAA | Elongation factor Tu OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=tuf1 PE=3 SV=1 | 135 | 562 | 2.0E-40 |
| sp|P19457|EFTU_GUITH | Elongation factor Tu, chloroplastic OS=Guillardia theta GN=tufA PE=3 SV=1 | 135 | 562 | 2.0E-40 |
| sp|B8HVR7|EFTU_CYAP4 | Elongation factor Tu OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-40 |
| sp|Q9TLV8|EFTU_CYACA | Elongation factor Tu, chloroplastic OS=Cyanidium caldarium GN=tufA PE=3 SV=1 | 135 | 562 | 2.0E-40 |
| sp|Q9TKZ5|EFTU_NEPOL | Elongation factor Tu, chloroplastic OS=Nephroselmis olivacea GN=tufA PE=3 SV=1 | 135 | 561 | 3.0E-40 |
| sp|A6Q1L5|EFTU_NITSB | Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 | 135 | 562 | 3.0E-40 |
| sp|P74227|EFTU_SYNY3 | Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tuf PE=1 SV=1 | 135 | 562 | 3.0E-40 |
| sp|Q2EEV7|EFTU_HELSJ | Elongation factor Tu, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=tufA PE=3 SV=2 | 134 | 561 | 3.0E-40 |
| sp|Q160Y4|EFTU_ROSDO | Elongation factor Tu OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tuf1 PE=3 SV=1 | 135 | 562 | 4.0E-40 |
| sp|A5D5I8|EFTU2_PELTS | Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 | 135 | 562 | 5.0E-40 |
| sp|Q7VJ74|EFTU_HELHP | Elongation factor Tu OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tuf PE=3 SV=1 | 135 | 562 | 5.0E-40 |
| sp|A2C4U5|EFTU_PROM1 | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 | 135 | 562 | 6.0E-40 |
| sp|P18906|EFTU_MYCGA | Elongation factor Tu OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-40 |
| sp|Q7VA05|EFTU_PROMA | Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 | 135 | 562 | 8.0E-40 |
| sp|B0TC54|EFTU_HELMI | Elongation factor Tu OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=tuf PE=3 SV=1 | 135 | 562 | 8.0E-40 |
| sp|A2CI56|EFTU_CHLAT | Elongation factor Tu, chloroplastic OS=Chlorokybus atmophyticus GN=tufA PE=3 SV=1 | 135 | 562 | 1.0E-39 |
| sp|P18668|EFTU_SYNP6 | Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-39 |
| sp|P33171|EFTU_SYNE7 | Elongation factor Tu OS=Synechococcus elongatus (strain PCC 7942) GN=tuf PE=3 SV=2 | 135 | 562 | 1.0E-39 |
| sp|B1XI63|EFTU_SYNP2 | Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-39 |
| sp|A5D5K0|EFTU1_PELTS | Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 | 135 | 562 | 1.0E-39 |
| sp|Q9TJQ8|EFTU_PROWI | Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 | 135 | 562 | 1.0E-39 |
| sp|O50293|EFTU_AQUPY | Elongation factor Tu OS=Aquifex pyrophilus GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-39 |
| sp|O66429|EFTU_AQUAE | Elongation factor Tu OS=Aquifex aeolicus (strain VF5) GN=tufA PE=3 SV=1 | 135 | 562 | 2.0E-39 |
| sp|P18905|EFTU_COLOB | Elongation factor Tu, chloroplastic OS=Coleochaete orbicularis GN=tufA PE=3 SV=1 | 126 | 562 | 2.0E-39 |
| sp|B8DLL9|EFTU_DESVM | Elongation factor Tu OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-39 |
| sp|P51287|EFTU_PORPU | Elongation factor Tu, chloroplastic OS=Porphyra purpurea GN=tufA PE=3 SV=1 | 135 | 562 | 3.0E-39 |
| sp|Q46IW4|EFTU_PROMT | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 | 135 | 562 | 3.0E-39 |
| sp|Q2JMX7|EFTU_SYNJB | Elongation factor Tu OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-39 |
| sp|Q1KVS9|EFTU_ACUOB | Elongation factor Tu, chloroplastic OS=Acutodesmus obliquus GN=tufA PE=3 SV=1 | 135 | 562 | 4.0E-39 |
| sp|Q3A9R3|EFTU1_CARHZ | Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 | 134 | 562 | 5.0E-39 |
| sp|Q6B8Y0|EFTU_GRATL | Elongation factor Tu, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=tufA PE=3 SV=1 | 135 | 562 | 6.0E-39 |
| sp|P17746|EFTU_CHLRE | Elongation factor Tu, chloroplastic OS=Chlamydomonas reinhardtii GN=tufA PE=3 SV=1 | 135 | 562 | 6.0E-39 |
| sp|B9MQH1|EFTU_CALBD | Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-39 |
| sp|Q5HVZ7|EFTU_CAMJR | Elongation factor Tu OS=Campylobacter jejuni (strain RM1221) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-39 |
| sp|A1VYI6|EFTU_CAMJJ | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-39 |
| sp|O69303|EFTU_CAMJE | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-39 |
| sp|A7H4R3|EFTU_CAMJD | Elongation factor Tu OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-39 |
| sp|A8FKQ5|EFTU_CAMJ8 | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-39 |
| sp|B9KFF9|EFTU_CAMLR | Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-39 |
| sp|P42482|EFTU_WOLSU | Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 | 135 | 560 | 9.0E-39 |
| sp|Q7U4D1|EFTU_SYNPX | Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-38 |
| sp|Q30TQ5|EFTU_SULDN | Elongation factor Tu OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=tuf PE=3 SV=1 | 135 | 561 | 1.0E-38 |
| sp|Q042T5|EFTU_LACGA | Elongation factor Tu OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=tuf PE=3 SV=2 | 131 | 562 | 1.0E-38 |
| sp|A6MW28|EFTU_RHDSA | Elongation factor Tu, chloroplastic OS=Rhodomonas salina GN=tufA PE=3 SV=1 | 135 | 562 | 1.0E-38 |
| sp|Q3A9P8|EFTU2_CARHZ | Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 | 134 | 562 | 1.0E-38 |
| sp|P56292|EFTU_CHLVU | Elongation factor Tu, chloroplastic OS=Chlorella vulgaris GN=tufA PE=3 SV=1 | 135 | 561 | 1.0E-38 |
| sp|P50372|EFTU_CODFR | Elongation factor Tu, chloroplastic OS=Codium fragile GN=tufA PE=3 SV=1 | 126 | 563 | 2.0E-38 |
