Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|073010
Gene name
Locationscaffold_4:1842914..1846103
Strand-
Gene length (bp)3189
Transcript length (bp)2454
Coding sequence length (bp)2454
Protein length (aa) 818

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00183 HSP90 Hsp90 protein 7.8E-135 220 750
PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.4E-07 53 169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08110|ENPL_CHICK Endoplasmin OS=Gallus gallus GN=HSP90B1 PE=1 SV=1 28 741 8.0E-156
sp|Q95M18|ENPL_BOVIN Endoplasmin OS=Bos taurus GN=HSP90B1 PE=2 SV=1 28 741 8.0E-156
sp|P41148|ENPL_CANLF Endoplasmin OS=Canis lupus familiaris GN=HSP90B1 PE=1 SV=1 28 741 3.0E-155
sp|Q66HD0|ENPL_RAT Endoplasmin OS=Rattus norvegicus GN=Hsp90b1 PE=1 SV=2 28 741 2.0E-154
sp|P08113|ENPL_MOUSE Endoplasmin OS=Mus musculus GN=Hsp90b1 PE=1 SV=2 28 741 4.0E-154
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08110|ENPL_CHICK Endoplasmin OS=Gallus gallus GN=HSP90B1 PE=1 SV=1 28 741 8.0E-156
sp|Q95M18|ENPL_BOVIN Endoplasmin OS=Bos taurus GN=HSP90B1 PE=2 SV=1 28 741 8.0E-156
sp|P41148|ENPL_CANLF Endoplasmin OS=Canis lupus familiaris GN=HSP90B1 PE=1 SV=1 28 741 3.0E-155
sp|Q66HD0|ENPL_RAT Endoplasmin OS=Rattus norvegicus GN=Hsp90b1 PE=1 SV=2 28 741 2.0E-154
sp|P08113|ENPL_MOUSE Endoplasmin OS=Mus musculus GN=Hsp90b1 PE=1 SV=2 28 741 4.0E-154
sp|Q29092|ENPL_PIG Endoplasmin OS=Sus scrofa GN=HSP90B1 PE=2 SV=3 28 741 6.0E-154
sp|Q4R520|ENPL_MACFA Endoplasmin OS=Macaca fascicularis GN=HSP90B1 PE=2 SV=1 28 741 3.0E-153
sp|P14625|ENPL_HUMAN Endoplasmin OS=Homo sapiens GN=HSP90B1 PE=1 SV=1 28 741 4.0E-153
sp|Q5R6F7|ENPL_PONAB Endoplasmin OS=Pongo abelii GN=HSP90B1 PE=2 SV=1 28 741 4.0E-152
sp|O18750|ENPL_RABIT Endoplasmin (Fragment) OS=Oryctolagus cuniculus GN=HSP90B1 PE=2 SV=1 33 741 2.0E-148
sp|Q22235|ENPL1_CAEEL Endoplasmin homolog OS=Caenorhabditis elegans GN=enpl-1 PE=3 SV=1 28 745 3.0E-139
sp|Q9STX5|ENPL_ARATH Endoplasmin homolog OS=Arabidopsis thaliana GN=HSP90-7 PE=1 SV=1 28 742 1.0E-135
sp|Q9NKX1|ENPL_DICDI Endoplasmin homolog OS=Dictyostelium discoideum GN=grp94 PE=2 SV=2 28 727 6.0E-133
sp|P24724|HSP90_THEPA Heat shock protein 90 OS=Theileria parva GN=TP02_0244 PE=2 SV=2 31 771 1.0E-131
sp|Q9SIF2|HS905_ARATH Heat shock protein 90-5, chloroplastic OS=Arabidopsis thaliana GN=HSP90-5 PE=1 SV=1 14 740 3.0E-129
sp|P02828|HSP83_DROME Heat shock protein 83 OS=Drosophila melanogaster GN=Hsp83 PE=1 SV=1 31 746 5.0E-128
sp|P04809|HSP83_DROPS Heat shock protein 83 OS=Drosophila pseudoobscura pseudoobscura GN=Hsp83 PE=3 SV=2 31 746 7.0E-128
sp|O02192|HSP83_DROAV Heat shock protein 83 OS=Drosophila auraria GN=Hsp83 PE=3 SV=1 31 766 2.0E-127
sp|F4JFN3|HS906_ARATH Heat shock protein 90-6, mitochondrial OS=Arabidopsis thaliana GN=HSP90-6 PE=2 SV=1 25 746 3.0E-126
sp|Q08277|HSP82_MAIZE Heat shock protein 82 OS=Zea mays GN=HSP82 PE=3 SV=1 31 771 6.0E-126
sp|P02829|HSP82_YEAST ATP-dependent molecular chaperone HSP82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP82 PE=1 SV=1 30 765 1.0E-125
sp|O43109|HSP90_PODAS Heat shock protein 90 homolog OS=Podospora anserina GN=MOD-E PE=3 SV=1 30 742 1.0E-125
sp|P15108|HSC82_YEAST ATP-dependent molecular chaperone HSC82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSC82 PE=1 SV=4 30 765 2.0E-125
sp|P27323|HS901_ARATH Heat shock protein 90-1 OS=Arabidopsis thaliana GN=HSP90-1 PE=1 SV=3 31 749 1.0E-124
sp|Q4UDU8|HSP90_THEAN Heat shock protein 90 OS=Theileria annulata GN=TA12105 PE=3 SV=1 29 771 2.0E-124
sp|Q7PT10|HSP83_ANOGA Heat shock protein 83 OS=Anopheles gambiae GN=Hsp83 PE=3 SV=3 31 746 3.0E-124
sp|Q90474|H90A1_DANRE Heat shock protein HSP 90-alpha 1 OS=Danio rerio GN=hsp90a.1 PE=1 SV=3 31 765 8.0E-124
sp|Q25293|HSP83_LEIIN Heat shock protein 83-1 OS=Leishmania infantum GN=HSP83-1 PE=3 SV=2 31 741 2.0E-123
sp|P51819|HSP83_IPONI Heat shock protein 83 OS=Ipomoea nil GN=HSP83A PE=2 SV=1 31 771 2.0E-123
sp|P06660|HSP85_TRYCR Heat shock-like 85 kDa protein OS=Trypanosoma cruzi PE=3 SV=1 31 741 5.0E-123
sp|O57521|HS90B_DANRE Heat shock protein HSP 90-beta OS=Danio rerio GN=hsp90ab1 PE=1 SV=2 31 758 6.0E-123
sp|O03986|HS904_ARATH Heat shock protein 90-4 OS=Arabidopsis thaliana GN=HSP90-4 PE=1 SV=1 31 771 6.0E-122
sp|P30946|HS90A_RABIT Heat shock protein HSP 90-alpha OS=Oryctolagus cuniculus GN=HSP90AA1 PE=1 SV=2 31 758 6.0E-122
sp|Q04619|HS90B_CHICK Heat shock cognate protein HSP 90-beta OS=Gallus gallus GN=HSP90AB1 PE=2 SV=1 31 756 1.0E-121
sp|P36181|HSP80_SOLLC Heat shock cognate protein 80 OS=Solanum lycopersicum GN=HSC80 PE=2 SV=1 31 771 2.0E-120
sp|O44001|HSP90_EIMTE Heat shock protein 90 OS=Eimeria tenella GN=HSP90 PE=2 SV=1 31 758 4.0E-120
sp|P54651|HSC90_DICDI Heat shock cognate 90 kDa protein OS=Dictyostelium discoideum GN=hspD PE=1 SV=2 31 743 7.0E-120
sp|P41887|HSP90_SCHPO Heat shock protein 90 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swo1 PE=1 SV=2 31 742 4.0E-119
sp|Q76LV1|HS90B_BOVIN Heat shock protein HSP 90-beta OS=Bos taurus GN=HSP90AB1 PE=2 SV=3 31 756 1.0E-118
sp|P55737|HS902_ARATH Heat shock protein 90-2 OS=Arabidopsis thaliana GN=HSP90-2 PE=1 SV=1 31 771 1.0E-118
sp|P34058|HS90B_RAT Heat shock protein HSP 90-beta OS=Rattus norvegicus GN=Hsp90ab1 PE=1 SV=4 31 756 2.0E-118
sp|P11499|HS90B_MOUSE Heat shock protein HSP 90-beta OS=Mus musculus GN=Hsp90ab1 PE=1 SV=3 31 756 2.0E-118
sp|Q5R710|HS90B_PONAB Heat shock protein HSP 90-beta OS=Pongo abelii GN=HSP90AB1 PE=2 SV=1 31 756 6.0E-118
sp|P82995|HS90A_RAT Heat shock protein HSP 90-alpha OS=Rattus norvegicus GN=Hsp90aa1 PE=1 SV=3 31 758 6.0E-118
sp|P07901|HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus GN=Hsp90aa1 PE=1 SV=4 31 758 7.0E-118
sp|Q4R4T5|HS90B_MACFA Heat shock protein HSP 90-beta OS=Macaca fascicularis GN=Hsp90ab1 PE=2 SV=1 31 756 8.0E-118
sp|Q9GKX8|HS90B_HORSE Heat shock protein HSP 90-beta OS=Equus caballus GN=HSP90AB1 PE=2 SV=3 31 756 8.0E-118
sp|P08238|HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens GN=HSP90AB1 PE=1 SV=4 31 756 1.0E-117
sp|P51818|HS903_ARATH Heat shock protein 90-3 OS=Arabidopsis thaliana GN=HSP90-3 PE=1 SV=2 31 771 3.0E-117
sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens GN=HSP90AA1 PE=1 SV=5 31 758 9.0E-117
sp|Q4R4P1|HS90A_MACFA Heat shock protein HSP 90-alpha OS=Macaca fascicularis GN=HSP90AA1 PE=2 SV=3 31 758 3.0E-116
sp|Q9GKX7|HS90A_HORSE Heat shock protein HSP 90-alpha OS=Equus caballus GN=HSP90AA1 PE=2 SV=2 31 747 4.0E-116
sp|O02705|HS90A_PIG Heat shock protein HSP 90-alpha OS=Sus scrofa GN=HSP90AA1 PE=2 SV=3 31 747 5.0E-116
sp|P11501|HS90A_CHICK Heat shock protein HSP 90-alpha OS=Gallus gallus GN=HSP90AA1 PE=3 SV=3 31 758 5.0E-116
sp|Q76LV2|HS90A_BOVIN Heat shock protein HSP 90-alpha OS=Bos taurus GN=HSP90AA1 PE=1 SV=3 31 747 5.0E-116
sp|P46633|HS90A_CRIGR Heat shock protein HSP 90-alpha OS=Cricetulus griseus GN=HSP90AA1 PE=2 SV=2 31 758 4.0E-115
sp|A5A6K9|HS90A_PANTR Heat shock protein HSP 90-alpha OS=Pan troglodytes GN=HSP90AA1 PE=2 SV=1 31 758 6.0E-115
sp|P27741|HSP83_LEIAM Heat shock protein 83 OS=Leishmania amazonensis GN=HSP83 PE=3 SV=1 31 741 3.0E-114
sp|Q61W58|HSP90_CAEBR Heat shock protein 90 OS=Caenorhabditis briggsae GN=daf-21 PE=3 SV=1 31 743 4.0E-113
sp|Q18688|HSP90_CAEEL Heat shock protein 90 OS=Caenorhabditis elegans GN=daf-21 PE=1 SV=1 31 766 5.0E-112
sp|P40292|HSP90_ASPFU Heat shock protein 90 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hsp90 PE=1 SV=3 30 741 3.0E-111
sp|Q5QWR2|HTPG_IDILO Chaperone protein HtpG OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=htpG PE=3 SV=1 21 738 4.0E-111
sp|O61998|HSP90_BRUPA Heat shock protein 90 OS=Brugia pahangi GN=HSP90 PE=2 SV=2 31 762 1.0E-109
sp|Q8J2M3|HSP82_ASHGO Heat shock protein HSP82 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSP82 PE=3 SV=1 29 741 1.0E-109
sp|Q1CZI7|HTPG_MYXXD Chaperone protein HtpG OS=Myxococcus xanthus (strain DK 1622) GN=htpG PE=3 SV=1 19 735 4.0E-108
sp|P12861|HSP83_TRYBB Heat shock protein 83 OS=Trypanosoma brucei brucei GN=HSP83 PE=1 SV=1 31 741 4.0E-107
sp|P33125|HSP82_AJECA Heat shock protein 82 OS=Ajellomyces capsulatus GN=HSP82 PE=3 SV=1 30 761 4.0E-105
sp|A1S564|HTPG_SHEAM Chaperone protein HtpG OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=htpG PE=3 SV=1 29 740 2.0E-102
sp|Q21IX0|HTPG_SACD2 Chaperone protein HtpG OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=htpG PE=3 SV=1 31 735 7.0E-101
sp|A8H2R4|HTPG_SHEPA Chaperone protein HtpG OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=htpG PE=3 SV=1 29 735 1.0E-99
sp|A0KY03|HTPG_SHESA Chaperone protein HtpG OS=Shewanella sp. (strain ANA-3) GN=htpG PE=3 SV=1 29 735 1.0E-99