| sp|A4XI37|EFTU_CALS8 | Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-38 |
| sp|Q74JU6|EFTU_LACJO | Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tuf PE=3 SV=1 | 131 | 562 | 2.0E-38 |
| sp|Q87DG7|CYSNC_XYLFT | Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysNC PE=3 SV=1 | 133 | 577 | 2.0E-38 |
| sp|Q2RFP5|EFTU_MOOTA | Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1 | 131 | 562 | 2.0E-38 |
| sp|Q0AUG3|EFTU2_SYNWW | Elongation factor Tu 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf2 PE=3 SV=1 | 131 | 562 | 2.0E-38 |
| sp|Q3ZJ24|EFTU_PSEAK | Elongation factor Tu, chloroplastic OS=Pseudendoclonium akinetum GN=tufA PE=3 SV=1 | 135 | 562 | 3.0E-38 |
| sp|A3DJ00|EFTU_CLOTH | Elongation factor Tu OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tuf PE=3 SV=1 | 135 | 562 | 3.0E-38 |
| sp|B3WE38|EFTU_LACCB | Elongation factor Tu OS=Lactobacillus casei (strain BL23) GN=tuf PE=3 SV=1 | 131 | 562 | 3.0E-38 |
| sp|Q039K9|EFTU_LACC3 | Elongation factor Tu OS=Lactobacillus casei (strain ATCC 334) GN=tuf PE=3 SV=1 | 131 | 562 | 3.0E-38 |
| sp|B5FGJ9|CYSN_VIBFM | Sulfate adenylyltransferase subunit 1 OS=Vibrio fischeri (strain MJ11) GN=cysN PE=3 SV=1 | 134 | 555 | 3.0E-38 |
| sp|Q0AUH8|EFTU1_SYNWW | Elongation factor Tu 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf1 PE=3 SV=1 | 131 | 562 | 3.0E-38 |
| sp|Q5E830|CYSN_VIBF1 | Sulfate adenylyltransferase subunit 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysN PE=3 SV=1 | 134 | 555 | 3.0E-38 |
| sp|A8G708|EFTU_PROM2 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 | 135 | 562 | 3.0E-38 |
| sp|A6Q6H4|EFTU_SULNB | Elongation factor Tu OS=Sulfurovum sp. (strain NBC37-1) GN=tuf PE=3 SV=1 | 135 | 561 | 4.0E-38 |
| sp|B9K884|EFTU_THENN | Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-38 |
| sp|Q318N5|EFTU_PROM9 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 | 135 | 561 | 5.0E-38 |
| sp|O24310|EFTU_PEA | Elongation factor Tu, chloroplastic OS=Pisum sativum GN=tufA PE=2 SV=1 | 135 | 562 | 5.0E-38 |
| sp|Q7UZY7|EFTU_PROMP | Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 | 135 | 562 | 5.0E-38 |
| sp|A2BYN4|EFTU_PROM5 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 | 135 | 562 | 6.0E-38 |
| sp|P26184|EFTU_FLESI | Elongation factor Tu OS=Flexistipes sinusarabici GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-38 |
| sp|P9WNM5|CYSNC_MYCTU | Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysNC PE=1 SV=1 | 138 | 565 | 7.0E-38 |
| sp|P9WNM4|CYSNC_MYCTO | Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysNC PE=3 SV=1 | 138 | 565 | 7.0E-38 |
| sp|Q8DI42|EFTU_THEEB | Elongation factor Tu OS=Thermosynechococcus elongatus (strain BP-1) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-38 |
| sp|A0L5V8|EFTU_MAGMM | Elongation factor Tu OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=tuf1 PE=3 SV=1 | 131 | 562 | 7.0E-38 |
| sp|A8EW02|EFTU_ARCB4 | Elongation factor Tu OS=Arcobacter butzleri (strain RM4018) GN=tuf PE=3 SV=1 | 135 | 561 | 8.0E-38 |
| sp|A3PEZ7|EFTU_PROM0 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 | 135 | 562 | 8.0E-38 |
| sp|B5ZC31|EFTU_UREU1 | Elongation factor Tu OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=tuf PE=3 SV=1 | 135 | 559 | 8.0E-38 |
| sp|A1VAK4|EFTU_DESVV | Elongation factor Tu OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=tuf PE=3 SV=1 | 135 | 562 | 9.0E-38 |
| sp|Q727D5|EFTU_DESVH | Elongation factor Tu OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=tuf PE=3 SV=1 | 135 | 562 | 9.0E-38 |
| sp|P02992|EFTU_YEAST | Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 | 135 | 562 | 9.0E-38 |
| sp|Q9PD78|CYSNC_XYLFA | Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain 9a5c) GN=cysNC PE=3 SV=2 | 124 | 577 | 1.0E-37 |
| sp|A2BT83|EFTU_PROMS | Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-37 |
| sp|B0JSE0|EFTU_MICAN | Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-37 |
| sp|Q06J54|EFTU_BIGNA | Elongation factor Tu, chloroplastic OS=Bigelowiella natans GN=tufA PE=3 SV=1 | 134 | 561 | 1.0E-37 |
| sp|B9L7I8|EFTU_NAUPA | Elongation factor Tu OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-37 |
| sp|P42472|EFTU_CHLAU | Elongation factor Tu (Fragment) OS=Chloroflexus aurantiacus GN=tuf PE=3 SV=1 | 145 | 562 | 1.0E-37 |
| sp|Q38WR7|EFTU_LACSS | Elongation factor Tu OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=tuf PE=3 SV=1 | 131 | 562 | 1.0E-37 |
| sp|P13552|EFTU_ARTPT | Elongation factor Tu OS=Arthrospira platensis GN=tuf PE=3 SV=1 | 135 | 561 | 1.0E-37 |
| sp|A8YUS2|EFTU_LACH4 | Elongation factor Tu OS=Lactobacillus helveticus (strain DPC 4571) GN=tuf PE=3 SV=1 | 131 | 562 | 2.0E-37 |
| sp|P50068|EFTU_UREPA | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=tuf PE=3 SV=1 | 135 | 559 | 2.0E-37 |
| sp|B1AJG3|EFTU_UREP2 | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=tuf PE=3 SV=1 | 135 | 559 | 2.0E-37 |
| sp|A5DN78|EFTU_PICGU | Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 | 135 | 562 | 2.0E-37 |
| sp|Q5LMR5|EFTU_RUEPO | Elongation factor Tu OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tuf1 PE=3 SV=1 | 135 | 562 | 2.0E-37 |
| sp|C4K4F8|EFTU_HAMD5 | Elongation factor Tu OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-37 |
| sp|Q9TMM9|EFTU_TOXGO | Elongation factor Tu, apicoplast OS=Toxoplasma gondii GN=tufA PE=3 SV=1 | 128 | 562 | 2.0E-37 |