sp|Q0HU95|HTPG_SHESR Chaperone protein HtpG OS=Shewanella sp. (strain MR-7) GN=htpG PE=3 SV=1 29 735 2.0E-99
sp|Q0HHZ5|HTPG_SHESM Chaperone protein HtpG OS=Shewanella sp. (strain MR-4) GN=htpG PE=3 SV=1 29 735 2.0E-99
sp|Q8EFF7|HTPG_SHEON Chaperone protein HtpG OS=Shewanella oneidensis (strain MR-1) GN=htpG PE=3 SV=1 29 735 3.0E-99
sp|A4Y7T7|HTPG_SHEPC Chaperone protein HtpG OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=htpG PE=3 SV=1 29 735 8.0E-98
sp|Q5X5J7|HTPG_LEGPA Chaperone protein HtpG OS=Legionella pneumophila (strain Paris) GN=htpG PE=3 SV=1 31 735 1.0E-97
sp|Q084C6|HTPG_SHEFN Chaperone protein HtpG OS=Shewanella frigidimarina (strain NCIMB 400) GN=htpG PE=3 SV=1 29 680 3.0E-97
sp|A9L569|HTPG_SHEB9 Chaperone protein HtpG OS=Shewanella baltica (strain OS195) GN=htpG PE=3 SV=1 29 735 3.0E-97
sp|A6WPI2|HTPG_SHEB8 Chaperone protein HtpG OS=Shewanella baltica (strain OS185) GN=htpG PE=3 SV=1 29 735 3.0E-97
sp|A3D5M8|HTPG_SHEB5 Chaperone protein HtpG OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=htpG PE=3 SV=1 29 735 8.0E-97
sp|A3QF50|HTPG_SHELP Chaperone protein HtpG OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=htpG PE=3 SV=1 29 680 2.0E-96
sp|A1RIQ1|HTPG_SHESW Chaperone protein HtpG OS=Shewanella sp. (strain W3-18-1) GN=htpG PE=3 SV=1 29 735 2.0E-96
sp|Q88FB9|HTPG_PSEPK Chaperone protein HtpG OS=Pseudomonas putida (strain KT2440) GN=htpG PE=3 SV=1 31 735 2.0E-96
sp|A5IBL1|HTPG_LEGPC Chaperone protein HtpG OS=Legionella pneumophila (strain Corby) GN=htpG PE=3 SV=1 31 735 2.0E-96
sp|Q6FF82|HTPG_ACIAD Chaperone protein HtpG OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=htpG PE=3 SV=1 29 735 2.0E-96
sp|Q5ZVS1|HTPG_LEGPH Chaperone protein HtpG OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=htpG PE=3 SV=1 31 735 4.0E-96
sp|Q48K64|HTPG_PSE14 Chaperone protein HtpG OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=htpG PE=3 SV=1 31 735 4.0E-96
sp|Q1H2K2|HTPG_METFK Chaperone protein HtpG OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=htpG1 PE=3 SV=1 31 735 5.0E-96
sp|Q3IKQ2|HTPG_PSEHT Chaperone protein HtpG OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=htpG PE=3 SV=1 31 735 6.0E-96
sp|Q12FW8|HTPG_POLSJ Chaperone protein HtpG OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=htpG PE=3 SV=1 31 718 6.0E-96
sp|Q4ZUW2|HTPG_PSEU2 Chaperone protein HtpG OS=Pseudomonas syringae pv. syringae (strain B728a) GN=htpG PE=3 SV=2 31 735 1.0E-95
sp|Q5WWX9|HTPG_LEGPL Chaperone protein HtpG OS=Legionella pneumophila (strain Lens) GN=htpG PE=3 SV=1 31 735 2.0E-95
sp|B0TP05|HTPG_SHEHH Chaperone protein HtpG OS=Shewanella halifaxensis (strain HAW-EB4) GN=htpG PE=3 SV=1 29 735 2.0E-95
sp|C3K6N7|HTPG_PSEFS Chaperone protein HtpG OS=Pseudomonas fluorescens (strain SBW25) GN=htpG PE=3 SV=1 31 735 3.0E-95
sp|Q883Y9|HTPG_PSESM Chaperone protein HtpG OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=htpG PE=3 SV=1 31 735 1.0E-94
sp|A6VXW3|HTPG_MARMS Chaperone protein HtpG OS=Marinomonas sp. (strain MWYL1) GN=htpG PE=3 SV=1 21 735 1.0E-94
sp|P54649|HTPG_AGGAC Chaperone protein HtpG OS=Aggregatibacter actinomycetemcomitans GN=htpG PE=3 SV=1 31 735 1.0E-94
sp|Q3SJW8|HTPG_THIDA Chaperone protein HtpG OS=Thiobacillus denitrificans (strain ATCC 25259) GN=htpG PE=3 SV=1 31 735 2.0E-94
sp|Q12PB2|HTPG_SHEDO Chaperone protein HtpG OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=htpG PE=3 SV=1 29 735 7.0E-94
sp|Q47XA7|HTPG_COLP3 Chaperone protein HtpG OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=htpG PE=3 SV=1 29 651 8.0E-94
sp|B8F5X3|HTPG_HAEPS Chaperone protein HtpG OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=htpG PE=3 SV=1 31 735 1.0E-93
sp|A1VTA5|HTPG_POLNA Chaperone protein HtpG OS=Polaromonas naphthalenivorans (strain CJ2) GN=htpG PE=3 SV=1 31 735 2.0E-93
sp|Q2SKD0|HTPG_HAHCH Chaperone protein HtpG OS=Hahella chejuensis (strain KCTC 2396) GN=htpG PE=3 SV=1 31 735 3.0E-93
sp|Q31F72|HTPG_THICR Chaperone protein HtpG OS=Thiomicrospira crunogena (strain XCL-2) GN=htpG PE=3 SV=1 29 739 3.0E-93
sp|Q57S77|HTPG_SALCH Chaperone protein HtpG OS=Salmonella choleraesuis (strain SC-B67) GN=htpG PE=3 SV=2 31 735 8.0E-93
sp|Q5PFK7|HTPG_SALPA Chaperone protein HtpG OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=htpG PE=3 SV=2 31 735 2.0E-92