| sp|Q118Z2|EFTU_TRIEI | Elongation factor Tu OS=Trichodesmium erythraeum (strain IMS101) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-37 |
| sp|A6YG72|EFTU_LEPTE | Elongation factor Tu, chloroplastic OS=Leptosira terrestris GN=tufA PE=3 SV=1 | 135 | 561 | 3.0E-37 |
| sp|B1KMH4|CYSN_SHEWM | Sulfate adenylyltransferase subunit 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysN PE=3 SV=1 | 135 | 555 | 3.0E-37 |
| sp|P46280|EFTU2_SOYBN | Elongation factor Tu, chloroplastic OS=Glycine max GN=TUFB1 PE=3 SV=1 | 135 | 562 | 3.0E-37 |
| sp|Q28UW7|EFTU_JANSC | Elongation factor Tu OS=Jannaschia sp. (strain CCS1) GN=tuf1 PE=3 SV=1 | 135 | 562 | 3.0E-37 |
| sp|Q0P3M7|EFTU_OSTTA | Elongation factor Tu, chloroplastic OS=Ostreococcus tauri GN=tufA PE=3 SV=1 | 135 | 562 | 4.0E-37 |
| sp|P17245|EFTU_CYAPA | Elongation factor Tu, cyanelle OS=Cyanophora paradoxa GN=tufA PE=3 SV=2 | 135 | 562 | 4.0E-37 |
| sp|A8Z5T8|EFTU_SULMW | Elongation factor Tu OS=Sulcia muelleri (strain GWSS) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-37 |
| sp|A8LLG2|EFTU_DINSH | Elongation factor Tu OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=tuf1 PE=3 SV=1 | 135 | 562 | 4.0E-37 |
| sp|B7K834|EFTU_CYAP7 | Elongation factor Tu OS=Cyanothece sp. (strain PCC 7424) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-37 |
| sp|B6YQ04|EFTU_AZOPC | Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 | 135 | 562 | 5.0E-37 |
| sp|A0RQJ3|EFTU_CAMFF | Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1 | 135 | 561 | 5.0E-37 |
| sp|Q5FKR8|EFTU_LACAC | Elongation factor Tu OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tuf PE=3 SV=1 | 131 | 562 | 6.0E-37 |
| sp|Q8EX18|EFTU_MYCPE | Elongation factor Tu OS=Mycoplasma penetrans (strain HF-2) GN=tuf PE=3 SV=1 | 135 | 562 | 8.0E-37 |
| sp|Q06SH3|EFTU_STIHE | Elongation factor Tu, chloroplastic OS=Stigeoclonium helveticum GN=tufA PE=3 SV=1 | 135 | 563 | 9.0E-37 |
| sp|P23568|EFTU_MYCPN | Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=tuf PE=3 SV=2 | 135 | 562 | 9.0E-37 |
| sp|Q482Z9|CYSN_COLP3 | Sulfate adenylyltransferase subunit 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysN PE=3 SV=1 | 128 | 470 | 9.0E-37 |
| sp|Q04FQ4|EFTU_OENOB | Elongation factor Tu OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=tuf PE=3 SV=1 | 131 | 560 | 1.0E-36 |
| sp|A6LLL1|EFTU_THEM4 | Elongation factor Tu OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-36 |
| sp|Q1WU83|EFTU_LACS1 | Elongation factor Tu OS=Lactobacillus salivarius (strain UCC118) GN=tuf PE=3 SV=1 | 131 | 560 | 1.0E-36 |
| sp|P68158|EFTU_TOBAC | Elongation factor Tu, chloroplastic OS=Nicotiana tabacum GN=TUFA PE=3 SV=1 | 45 | 562 | 1.0E-36 |
| sp|Q40450|EFTUA_NICSY | Elongation factor TuA, chloroplastic OS=Nicotiana sylvestris GN=TUFA PE=2 SV=2 | 45 | 562 | 1.0E-36 |
| sp|Q839G8|EFTU_ENTFA | Elongation factor Tu OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tuf PE=3 SV=1 | 135 | 561 | 2.0E-36 |
| sp|P14634|EFTU_EUGLO | Elongation factor Tu, plastid OS=Euglena longa GN=tufA PE=3 SV=1 | 134 | 562 | 2.0E-36 |
| sp|B7JUP5|EFTU_CYAP8 | Elongation factor Tu OS=Cyanothece sp. (strain PCC 8801) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-36 |
| sp|A5USJ1|EFTU1_ROSS1 | Elongation factor Tu 1 OS=Roseiflexus sp. (strain RS-1) GN=tuf1 PE=3 SV=1 | 135 | 562 | 2.0E-36 |
| sp|Q5FTY1|EFTU_GLUOX | Elongation factor Tu OS=Gluconobacter oxydans (strain 621H) GN=tuf PE=3 SV=1 | 135 | 560 | 2.0E-36 |
| sp|Q9MUP0|EFTU_MESVI | Elongation factor Tu, chloroplastic OS=Mesostigma viride GN=tufA PE=3 SV=1 | 135 | 562 | 2.0E-36 |
| sp|B7GJ65|EFTU_ANOFW | Elongation factor Tu OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-36 |
| sp|Q6YQV8|EFTU_ONYPE | Elongation factor Tu OS=Onion yellows phytoplasma (strain OY-M) GN=tuf PE=3 SV=1 | 135 | 561 | 2.0E-36 |
| sp|Q605B0|EFTU_METCA | Elongation factor Tu OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tuf1 PE=3 SV=1 | 135 | 562 | 2.0E-36 |
| sp|C5D3R5|EFTU_GEOSW | Elongation factor Tu OS=Geobacillus sp. (strain WCH70) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-36 |
| sp|P42477|EFTU_HERAU | Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 | 135 | 561 | 3.0E-36 |
| sp|C1D890|CYSN_LARHH | Sulfate adenylyltransferase subunit 1 OS=Laribacter hongkongensis (strain HLHK9) GN=cysN PE=3 SV=1 | 126 | 453 | 3.0E-36 |
| sp|Q7TT91|EFTU_BORPE | Elongation factor Tu OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=tuf1 PE=3 SV=1 | 135 | 562 | 3.0E-36 |
| sp|Q79GC6|EFTU_BORPA | Elongation factor Tu OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=tuf1 PE=3 SV=1 | 135 | 562 | 3.0E-36 |
| sp|Q79G84|EFTU_BORBR | Elongation factor Tu OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=tuf1 PE=3 SV=1 | 135 | 562 | 3.0E-36 |
| sp|B7IHU4|EFTU_THEAB | Elongation factor Tu OS=Thermosipho africanus (strain TCF52B) GN=tuf PE=3 SV=1 | 135 | 562 | 3.0E-36 |
| sp|A7ZCN0|EFTU_CAMC1 | Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 | 135 | 561 | 3.0E-36 |
| sp|P13927|EFTU_MYCGE | Elongation factor Tu OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=tuf PE=3 SV=1 | 135 | 562 | 3.0E-36 |
| sp|Q1D7V1|EFTU1_MYXXD | Elongation factor Tu 1 OS=Myxococcus xanthus (strain DK 1622) GN=tuf1 PE=3 SV=1 | 135 | 562 | 3.0E-36 |
| sp|Q5LES3|CYSN_BACFN | Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=cysN PE=3 SV=1 | 135 | 469 | 3.0E-36 |