sp|P58480|HTPG_SALTY Chaperone protein HtpG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=htpG PE=3 SV=1 31 735 2.0E-92
sp|A6T5N6|HTPG_KLEP7 Chaperone protein HtpG OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=htpG PE=3 SV=1 31 735 2.0E-92
sp|Q5P1C5|HTPG_AROAE Chaperone protein HtpG OS=Aromatoleum aromaticum (strain EbN1) GN=htpG PE=3 SV=1 30 748 2.0E-92
sp|A9MW88|HTPG_SALPB Chaperone protein HtpG OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=htpG PE=3 SV=1 31 735 2.0E-92
sp|A4TFF4|HTPG_MYCGI Chaperone protein HtpG OS=Mycobacterium gilvum (strain PYR-GCK) GN=htpG PE=3 SV=1 24 740 3.0E-92
sp|Q1RF62|HTPG_ECOUT Chaperone protein HtpG OS=Escherichia coli (strain UTI89 / UPEC) GN=htpG PE=3 SV=1 31 735 4.0E-92
sp|A1A8D9|HTPG_ECOK1 Chaperone protein HtpG OS=Escherichia coli O1:K1 / APEC GN=htpG PE=3 SV=1 31 735 4.0E-92
sp|Q0VPG1|HTPG_ALCBS Chaperone protein HtpG OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=htpG PE=3 SV=1 24 718 4.0E-92
sp|Q3KFT8|HTPG_PSEPF Chaperone protein HtpG OS=Pseudomonas fluorescens (strain Pf0-1) GN=htpG PE=3 SV=1 31 735 5.0E-92
sp|Q3Z4S6|HTPG_SHISS Chaperone protein HtpG OS=Shigella sonnei (strain Ss046) GN=htpG PE=3 SV=1 31 735 6.0E-92
sp|Q325C3|HTPG_SHIBS Chaperone protein HtpG OS=Shigella boydii serotype 4 (strain Sb227) GN=htpG PE=3 SV=1 31 735 6.0E-92
sp|P0A6Z3|HTPG_ECOLI Chaperone protein HtpG OS=Escherichia coli (strain K12) GN=htpG PE=1 SV=1 31 735 6.0E-92
sp|B1IZC1|HTPG_ECOLC Chaperone protein HtpG OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=htpG PE=3 SV=1 31 735 6.0E-92
sp|P0A6Z4|HTPG_ECOL6 Chaperone protein HtpG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=htpG PE=3 SV=1 31 735 6.0E-92
sp|Q0TKG8|HTPG_ECOL5 Chaperone protein HtpG OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=htpG PE=3 SV=1 31 735 6.0E-92
sp|A7ZXD1|HTPG_ECOHS Chaperone protein HtpG OS=Escherichia coli O9:H4 (strain HS) GN=htpG PE=3 SV=1 31 735 6.0E-92
sp|P0A6Z5|HTPG_ECO57 Chaperone protein HtpG OS=Escherichia coli O157:H7 GN=htpG PE=3 SV=1 31 735 6.0E-92
sp|A0KL53|HTPG_AERHH Chaperone protein HtpG OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=htpG PE=3 SV=1 29 738 6.0E-92
sp|P58479|HTPG_SALTI Chaperone protein HtpG OS=Salmonella typhi GN=htpG PE=3 SV=1 31 735 7.0E-92
sp|Q1QUL4|HTPG_CHRSD Chaperone protein HtpG OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=htpG PE=3 SV=1 31 735 8.0E-92
sp|A1W3A1|HTPG_ACISJ Chaperone protein HtpG OS=Acidovorax sp. (strain JS42) GN=htpG PE=3 SV=1 26 718 9.0E-92
sp|A1T639|HTPG_MYCVP Chaperone protein HtpG OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=htpG PE=3 SV=1 30 740 1.0E-91
sp|A7ZIN3|HTPG_ECO24 Chaperone protein HtpG OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=htpG PE=3 SV=1 31 735 1.0E-91
sp|A1STI2|HTPG_PSYIN Chaperone protein HtpG OS=Psychromonas ingrahamii (strain 37) GN=htpG PE=3 SV=1 29 651 2.0E-91
sp|Q2KYY2|HTPG_BORA1 Chaperone protein HtpG OS=Bordetella avium (strain 197N) GN=htpG PE=3 SV=1 31 687 2.0E-91
sp|Q8Y0Q3|HTPG_RALSO Chaperone protein HtpG OS=Ralstonia solanacearum (strain GMI1000) GN=htpG PE=3 SV=1 24 735 3.0E-91
sp|Q2VZ28|HTPG_MAGSA Chaperone protein HtpG OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=htpG PE=3 SV=2 28 685 3.0E-91
sp|B0U0M7|HTPG_FRAP2 Chaperone protein HtpG OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=htpG PE=3 SV=1 28 715 4.0E-91
sp|Q142T5|HTPG_BURXL Chaperone protein HtpG OS=Burkholderia xenovorans (strain LB400) GN=htpG PE=3 SV=1 31 680 4.0E-91
sp|A7MJW4|HTPG_CROS8 Chaperone protein HtpG OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=htpG PE=3 SV=1 31 735 5.0E-91
sp|Q83SE6|HTPG_SHIFL Chaperone protein HtpG OS=Shigella flexneri GN=htpG PE=3 SV=1 31 735 7.0E-91
sp|Q6D7Z6|HTPG_PECAS Chaperone protein HtpG OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=htpG PE=3 SV=2 31 735 8.0E-91
sp|Q30R39|HTPG_SULDN Chaperone protein HtpG OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=htpG PE=3 SV=1 28 739 8.0E-91
sp|Q32J53|HTPG_SHIDS Chaperone protein HtpG OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=htpG PE=3 SV=1 31 735 8.0E-91
sp|Q7MMR7|HTPG_VIBVY Chaperone protein HtpG OS=Vibrio vulnificus (strain YJ016) GN=htpG PE=3 SV=2 31 738 1.0E-90
sp|A2SKM5|HTPG_METPP Chaperone protein HtpG OS=Methylibium petroleiphilum (strain PM1) GN=htpG PE=3 SV=1 31 735 1.0E-90
sp|A8F2Y0|HTPG_RICM5 Chaperone protein HtpG OS=Rickettsia massiliae (strain Mtu5) GN=htpG PE=3 SV=1 28 739 2.0E-90
sp|A8GTZ5|HTPG_RICRS Chaperone protein HtpG OS=Rickettsia rickettsii (strain Sheila Smith) GN=htpG PE=3 SV=1 28 739 2.0E-90
sp|B0BVI6|HTPG_RICRO Chaperone protein HtpG OS=Rickettsia rickettsii (strain Iowa) GN=htpG PE=3 SV=1 28 739 2.0E-90
sp|A8M4S6|HTPG_SALAI Chaperone protein HtpG OS=Salinispora arenicola (strain CNS-205) GN=htpG PE=3 SV=1 30 739 2.0E-90
sp|Q4KFX8|HTPG_PSEF5 Chaperone protein HtpG OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=htpG PE=3 SV=1 31 735 2.0E-90
sp|A0Q4L0|HTPG_FRATN Chaperone protein HtpG OS=Francisella tularensis subsp. novicida (strain U112) GN=htpG PE=3 SV=1 28 715 2.0E-90
sp|Q7N0P4|HTPG_PHOLL Chaperone protein HtpG OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=htpG PE=3 SV=1 31 735 2.0E-90
sp|A8AJX0|HTPG_CITK8 Chaperone protein HtpG OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=htpG PE=3 SV=1 31 735 2.0E-90
sp|A4SLY0|HTPG_AERS4 Chaperone protein HtpG OS=Aeromonas salmonicida (strain A449) GN=htpG PE=3 SV=1 29 738 3.0E-90
sp|B6EHJ9|HTPG_ALISL Chaperone protein HtpG OS=Aliivibrio salmonicida (strain LFI1238) GN=htpG PE=3 SV=1 31 693 3.0E-90
sp|A1JNB3|HTPG_YERE8 Chaperone protein HtpG OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=htpG PE=3 SV=1 31 735 3.0E-90
sp|P9WMJ7|HTPG_MYCTU Chaperone protein HtpG OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=htpG PE=1 SV=1 30 718 4.0E-90
sp|P9WMJ6|HTPG_MYCTO Chaperone protein HtpG OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=htpG PE=3 SV=1 30 718 4.0E-90
sp|A5U4Y2|HTPG_MYCTA Chaperone protein HtpG OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=htpG PE=3 SV=1 30 718 4.0E-90
sp|A1KKZ1|HTPG_MYCBP Chaperone protein HtpG OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=htpG PE=3 SV=1 30 718 4.0E-90
sp|P64412|HTPG_MYCBO Chaperone protein HtpG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=htpG PE=3 SV=1 30 718 4.0E-90
sp|A0QEJ0|HTPG_MYCA1 Chaperone protein HtpG OS=Mycobacterium avium (strain 104) GN=htpG PE=3 SV=1 30 718 4.0E-90
sp|A4IZQ6|HTPG_FRATW Chaperone protein HtpG OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=htpG PE=3 SV=1 28 715 7.0E-90
sp|O33012|HTPG_MYCLE Chaperone protein HtpG OS=Mycobacterium leprae (strain TN) GN=htpG PE=3 SV=1 30 739 1.0E-89
sp|A8FX83|HTPG_SHESH Chaperone protein HtpG OS=Shewanella sediminis (strain HAW-EB3) GN=htpG PE=3 SV=1 29 680 1.0E-89
sp|Q8DFM0|HTPG_VIBVU Chaperone protein HtpG OS=Vibrio vulnificus (strain CMCP6) GN=htpG PE=3 SV=1 31 738 1.0E-89
sp|Q9I3C5|HTPG_PSEAE Chaperone protein HtpG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=htpG PE=3 SV=1 31 735 1.0E-89
sp|Q1LTX6|HTPG_BAUCH Chaperone protein HtpG OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=htpG PE=3 SV=1 31 737 1.0E-89
sp|A8GWJ4|HTPG_RICB8 Chaperone protein HtpG OS=Rickettsia bellii (strain OSU 85-389) GN=htpG PE=3 SV=1 28 739 2.0E-89
sp|P58478|HTPG_RICCN Chaperone protein HtpG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=htpG PE=3 SV=1 28 739 2.0E-89
sp|Q5NHT8|HTPG_FRATT Chaperone protein HtpG OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=htpG PE=3 SV=1 28 715 3.0E-89
sp|Q14J90|HTPG_FRAT1 Chaperone protein HtpG OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=htpG PE=3 SV=1 28 715 3.0E-89
sp|P58482|HTPG_YERPE Chaperone protein HtpG OS=Yersinia pestis GN=htpG PE=3 SV=1 31 735 3.0E-89
sp|Q66DP8|HTPG_YERPS Chaperone protein HtpG OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=htpG PE=3 SV=1 31 735 3.0E-89
sp|A4TPA5|HTPG_YERPP Chaperone protein HtpG OS=Yersinia pestis (strain Pestoides F) GN=htpG PE=3 SV=1 31 735 3.0E-89
sp|Q1CL28|HTPG_YERPN Chaperone protein HtpG OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=htpG PE=3 SV=1 31 735 3.0E-89
sp|Q1C4P8|HTPG_YERPA Chaperone protein HtpG OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=htpG PE=3 SV=1 31 735 3.0E-89
sp|B5EQZ5|HTPG_ACIF5 Chaperone protein HtpG OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=htpG PE=3 SV=1 24 735 4.0E-89
sp|B7JAR2|HTPG_ACIF2 Chaperone protein HtpG OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=htpG PE=3 SV=1 24 735 4.0E-89
sp|Q0I2A3|HTPG_HAES1 Chaperone protein HtpG OS=Haemophilus somnus (strain 129Pt) GN=htpG PE=3 SV=1 31 735 6.0E-89