| sp|B1Z7C0|CYSN_METPB | Sulfate adenylyltransferase subunit 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=cysN PE=3 SV=1 | 135 | 504 | 3.0E-36 |
| sp|Q5WLR4|EFTU_BACSK | Elongation factor Tu OS=Bacillus clausii (strain KSM-K16) GN=tuf PE=3 SV=1 | 135 | 562 | 3.0E-36 |
| sp|Q64VQ9|CYSN_BACFR | Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain YCH46) GN=cysN PE=3 SV=1 | 135 | 469 | 3.0E-36 |
| sp|Q3J8Q0|EFTU_NITOC | Elongation factor Tu OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tuf1 PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|P42473|EFTU_CHLP8 | Elongation factor Tu OS=Chlorobaculum parvum (strain NCIB 8327) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|Q5NQ65|EFTU_ZYMMO | Elongation factor Tu OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|Q72GW4|EFTU_THET2 | Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|B5Z8K3|EFTU_HELPG | Elongation factor Tu OS=Helicobacter pylori (strain G27) GN=tuf PE=3 SV=1 | 131 | 562 | 4.0E-36 |
| sp|P17745|EFTU_ARATH | Elongation factor Tu, chloroplastic OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 | 135 | 562 | 4.0E-36 |
| sp|Q54HB2|EFTU_DICDI | Elongation factor Tu, mitochondrial OS=Dictyostelium discoideum GN=tufm PE=1 SV=2 | 135 | 561 | 4.0E-36 |
| sp|P64029|EFTU_STAAW | Elongation factor Tu OS=Staphylococcus aureus (strain MW2) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|A8YZP5|EFTU_STAAT | Elongation factor Tu OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|Q6GBT9|EFTU_STAAS | Elongation factor Tu OS=Staphylococcus aureus (strain MSSA476) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|Q6GJC0|EFTU_STAAR | Elongation factor Tu OS=Staphylococcus aureus (strain MRSA252) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|P99152|EFTU_STAAN | Elongation factor Tu OS=Staphylococcus aureus (strain N315) GN=tuf PE=1 SV=1 | 135 | 562 | 4.0E-36 |
| sp|P64028|EFTU_STAAM | Elongation factor Tu OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|A6QEK0|EFTU_STAAE | Elongation factor Tu OS=Staphylococcus aureus (strain Newman) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|Q5HIC7|EFTU_STAAC | Elongation factor Tu OS=Staphylococcus aureus (strain COL) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|Q2YSB3|EFTU_STAAB | Elongation factor Tu OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|A5IQA2|EFTU_STAA9 | Elongation factor Tu OS=Staphylococcus aureus (strain JH9) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|Q2G0N0|EFTU_STAA8 | Elongation factor Tu OS=Staphylococcus aureus (strain NCTC 8325) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|Q2FJ92|EFTU_STAA3 | Elongation factor Tu OS=Staphylococcus aureus (strain USA300) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|A6TZ25|EFTU_STAA2 | Elongation factor Tu OS=Staphylococcus aureus (strain JH1) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|A7WYX6|EFTU_STAA1 | Elongation factor Tu OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-36 |
| sp|P60339|EFTU2_THET8 | Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 | 135 | 562 | 5.0E-36 |
| sp|A8F2E9|EFTU_RICM5 | Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 | 135 | 560 | 5.0E-36 |
| sp|P56003|EFTU_HELPY | Elongation factor Tu OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tuf PE=3 SV=1 | 131 | 562 | 5.0E-36 |
| sp|Q5L3Z9|EFTU_GEOKA | Elongation factor Tu OS=Geobacillus kaustophilus (strain HTA426) GN=tuf PE=3 SV=1 | 135 | 562 | 5.0E-36 |
| sp|B2UUW8|EFTU_HELPS | Elongation factor Tu OS=Helicobacter pylori (strain Shi470) GN=tuf PE=3 SV=1 | 131 | 562 | 5.0E-36 |
| sp|P60338|EFTU1_THETH | Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 | 135 | 562 | 5.0E-36 |
| sp|Q5SHN6|EFTU1_THET8 | Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 | 135 | 562 | 5.0E-36 |
| sp|Q2GFN6|EFTU_EHRCR | Elongation factor Tu OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=tuf1 PE=3 SV=1 | 135 | 562 | 6.0E-36 |
| sp|Q1D776|EFTU2_MYXXD | Elongation factor Tu 2 OS=Myxococcus xanthus (strain DK 1622) GN=tuf2 PE=3 SV=1 | 135 | 562 | 6.0E-36 |
| sp|Q7M7F1|EFTU_CHRVO | Elongation factor Tu OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tuf1 PE=3 SV=1 | 135 | 561 | 6.0E-36 |
| sp|Q4L3K9|EFTU_STAHJ | Elongation factor Tu OS=Staphylococcus haemolyticus (strain JCSC1435) GN=tuf PE=3 SV=1 | 135 | 562 | 6.0E-36 |
| sp|B6JN44|EFTU_HELP2 | Elongation factor Tu OS=Helicobacter pylori (strain P12) GN=tuf PE=3 SV=1 | 131 | 562 | 6.0E-36 |
| sp|B8I5N8|EFTU_CLOCE | Elongation factor Tu OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-36 |
| sp|Q748X8|EFTU_GEOSL | Elongation factor Tu OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tuf1 PE=3 SV=1 | 135 | 562 | 7.0E-36 |
| sp|A5N4N1|EFTU_CLOK5 | Elongation factor Tu OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=tuf1 PE=3 SV=1 | 135 | 562 | 7.0E-36 |
| sp|B1YGU8|EFTU_EXIS2 | Elongation factor Tu OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-36 |
| sp|A4J0Z5|EFTU_DESRM | Elongation factor Tu OS=Desulfotomaculum reducens (strain MI-1) GN=tuf PE=3 SV=1 | 131 | 562 | 8.0E-36 |
| sp|A9H3R7|EFTU_GLUDA | Elongation factor Tu OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=tuf PE=3 SV=1 | 135 | 560 | 8.0E-36 |
| sp|Q01698|EFTU_THEAQ | Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 | 135 | 562 | 9.0E-36 |