sp|Q1RIV1|HTPG_RICBR Chaperone protein HtpG OS=Rickettsia bellii (strain RML369-C) GN=htpG PE=3 SV=1 28 739 6.0E-89
sp|A4XV81|HTPG_PSEMY Chaperone protein HtpG OS=Pseudomonas mendocina (strain ymp) GN=htpG PE=3 SV=1 31 735 9.0E-89
sp|B3R5J8|HTPG_CUPTR Chaperone protein HtpG OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=htpG PE=3 SV=1 24 735 1.0E-88
sp|C3LTN3|HTPG_VIBCM Chaperone protein HtpG OS=Vibrio cholerae serotype O1 (strain M66-2) GN=htpG PE=3 SV=1 31 735 1.0E-88
sp|P22359|HTPG_VIBCH Chaperone protein HtpG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=htpG PE=2 SV=2 31 735 1.0E-88
sp|A5F2T9|HTPG_VIBC3 Chaperone protein HtpG OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=htpG PE=3 SV=1 31 735 1.0E-88
sp|Q7WQ31|HTPG_BORBR Chaperone protein HtpG OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=htpG PE=3 SV=1 31 686 1.0E-88
sp|Q7NYF6|HTPG_CHRVO Chaperone protein HtpG OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=htpG PE=3 SV=2 31 735 1.0E-88
sp|P61186|HTPG_MYCPA Chaperone protein HtpG OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=htpG PE=3 SV=1 30 718 1.0E-88
sp|Q15RT6|HTPG_PSEA6 Chaperone protein HtpG OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=htpG PE=3 SV=1 21 735 2.0E-88
sp|Q1Q978|HTPG_PSYCK Chaperone protein HtpG OS=Psychrobacter cryohalolentis (strain K5) GN=htpG PE=3 SV=1 28 737 2.0E-88
sp|Q7W0M8|HTPG_BORPE Chaperone protein HtpG OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=htpG PE=3 SV=1 31 686 2.0E-88
sp|Q47GZ8|HTPG_DECAR Chaperone protein HtpG OS=Dechloromonas aromatica (strain RCB) GN=htpG PE=3 SV=1 20 735 2.0E-88
sp|Q2A5E0|HTPG_FRATH Chaperone protein HtpG OS=Francisella tularensis subsp. holarctica (strain LVS) GN=htpG PE=3 SV=1 28 715 2.0E-88
sp|A7N9V7|HTPG_FRATF Chaperone protein HtpG OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=htpG PE=3 SV=1 28 715 2.0E-88
sp|A6VML2|HTPG_ACTSZ Chaperone protein HtpG OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=htpG PE=3 SV=1 31 651 3.0E-88
sp|A4W7F7|HTPG_ENT38 Chaperone protein HtpG OS=Enterobacter sp. (strain 638) GN=htpG PE=3 SV=1 31 735 3.0E-88
sp|A5CWV5|HTPG_VESOH Chaperone protein HtpG OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=htpG PE=3 SV=1 26 735 3.0E-88
sp|A8GAV2|HTPG_SERP5 Chaperone protein HtpG OS=Serratia proteamaculans (strain 568) GN=htpG PE=3 SV=1 31 678 3.0E-88
sp|B0USJ0|HTPG_HISS2 Chaperone protein HtpG OS=Histophilus somni (strain 2336) GN=htpG PE=3 SV=1 31 735 3.0E-88
sp|Q21SJ8|HTPG_RHOFT Chaperone protein HtpG OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=htpG PE=3 SV=1 31 735 4.0E-88
sp|Q65RV7|HTPG_MANSM Chaperone protein HtpG OS=Mannheimia succiniciproducens (strain MBEL55E) GN=htpG PE=3 SV=1 31 651 5.0E-88
sp|Q0A738|HTPG_ALKEH Chaperone protein HtpG OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=htpG PE=3 SV=1 21 735 7.0E-88
sp|Q68Y08|HTPG_RICTY Chaperone protein HtpG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=htpG PE=3 SV=1 28 739 1.0E-87
sp|A1AWE2|HTPG_RUTMC Chaperone protein HtpG OS=Ruthia magnifica subsp. Calyptogena magnifica GN=htpG PE=3 SV=1 24 735 2.0E-87
sp|Q7WC32|HTPG_BORPA Chaperone protein HtpG OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=htpG PE=3 SV=1 31 686 2.0E-87
sp|Q4QP81|HTPG_HAEI8 Chaperone protein HtpG OS=Haemophilus influenzae (strain 86-028NP) GN=htpG PE=3 SV=2 31 735 3.0E-87
sp|A5GER7|HTPG_GEOUR Chaperone protein HtpG OS=Geobacter uraniireducens (strain Rf4) GN=htpG PE=3 SV=1 31 723 5.0E-87
sp|A5UB42|HTPG_HAEIE Chaperone protein HtpG OS=Haemophilus influenzae (strain PittEE) GN=htpG PE=3 SV=1 31 735 5.0E-87
sp|Q87EN0|HTPG_XYLFT Chaperone protein HtpG OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=htpG PE=3 SV=1 23 735 5.0E-87
sp|Q46YS9|HTPG_CUPPJ Chaperone protein HtpG OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=htpG PE=3 SV=1 24 735 6.0E-87
sp|Q4UJV5|HTPG_RICFE Chaperone protein HtpG OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=htpG PE=3 SV=1 28 739 7.0E-87
sp|A5UFQ9|HTPG_HAEIG Chaperone protein HtpG OS=Haemophilus influenzae (strain PittGG) GN=htpG PE=3 SV=1 31 735 7.0E-87
sp|Q9CM20|HTPG_PASMU Chaperone protein HtpG OS=Pasteurella multocida (strain Pm70) GN=htpG PE=3 SV=1 31 737 7.0E-87
sp|A1ANS1|HTPG_PELPD Chaperone protein HtpG OS=Pelobacter propionicus (strain DSM 2379) GN=htpG PE=3 SV=1 26 718 8.0E-87
sp|Q5GZV7|HTPG_XANOR Chaperone protein HtpG OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=htpG PE=3 SV=2 23 735 8.0E-87
sp|Q2P2U8|HTPG_XANOM Chaperone protein HtpG OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=htpG PE=3 SV=1 23 735 8.0E-87
sp|P44516|HTPG_HAEIN Chaperone protein HtpG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=htpG PE=3 SV=2 31 735 1.0E-86
sp|Q2JGG1|HTPG_FRASC Chaperone protein HtpG OS=Frankia sp. (strain CcI3) GN=htpG PE=3 SV=1 30 727 1.0E-86
sp|Q0S467|HTPG_RHOJR Chaperone protein HtpG OS=Rhodococcus jostii (strain RHA1) GN=htpG PE=3 SV=1 30 739 1.0E-86
sp|Q8P855|HTPG_XANCP Chaperone protein HtpG OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=htpG PE=3 SV=1 23 735 2.0E-86
sp|A1WXE4|HTPG_HALHL Chaperone protein HtpG OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=htpG PE=3 SV=1 30 680 2.0E-86
sp|Q4FQZ1|HTPG_PSYA2 Chaperone protein HtpG OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=htpG PE=3 SV=1 28 737 3.0E-86
sp|Q3BS21|HTPG_XANC5 Chaperone protein HtpG OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=htpG PE=3 SV=1 31 735 3.0E-86
sp|Q4UVY7|HTPG_XANC8 Chaperone protein HtpG OS=Xanthomonas campestris pv. campestris (strain 8004) GN=htpG PE=3 SV=1 23 735 4.0E-86
sp|Q1LKE3|HTPG_CUPMC Chaperone protein HtpG OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=htpG PE=3 SV=1 24 735 5.0E-86
sp|Q2RYB8|HTPG_RHORT Chaperone protein HtpG OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=htpG PE=3 SV=1 31 739 6.0E-86
sp|Q9ZCB9|HTPG_RICPR Chaperone protein HtpG OS=Rickettsia prowazekii (strain Madrid E) GN=htpG PE=3 SV=1 28 739 7.0E-86
sp|A6V7J7|HTPG_PSEA7 Chaperone protein HtpG OS=Pseudomonas aeruginosa (strain PA7) GN=htpG PE=3 SV=1 31 735 9.0E-86
sp|Q6LTE2|HTPG_PHOPR Chaperone protein HtpG OS=Photobacterium profundum GN=htpG PE=3 SV=1 31 693 1.0E-85
sp|A4X7S0|HTPG_SALTO Chaperone protein HtpG OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=htpG PE=3 SV=1 30 739 3.0E-85
sp|Q0K8D7|HTPG_CUPNH Chaperone protein HtpG OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=htpG PE=3 SV=1 24 735 3.0E-85
sp|Q9PEQ0|HTPG_XYLFA Chaperone protein HtpG OS=Xylella fastidiosa (strain 9a5c) GN=htpG PE=3 SV=1 23 735 3.0E-85
sp|Q87RH5|HTPG_VIBPA Chaperone protein HtpG OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=htpG PE=3 SV=1 31 737 4.0E-85
sp|B0BPS7|HTPG_ACTPJ Chaperone protein HtpG OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=htpG PE=3 SV=1 31 735 6.0E-85
sp|Q2NV58|HTPG_SODGM Chaperone protein HtpG OS=Sodalis glossinidius (strain morsitans) GN=htpG PE=3 SV=2 31 735 7.0E-85
sp|Q5E6Q9|HTPG_VIBF1 Chaperone protein HtpG OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=htpG PE=3 SV=1 19 576 7.0E-85
sp|A0PRT4|HTPG_MYCUA Chaperone protein HtpG OS=Mycobacterium ulcerans (strain Agy99) GN=htpG PE=3 SV=1 30 718 8.0E-85
sp|Q5FS51|HTPG_GLUOX Chaperone protein HtpG OS=Gluconobacter oxydans (strain 621H) GN=htpG PE=3 SV=1 28 727 9.0E-85
sp|Q3JAF6|HTPG_NITOC Chaperone protein HtpG OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=htpG PE=3 SV=1 31 735 1.0E-84
sp|B3GXX7|HTPG_ACTP7 Chaperone protein HtpG OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=htpG PE=3 SV=1 31 735 2.0E-84
sp|Q8PJK3|HTPG_XANAC Chaperone protein HtpG OS=Xanthomonas axonopodis pv. citri (strain 306) GN=htpG PE=3 SV=1 31 735 2.0E-84
sp|A1WF62|HTPG_VEREI Chaperone protein HtpG OS=Verminephrobacter eiseniae (strain EF01-2) GN=htpG PE=3 SV=1 31 735 3.0E-84
sp|A8GQ51|HTPG_RICAH Chaperone protein HtpG OS=Rickettsia akari (strain Hartford) GN=htpG PE=3 SV=1 28 739 3.0E-84
sp|Q39E36|HTPG_BURL3 Chaperone protein HtpG OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=htpG PE=3 SV=1 31 680 4.0E-84
sp|P61185|HTPG_GEOSL Chaperone protein HtpG OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=htpG PE=3 SV=1 31 678 6.0E-84
sp|Q63W07|HTPG_BURPS Chaperone protein HtpG OS=Burkholderia pseudomallei (strain K96243) GN=htpG PE=3 SV=1 31 680 9.0E-84
sp|Q3JUM5|HTPG_BURP1 Chaperone protein HtpG OS=Burkholderia pseudomallei (strain 1710b) GN=htpG PE=3 SV=1 31 680 9.0E-84
sp|A1V292|HTPG_BURMS Chaperone protein HtpG OS=Burkholderia mallei (strain SAVP1) GN=htpG PE=3 SV=1 31 680 9.0E-84