| sp|A7GZK6|EFTU_CAMC5 | Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 | 135 | 561 | 1.0E-35 |
| sp|Q43364|EFTUB_NICSY | Elongation factor TuB, chloroplastic OS=Nicotiana sylvestris GN=TUFB PE=2 SV=1 | 135 | 562 | 1.0E-35 |
| sp|Q3AW53|EFTU_SYNS9 | Elongation factor Tu OS=Synechococcus sp. (strain CC9902) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-35 |
| sp|Q0ID59|EFTU_SYNS3 | Elongation factor Tu OS=Synechococcus sp. (strain CC9311) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-35 |
| sp|B6ELP3|CYSN_ALISL | Sulfate adenylyltransferase subunit 1 OS=Aliivibrio salmonicida (strain LFI1238) GN=cysN PE=3 SV=1 | 135 | 555 | 1.0E-35 |
| sp|O21245|EFTU_RECAM | Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 | 135 | 562 | 1.0E-35 |
| sp|B2GBC2|EFTU_LACF3 | Elongation factor Tu OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=tuf PE=3 SV=1 | 131 | 562 | 1.0E-35 |
| sp|A7NR65|EFTU1_ROSCS | Elongation factor Tu 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=tuf1 PE=3 SV=1 | 135 | 562 | 1.0E-35 |
| sp|Q03F25|EFTU_PEDPA | Elongation factor Tu OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=tuf PE=3 SV=1 | 131 | 560 | 1.0E-35 |
| sp|Q07KJ2|EFTU_RHOP5 | Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisA53) GN=tuf1 PE=3 SV=1 | 135 | 562 | 2.0E-35 |
| sp|A4IJI7|EFTU_GEOTN | Elongation factor Tu OS=Geobacillus thermodenitrificans (strain NG80-2) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-35 |
| sp|A9BHA7|EFTU_PETMO | Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-35 |
| sp|Q04B37|EFTU_LACDB | Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tuf PE=3 SV=1 | 131 | 560 | 2.0E-35 |
| sp|Q1GAQ0|EFTU_LACDA | Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tuf PE=3 SV=1 | 131 | 560 | 2.0E-35 |
| sp|P49410|EFTU_BOVIN | Elongation factor Tu, mitochondrial OS=Bos taurus GN=TUFM PE=1 SV=1 | 135 | 558 | 2.0E-35 |
| sp|Q1H4N9|EFTU2_METFK | Elongation factor Tu 2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf2 PE=3 SV=1 | 135 | 562 | 2.0E-35 |
| sp|P40175|EFTU3_STRCO | Elongation factor Tu-3 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf3 PE=3 SV=2 | 131 | 560 | 2.0E-35 |
| sp|P85834|EFTU_RAT | Elongation factor Tu, mitochondrial OS=Rattus norvegicus GN=Tufm PE=1 SV=1 | 135 | 558 | 2.0E-35 |
| sp|O50306|EFTU_GEOSE | Elongation factor Tu OS=Geobacillus stearothermophilus GN=tuf PE=3 SV=2 | 135 | 562 | 2.0E-35 |
| sp|Q8KT99|EFTU_RICHE | Elongation factor Tu OS=Rickettsia helvetica GN=tuf PE=3 SV=1 | 135 | 560 | 2.0E-35 |
| sp|A5CCA0|EFTU1_ORITB | Elongation factor Tu 1 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf1 PE=3 SV=1 | 135 | 562 | 2.0E-35 |
| sp|C4LAG3|CYSN_TOLAT | Sulfate adenylyltransferase subunit 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysN PE=3 SV=1 | 135 | 464 | 2.0E-35 |
| sp|Q1GDV0|EFTU_RUEST | Elongation factor Tu OS=Ruegeria sp. (strain TM1040) GN=tuf1 PE=3 SV=1 | 135 | 561 | 2.0E-35 |
| sp|Q2NJ20|EFTU_AYWBP | Elongation factor Tu OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tuf PE=3 SV=1 | 135 | 561 | 2.0E-35 |
| sp|Q9ZK19|EFTU_HELPJ | Elongation factor Tu OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=tuf PE=3 SV=1 | 137 | 562 | 2.0E-35 |
| sp|Q6N4Q4|EFTU_RHOPA | Elongation factor Tu OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=tuf1 PE=3 SV=1 | 135 | 562 | 2.0E-35 |
| sp|Q03QN5|EFTU_LACBA | Elongation factor Tu OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=tuf PE=3 SV=1 | 131 | 560 | 2.0E-35 |
| sp|A1JJT0|CYSN_YERE8 | Sulfate adenylyltransferase subunit 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysN PE=3 SV=1 | 135 | 457 | 2.0E-35 |
| sp|C4KZP9|EFTU_EXISA | Elongation factor Tu OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-35 |
| sp|Q0ANN1|EFTU_MARMM | Elongation factor Tu OS=Maricaulis maris (strain MCS10) GN=tuf1 PE=3 SV=1 | 135 | 562 | 3.0E-35 |
| sp|Q67JU1|EFTU_SYMTH | Elongation factor Tu OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tuf PE=3 SV=1 | 135 | 562 | 3.0E-35 |
| sp|Q8KT95|EFTU_RICTY | Elongation factor Tu OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tuf PE=3 SV=2 | 135 | 560 | 3.0E-35 |
| sp|Q8BFR5|EFTU_MOUSE | Elongation factor Tu, mitochondrial OS=Mus musculus GN=Tufm PE=1 SV=1 | 135 | 558 | 3.0E-35 |
| sp|A5CCL4|EFTU2_ORITB | Elongation factor Tu 2 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf2 PE=3 SV=2 | 135 | 562 | 3.0E-35 |
| sp|Q92GW4|EFTU_RICCN | Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 | 135 | 560 | 4.0E-35 |
| sp|Q8KTA3|EFTU_RICRH | Elongation factor Tu OS=Rickettsia rhipicephali GN=tuf PE=3 SV=1 | 135 | 560 | 4.0E-35 |
| sp|A9ISD9|EFTU_BART1 | Elongation factor Tu OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=tuf1 PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|P42474|EFTU_CELLY | Elongation factor Tu OS=Cellulophaga lytica GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|Q6HPR0|EFTU_BACHK | Elongation factor Tu OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|Q63H92|EFTU_BACCZ | Elongation factor Tu OS=Bacillus cereus (strain ZK / E33L) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|Q814C4|EFTU_BACCR | Elongation factor Tu OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|B7HJ46|EFTU_BACC4 | Elongation factor Tu OS=Bacillus cereus (strain B4264) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|C1ET37|EFTU_BACC3 | Elongation factor Tu OS=Bacillus cereus (strain 03BB102) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|B7JKB7|EFTU_BACC0 | Elongation factor Tu OS=Bacillus cereus (strain AH820) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|Q81VT2|EFTU_BACAN | Elongation factor Tu OS=Bacillus anthracis GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|A0R8H8|EFTU_BACAH | Elongation factor Tu OS=Bacillus thuringiensis (strain Al Hakam) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|C3LJ80|EFTU_BACAC | Elongation factor Tu OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|C3P9Q3|EFTU_BACAA | Elongation factor Tu OS=Bacillus anthracis (strain A0248) GN=tuf PE=3 SV=1 | 135 | 562 | 4.0E-35 |
| sp|Q3J5S4|EFTU_RHOS4 | Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=tuf1 PE=3 SV=1 | 135 | 561 | 4.0E-35 |
| sp|A3PGI1|EFTU_RHOS1 | Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=tuf1 PE=3 SV=1 | 135 | 561 | 4.0E-35 |
| sp|P0A3B0|EFTU_RICSI | Elongation factor Tu OS=Rickettsia sibirica GN=tuf PE=3 SV=1 | 135 | 560 | 5.0E-35 |
| sp|P0A3A9|EFTU_RICRI | Elongation factor Tu OS=Rickettsia rickettsii GN=tuf PE=3 SV=1 | 135 | 560 | 5.0E-35 |
| sp|Q65PA9|EFTU_BACLD | Elongation factor Tu OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tuf PE=3 SV=1 | 135 | 562 | 5.0E-35 |
| sp|C5CGR6|EFTU_KOSOT | Elongation factor Tu OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tuf PE=3 SV=1 | 135 | 562 | 5.0E-35 |
| sp|Q8AAP9|CYSN_BACTN | Sulfate adenylyltransferase subunit 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cysN PE=3 SV=1 | 135 | 469 | 5.0E-35 |
| sp|Q255F3|EFTU_CHLFF | Elongation factor Tu OS=Chlamydophila felis (strain Fe/C-56) GN=tuf PE=3 SV=1 | 135 | 561 | 5.0E-35 |
| sp|Q1H4Q1|EFTU1_METFK | Elongation factor Tu 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf1 PE=3 SV=1 | 135 | 562 | 5.0E-35 |
| sp|Q877P8|EFTU_XYLFT | Elongation factor Tu OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tufA PE=3 SV=2 | 128 | 561 | 6.0E-35 |
| sp|P09953|EFTU_MICLU | Elongation factor Tu OS=Micrococcus luteus GN=tuf PE=3 SV=1 | 135 | 560 | 6.0E-35 |
| sp|A7HWP7|EFTU_PARL1 | Elongation factor Tu OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=tuf1 PE=3 SV=1 | 135 | 562 | 6.0E-35 |
| sp|B8J1A0|EFTU_DESDA | Elongation factor Tu OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=tuf PE=3 SV=1 | 135 | 562 | 6.0E-35 |
| sp|Q9P9Q9|EFTU_XYLFA | Elongation factor Tu OS=Xylella fastidiosa (strain 9a5c) GN=tufA PE=1 SV=3 | 128 | 561 | 6.0E-35 |
| sp|B9IZJ2|EFTU_BACCQ | Elongation factor Tu OS=Bacillus cereus (strain Q1) GN=tuf PE=3 SV=1 | 135 | 562 | 6.0E-35 |
| sp|B7HQU2|EFTU_BACC7 | Elongation factor Tu OS=Bacillus cereus (strain AH187) GN=tuf PE=3 SV=1 | 135 | 562 | 6.0E-35 |
| sp|Q73F98|EFTU_BACC1 | Elongation factor Tu OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tuf PE=3 SV=1 | 135 | 562 | 6.0E-35 |
| sp|A5WGK9|EFTU1_PSYWF | Elongation factor Tu 1 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf1 PE=3 SV=1 | 135 | 560 | 6.0E-35 |
| sp|Q73IX6|EFTU1_WOLPM | Elongation factor Tu 1 OS=Wolbachia pipientis wMel GN=tuf1 PE=3 SV=1 | 135 | 562 | 7.0E-35 |
| sp|A8F982|EFTU_BACP2 | Elongation factor Tu OS=Bacillus pumilus (strain SAFR-032) GN=tuf PE=3 SV=1 | 135 | 562 | 7.0E-35 |
| sp|A1WVC4|EFTU1_HALHL | Elongation factor Tu 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf1 PE=3 SV=1 | 135 | 562 | 7.0E-35 |
| sp|Q1RHL9|EFTU_RICBR | Elongation factor Tu OS=Rickettsia bellii (strain RML369-C) GN=tuf PE=3 SV=1 | 135 | 561 | 7.0E-35 |
| sp|A8GVB2|EFTU_RICB8 | Elongation factor Tu OS=Rickettsia bellii (strain OSU 85-389) GN=tuf PE=3 SV=1 | 135 | 561 | 7.0E-35 |
| sp|Q73H85|EFTU2_WOLPM | Elongation factor Tu 2 OS=Wolbachia pipientis wMel GN=tuf2 PE=3 SV=1 | 135 | 562 | 8.0E-35 |
| sp|A8GT71|EFTU_RICRS | Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 | 135 | 560 | 8.0E-35 |
| sp|B0BUR2|EFTU_RICRO | Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 | 135 | 560 | 8.0E-35 |
| sp|C4K2I2|EFTU_RICPU | Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 | 135 | 560 | 8.0E-35 |
| sp|C3PPA9|EFTU_RICAE | Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 | 135 | 560 | 8.0E-35 |
| sp|Q6AP73|EFTU2_DESPS | Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 | 135 | 562 | 8.0E-35 |
| sp|C6C171|EFTU_DESAD | Elongation factor Tu OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=tuf PE=3 SV=1 | 135 | 562 | 8.0E-35 |
| sp|Q8CQ81|EFTU_STAES | Elongation factor Tu OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tuf PE=3 SV=1 | 135 | 562 | 8.0E-35 |
| sp|Q5HRK4|EFTU_STAEQ | Elongation factor Tu OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=tuf PE=3 SV=1 | 135 | 562 | 8.0E-35 |
| sp|Q2YAZ9|EFTU_NITMU | Elongation factor Tu OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=tuf1 PE=3 SV=1 | 135 | 562 | 8.0E-35 |
| sp|Q2LQA3|EFTU_SYNAS | Elongation factor Tu OS=Syntrophus aciditrophicus (strain SB) GN=tuf PE=3 SV=1 | 135 | 562 | 9.0E-35 |
| sp|Q5HAS0|EFTU_EHRRW | Elongation factor Tu OS=Ehrlichia ruminantium (strain Welgevonden) GN=tuf1 PE=3 SV=1 | 135 | 562 | 9.0E-35 |
| sp|Q5FFE6|EFTU_EHRRG | Elongation factor Tu OS=Ehrlichia ruminantium (strain Gardel) GN=tuf1 PE=3 SV=1 | 135 | 562 | 9.0E-35 |
| sp|A0LIH6|EFTU_SYNFM | Elongation factor Tu OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=tuf1 PE=3 SV=1 | 135 | 562 | 9.0E-35 |
| sp|Q2L2G6|EFTU_BORA1 | Elongation factor Tu OS=Bordetella avium (strain 197N) GN=tuf1 PE=3 SV=1 | 135 | 562 | 9.0E-35 |
| sp|Q250N4|EFTU_DESHY | Elongation factor Tu OS=Desulfitobacterium hafniense (strain Y51) GN=tuf PE=3 SV=1 | 135 | 562 | 9.0E-35 |
| sp|B8G1W4|EFTU_DESHD | Elongation factor Tu OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tuf PE=3 SV=1 | 135 | 562 | 9.0E-35 |
| sp|Q3YRK7|EFTU_EHRCJ | Elongation factor Tu OS=Ehrlichia canis (strain Jake) GN=tuf1 PE=3 SV=1 | 135 | 562 | 1.0E-34 |
| sp|A5WH42|EFTU2_PSYWF | Elongation factor Tu 2 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf2 PE=3 SV=1 | 135 | 560 | 1.0E-34 |
| sp|Q661E5|EFTU_BORBP | Elongation factor Tu OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=tuf PE=3 SV=1 | 128 | 562 | 1.0E-34 |
| sp|B7J241|EFTU_BORBZ | Elongation factor Tu OS=Borrelia burgdorferi (strain ZS7) GN=tuf PE=3 SV=1 | 128 | 562 | 1.0E-34 |
| sp|P50062|EFTU_BORBU | Elongation factor Tu OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=tuf PE=3 SV=1 | 128 | 562 | 1.0E-34 |
| sp|Q88VE0|EFTU_LACPL | Elongation factor Tu OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=tuf PE=3 SV=1 | 131 | 560 | 1.0E-34 |
| sp|Q5L5H6|EFTU_CHLAB | Elongation factor Tu OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tuf PE=3 SV=1 | 135 | 561 | 1.0E-34 |
| sp|P29544|EFTU3_STRRA | Elongation factor Tu-3 OS=Streptomyces ramocissimus GN=tuf3 PE=3 SV=1 | 131 | 561 | 1.0E-34 |
| sp|A7I3U7|EFTU_CAMHC | Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 | 131 | 561 | 1.0E-34 |
| sp|A7Z0N5|EFTU_BACMF | Elongation factor Tu OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-34 |
| sp|A5V604|EFTU_SPHWW | Elongation factor Tu OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=tuf PE=3 SV=1 | 135 | 560 | 1.0E-34 |
| sp|B7IT17|EFTU_BACC2 | Elongation factor Tu OS=Bacillus cereus (strain G9842) GN=tuf PE=3 SV=1 | 135 | 562 | 1.0E-34 |
| sp|Q822I4|EFTU_CHLCV | Elongation factor Tu OS=Chlamydophila caviae (strain GPIC) GN=tuf PE=3 SV=3 | 135 | 561 | 1.0E-34 |
| sp|Q0BUQ2|EFTU_GRABC | Elongation factor Tu OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=tuf PE=3 SV=1 | 135 | 560 | 1.0E-34 |
| sp|Q8D240|EFTU_WIGBR | Elongation factor Tu OS=Wigglesworthia glossinidia brevipalpis GN=tuf PE=3 SV=1 | 134 | 561 | 1.0E-34 |
| sp|Q6AP86|EFTU1_DESPS | Elongation factor Tu 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf1 PE=3 SV=1 | 135 | 561 | 1.0E-34 |
| sp|Q9Z9L6|EFTU_BACHD | Elongation factor Tu OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=tuf PE=3 SV=1 | 135 | 560 | 2.0E-34 |
| sp|Q5QWA3|EFTU_IDILO | Elongation factor Tu OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tuf1 PE=3 SV=1 | 135 | 562 | 2.0E-34 |
| sp|Q3SSW8|EFTU_NITWN | Elongation factor Tu OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-34 |
| sp|Q99QM0|EFTU_CAUCR | Elongation factor Tu OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=tufA PE=3 SV=1 | 135 | 562 | 2.0E-34 |
| sp|B3QZH5|EFTU_PHYMT | Elongation factor Tu OS=Phytoplasma mali (strain AT) GN=tuf PE=3 SV=1 | 135 | 562 | 2.0E-34 |
| sp|Q2IXR2|EFTU_RHOP2 | Elongation factor Tu OS=Rhodopseudomonas palustris (strain HaA2) GN=tuf1 PE=3 SV=1 | 135 | 562 | 2.0E-34 |
| sp|A5UYI1|EFTU2_ROSS1 | Elongation factor Tu 2 OS=Roseiflexus sp. (strain RS-1) GN=tuf2 PE=3 SV=1 | 135 | 562 | 2.0E-34 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005525 | GTP binding | Yes |
| GO:0003924 | GTPase activity | Yes |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0032561 | guanyl ribonucleotide binding | No |
| GO:0036094 | small molecule binding | No |
| GO:0019001 | guanyl nucleotide binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:0016462 | pyrophosphatase activity | No |
| GO:0043168 | anion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0003674 | molecular_function | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| GO:0000166 | nucleotide binding | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm | 0.7116 | 0.5125 | 0.0067 | 0.0509 | 0.159 | 0.0104 | 0.1168 | 0.1946 | 0.1376 | 0.0384 |
| Orthofinder run ID | 1 |
| Orthogroup | 4367 |
| Change Orthofinder run |
| Species | Protein ID |
|---|---|
| Agaricus bisporus var bisporus H39 | AgabiH39|073150 |
| Agaricus bisporus var bisporus H97 | AgabiH97|073150 (this protein) |
| Rhodonia placenta FPRL280 | RhoplFPRL280|5_118 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|073150 MSKLSASAFEFVPGKGLVQTQPSLRAPIERPEQTEAPPPPPTISLSIGGSKPPPPAQAPPTTNPPTATQTPPAST PQTSKPATPKPQTTIKVEQAGTSSKTFTTEKAKTDALTVAQDVKDAADRAVLEDLYGDVKEHLNIVFIGHVDAGK STMGGNILYLTGMVDKRTMEKYEKEAKEAGRETWYLSWALDSTPQERNKGKTVEVGRAYFETDTRRYTILDAPGH KTYVPSMISGAAQADVAILVVSARKGEFETGFEKGGQTREHIMLVKTAGVSKVVIVINKMDDPTVQWEKARYEEI KEKMIPFARSAGFSPKTDVCFMPVSAYTGANLKDPVSEQVCSWWDGPSFLQHLDKMPMVDRKIHAPLMMPVSEKY KDMGTVIVGKIESGHLRKGDSLVLMPNKDVVEVSAIYNEMEEEVDRSLCGDNVRIRIRGIDDEDINPGFVLTSPS KPIRAVKQFEAQLAILEHKNIICAGYSAVLHVHTLSEEVVLSGLLHYFDKATGRKSKRPPQFAKKGQKIVALIET TAPICIEKFSDYPQLGRFTLRDEGRTVAIGKVTKLIESGTIEETTNGVANLNVNA* |
| Coding | >AgabiH97|073150 ATGAGCAAGCTCAGTGCCTCCGCCTTTGAATTCGTCCCCGGAAAAGGATTGGTCCAGACTCAGCCGTCACTGAGG GCTCCCATCGAGCGTCCAGAGCAGACGGAGGCCCCTCCTCCGCCTCCGACCATCTCCCTCAGCATAGGAGGGTCC AAACCCCCTCCCCCAGCACAAGCACCTCCTACCACTAACCCTCCTACAGCAACCCAAACGCCGCCTGCATCCACT CCCCAGACATCTAAACCTGCCACCCCCAAGCCTCAGACCACCATCAAGGTAGAACAGGCTGGCACATCATCTAAA ACTTTTACAACAGAAAAGGCAAAAACAGACGCCCTTACCGTCGCCCAGGACGTCAAGGATGCTGCAGATAGGGCC GTCTTGGAAGATCTTTATGGTGATGTCAAGGAACATCTGAATATTGTCTTCATCGGTCATGTTGATGCGGGAAAG AGTACCATGGGTGGTAACATTCTCTACCTGACAGGGATGGTAGATAAGCGTACTATGGAAAAATATGAAAAGGAA GCTAAAGAAGCTGGACGGGAGACATGGTACCTCAGTTGGGCTCTTGACTCCACTCCTCAGGAACGAAACAAGGGC AAAACAGTGGAGGTGGGCCGCGCATACTTTGAGACCGACACGAGGAGGTACACTATTCTCGACGCCCCCGGCCAT AAAACCTATGTTCCCAGCATGATATCCGGAGCCGCTCAGGCTGATGTCGCTATCCTCGTTGTCTCCGCCCGCAAA GGTGAATTCGAAACTGGTTTCGAGAAAGGTGGCCAGACTCGTGAACATATCATGCTGGTCAAGACTGCCGGCGTC TCAAAGGTCGTTATCGTAATTAACAAAATGGACGATCCCACCGTCCAGTGGGAAAAGGCGCGCTACGAGGAGATT AAGGAGAAAATGATACCATTTGCAAGGTCTGCTGGCTTCAGCCCCAAGACCGACGTCTGCTTCATGCCCGTCTCT GCCTACACGGGTGCAAATTTAAAAGATCCCGTTTCCGAGCAAGTTTGCTCATGGTGGGACGGACCATCTTTCCTT CAGCATCTTGATAAGATGCCCATGGTTGATCGCAAAATCCATGCTCCCTTGATGATGCCTGTTTCTGAGAAATAT AAAGATATGGGTACTGTGATCGTCGGCAAAATAGAATCTGGACACCTCCGTAAGGGTGATAGCCTCGTTCTCATG CCGAACAAGGATGTCGTTGAAGTAAGTGCGATCTACAATGAGATGGAAGAAGAAGTCGATCGCAGCTTATGCGGG GACAACGTCCGTATCCGTATTCGCGGCATAGACGATGAAGACATCAACCCCGGATTTGTGCTCACTAGCCCCTCG AAGCCTATTCGCGCCGTAAAGCAATTTGAAGCTCAGCTAGCAATCCTAGAACACAAAAATATCATTTGTGCTGGA TACTCTGCTGTATTACATGTGCACACCCTTTCGGAGGAGGTCGTGCTTTCTGGCCTCTTGCATTACTTTGACAAA GCCACGGGCCGCAAATCAAAAAGGCCGCCTCAATTCGCCAAGAAGGGTCAAAAGATTGTTGCTCTAATCGAGACA ACTGCTCCCATTTGCATAGAAAAATTCTCTGATTACCCACAGCTTGGCCGTTTCACTTTGCGGGATGAAGGGAGA ACGGTCGCAATTGGAAAAGTCACAAAACTGATCGAAAGCGGCACGATAGAGGAGACTACTAATGGCGTGGCGAAC TTGAATGTTAATGCGTAG |
| Transcript | >AgabiH97|073150 ATGAGCAAGCTCAGTGCCTCCGCCTTTGAATTCGTCCCCGGAAAAGGATTGGTCCAGACTCAGCCGTCACTGAGG GCTCCCATCGAGCGTCCAGAGCAGACGGAGGCCCCTCCTCCGCCTCCGACCATCTCCCTCAGCATAGGAGGGTCC AAACCCCCTCCCCCAGCACAAGCACCTCCTACCACTAACCCTCCTACAGCAACCCAAACGCCGCCTGCATCCACT CCCCAGACATCTAAACCTGCCACCCCCAAGCCTCAGACCACCATCAAGGTAGAACAGGCTGGCACATCATCTAAA ACTTTTACAACAGAAAAGGCAAAAACAGACGCCCTTACCGTCGCCCAGGACGTCAAGGATGCTGCAGATAGGGCC GTCTTGGAAGATCTTTATGGTGATGTCAAGGAACATCTGAATATTGTCTTCATCGGTCATGTTGATGCGGGAAAG AGTACCATGGGTGGTAACATTCTCTACCTGACAGGGATGGTAGATAAGCGTACTATGGAAAAATATGAAAAGGAA GCTAAAGAAGCTGGACGGGAGACATGGTACCTCAGTTGGGCTCTTGACTCCACTCCTCAGGAACGAAACAAGGGC AAAACAGTGGAGGTGGGCCGCGCATACTTTGAGACCGACACGAGGAGGTACACTATTCTCGACGCCCCCGGCCAT AAAACCTATGTTCCCAGCATGATATCCGGAGCCGCTCAGGCTGATGTCGCTATCCTCGTTGTCTCCGCCCGCAAA GGTGAATTCGAAACTGGTTTCGAGAAAGGTGGCCAGACTCGTGAACATATCATGCTGGTCAAGACTGCCGGCGTC TCAAAGGTCGTTATCGTAATTAACAAAATGGACGATCCCACCGTCCAGTGGGAAAAGGCGCGCTACGAGGAGATT AAGGAGAAAATGATACCATTTGCAAGGTCTGCTGGCTTCAGCCCCAAGACCGACGTCTGCTTCATGCCCGTCTCT GCCTACACGGGTGCAAATTTAAAAGATCCCGTTTCCGAGCAAGTTTGCTCATGGTGGGACGGACCATCTTTCCTT CAGCATCTTGATAAGATGCCCATGGTTGATCGCAAAATCCATGCTCCCTTGATGATGCCTGTTTCTGAGAAATAT AAAGATATGGGTACTGTGATCGTCGGCAAAATAGAATCTGGACACCTCCGTAAGGGTGATAGCCTCGTTCTCATG CCGAACAAGGATGTCGTTGAAGTAAGTGCGATCTACAATGAGATGGAAGAAGAAGTCGATCGCAGCTTATGCGGG GACAACGTCCGTATCCGTATTCGCGGCATAGACGATGAAGACATCAACCCCGGATTTGTGCTCACTAGCCCCTCG AAGCCTATTCGCGCCGTAAAGCAATTTGAAGCTCAGCTAGCAATCCTAGAACACAAAAATATCATTTGTGCTGGA TACTCTGCTGTATTACATGTGCACACCCTTTCGGAGGAGGTCGTGCTTTCTGGCCTCTTGCATTACTTTGACAAA GCCACGGGCCGCAAATCAAAAAGGCCGCCTCAATTCGCCAAGAAGGGTCAAAAGATTGTTGCTCTAATCGAGACA ACTGCTCCCATTTGCATAGAAAAATTCTCTGATTACCCACAGCTTGGCCGTTTCACTTTGCGGGATGAAGGGAGA ACGGTCGCAATTGGAAAAGTCACAAAACTGATCGAAAGCGGCACGATAGAGGAGACTACTAATGGCGTGGCGAAC TTGAATGTTAATGCGTAG |
| Gene | >AgabiH97|073150 ATGAGCAAGCTCAGTGCCTCCGCCTTTGAATTCGTCCCCGGAAAAGGATTGGTCCAGACTCAGCCGTCACTGAGG GCTCCCATCGAGCGTCCAGAGCAGACGGAGGCCCCTCCTCCGCCTCCGACCATCTCCCTCAGCATAGGAGGGTCC AAACCCCCTCCCCCAGCACAAGCACCTCCTACCACTAACCCTCCTACAGCAACCCAAACGCCGCCTGCATCCACT CCCCAGACATCTAAACCTGCCACCCCCAAGCCTCAGACCACCATCAAGGTAGAACAGGCTGGCACATCATCTAAA ACTTTTACAACAGAAAAGGCAAAAACAGACGCCCTTACCGTCGCCCAGGACGTCAAGGATGCTGCAGATAGGGCC GTCTTGGAAGATCTTTATGGTGATGGTGCGTCTGTCTCTCAGCTCCTACTTACCTGCAGTCTTACGCGCGCGGCA CAGTCAAGGAACATCTGAATATTGTCTTCATCGGTCATGTTGATGCGGGAAAGAGTACCATGGGTGGTAACATTC TCTACCTGACAGGGATGGTAGATAAGCGTACTATGGAAAAATATGAAAAGGAAGCTAAAGAAGCTGGACGGGAGA CATGGTACCTCAGTTGGGCTCTTGACTCCACTCCTCAGGAACGAAACAAGGGCAAAACAGTGGAGGTGGGCCGCG CATACTTTGAGACCGACACGAGGAGGTACACTATTCTCGACGCCCCCGGCCATAAAACCTATGTTCCCAGCATGA TATCCGGAGCCGCTCAGGCTGATGTCGCTATCCTCGTTGTCTCCGCCCGCAAAGGTGAATTCGAAACTGGTTTCG AGAAAGGTGGCCAGACTCGTGAACATATCATGCTGGTCAAGACTGCCGGCGTCTCAAAGGTCGTTATCGTAATTA ACAAAATGGACGATCCCACCGTCCAGTGGGAAAAGGCGCGCTACGAGGAGATTAAGGAGAAAATGATACCATTTG CAAGGTCTGCTGGCTTCAGCCCCAAGACCGACGTCTGCTTCATGCCCGTCTCTGCCTACACGGGTGCAAATTTAA AAGATCCCGTTTCCGAGCAAGTTTGCTCATGGTGGGAGTACGTGAACTTCACTTTCCTTTCGAATTCTGAGCTGA TTAAAACCCTTCTACAGCGGACCATCTTTCCTTCAGCATCTTGATAAGATGCCCATGGTTGATCGCAAAATCCAT GCTCCCTTGATGATGCCTGTTTCTGAGAAATATAAAGATATGGGTACTGTGATCGTCGGCAAAATAGAATCTGGA CACCTCCGTAAGGGTGATAGCCTCGTTCTCATGCCGAACAAGGATGTCGTTGAAGTAAGTGCGATCTACAATGAG ATGGAAGAAGAAGTCGATCGCAGCTTATGCGGGGACAACGTCCGTATCCGTATTCGCGGCATAGACGATGAAGAC ATCAACCCCGGATTTGTGCTCACTAGCCCCTCGAAGCCTATTCGCGCCGTAAAGCAATTTGAAGCTCAGCTAGCA ATCCTAGAACACAAAAATATCATTTGTGCTGGATACTCTGCTGTATTACATGTGCACACCCTTTCGGAGGAGGTC GTGCTTTCTGTACGTCAAATTGTATAACTTCGCCATCTCCAGCACTCATCTAACATCTTCAGGGCCTCTTGCATT ACTTTGACAAAGCCACGGGCCGCAAATCAAAAAGGCCGCCTCAATTCGCCAAGAAGGGTGAGCGCTTCATACATT TTCTCGTACTTCATATCACATATTAATCTAAAATCCAGGTCAAAAGATTGTTGCTCTAATCGAGACAACTGCTCC CATTTGCATAGAAAAATTCTCTGATTACCCACAGCTTGGCCGTTTCACTTTGCGGGATGAAGGTTGGTGAACTTC TTGAGAAGACATGATGGTTTGGTTTGAACACATTTGCAATTTAGGGAGAACGGTCGCAATTGGAAAAGTCACAAA ACTGATCGAAAGCGGCACGATAGAGGAGACTACTAATGGCGTGGCGAACTTGAATGTTAATGCGTAG |