sp|Q62ID1|HTPG_BURMA Chaperone protein HtpG OS=Burkholderia mallei (strain ATCC 23344) GN=htpG PE=3 SV=1 31 680 9.0E-84
sp|A2S4I0|HTPG_BURM9 Chaperone protein HtpG OS=Burkholderia mallei (strain NCTC 10229) GN=htpG PE=3 SV=1 31 680 9.0E-84
sp|A3MHX8|HTPG_BURM7 Chaperone protein HtpG OS=Burkholderia mallei (strain NCTC 10247) GN=htpG PE=3 SV=1 31 680 9.0E-84
sp|Q07GW8|HTPG_RHOP5 Chaperone protein HtpG OS=Rhodopseudomonas palustris (strain BisA53) GN=htpG PE=3 SV=1 31 739 1.0E-83
sp|A3N786|HTPG_BURP6 Chaperone protein HtpG OS=Burkholderia pseudomallei (strain 668) GN=htpG PE=3 SV=1 31 680 2.0E-83
sp|A3N0Z5|HTPG_ACTP2 Chaperone protein HtpG OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=htpG PE=3 SV=1 31 735 2.0E-83
sp|Q5Z3N4|HTPG_NOCFA Chaperone protein HtpG OS=Nocardia farcinica (strain IFM 10152) GN=htpG PE=3 SV=1 30 739 2.0E-83
sp|A3NSX5|HTPG_BURP0 Chaperone protein HtpG OS=Burkholderia pseudomallei (strain 1106a) GN=htpG PE=3 SV=1 31 680 2.0E-83
sp|Q0SMU9|HTPG_BORAP Chaperone protein HtpG OS=Borrelia afzelii (strain PKo) GN=htpG PE=3 SV=1 27 739 2.0E-83
sp|A9NB44|HTPG_COXBR Chaperone protein HtpG OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=htpG PE=3 SV=1 31 735 4.0E-83
sp|Q83EL0|HTPG_COXBU Chaperone protein HtpG OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=htpG PE=1 SV=1 31 735 7.0E-83
sp|A7N178|HTPG_VIBCB Chaperone protein HtpG OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=htpG PE=3 SV=1 31 576 7.0E-83
sp|A9KGQ8|HTPG_COXBN Chaperone protein HtpG OS=Coxiella burnetii (strain Dugway 5J108-111) GN=htpG PE=3 SV=1 31 735 8.0E-83
sp|Q0AHI5|HTPG_NITEC Chaperone protein HtpG OS=Nitrosomonas eutropha (strain C91) GN=htpG PE=3 SV=1 24 735 1.0E-82
sp|P58481|HTPG_STRCO Chaperone protein HtpG OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=htpG PE=3 SV=1 30 713 2.0E-82
sp|Q60AK3|HTPG_METCA Chaperone protein HtpG OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=htpG PE=3 SV=1 26 739 2.0E-82
sp|A0K9C0|HTPG_BURCH Chaperone protein HtpG OS=Burkholderia cenocepacia (strain HI2424) GN=htpG PE=3 SV=1 31 680 3.0E-82
sp|Q1BUR7|HTPG_BURCA Chaperone protein HtpG OS=Burkholderia cenocepacia (strain AU 1054) GN=htpG PE=3 SV=1 31 680 3.0E-82
sp|O83949|HTPG_TREPA Chaperone protein HtpG OS=Treponema pallidum (strain Nichols) GN=htpG PE=3 SV=1 28 738 3.0E-82
sp|Q660W4|HTPG_BORBP Chaperone protein HtpG OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=htpG PE=3 SV=1 27 739 4.0E-82
sp|Q2SZZ0|HTPG_BURTA Chaperone protein HtpG OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=htpG PE=3 SV=1 31 680 5.0E-82
sp|Q7M8C4|HTPG_WOLSU Chaperone protein HtpG OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=htpG PE=3 SV=1 27 739 2.0E-81
sp|B7VII6|HTPG_VIBTL Chaperone protein HtpG OS=Vibrio tasmaniensis (strain LGP32) GN=htpG PE=3 SV=1 31 576 3.0E-81
sp|Q0BD34|HTPG_BURCM Chaperone protein HtpG OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=htpG PE=3 SV=1 31 680 3.0E-81
sp|P61184|HTPG_BDEBA Chaperone protein HtpG OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=htpG PE=3 SV=1 29 738 4.0E-81
sp|A0L8B0|HTPG_MAGMM Chaperone protein HtpG OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=htpG PE=3 SV=1 30 735 8.0E-81
sp|Q39SQ3|HTPG_GEOMG Chaperone protein HtpG OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=htpG PE=3 SV=1 26 702 5.0E-80
sp|Q89A93|HTPG_BUCBP Chaperone protein HtpG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=htpG PE=3 SV=1 19 735 6.0E-80
sp|Q20WN5|HTPG_RHOPB Chaperone protein HtpG OS=Rhodopseudomonas palustris (strain BisB18) GN=htpG PE=3 SV=1 31 676 1.0E-79
sp|Q8D228|HTPG_WIGBR Chaperone protein HtpG OS=Wigglesworthia glossinidia brevipalpis GN=htpG PE=3 SV=1 30 735 2.0E-79
sp|P61188|HTPG_TREDE Chaperone protein HtpG OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=htpG PE=3 SV=1 28 735 2.0E-79
sp|Q3SNS6|HTPG_NITWN Chaperone protein HtpG OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=htpG PE=3 SV=1 31 748 2.0E-79
sp|P42555|HTPG_BORBU Chaperone protein HtpG OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=htpG PE=3 SV=2 27 737 2.0E-79
sp|Q2IQY5|HTPG_RHOP2 Chaperone protein HtpG OS=Rhodopseudomonas palustris (strain HaA2) GN=htpG PE=3 SV=1 31 680 4.0E-79
sp|Q82TV8|HTPG_NITEU Chaperone protein HtpG OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=htpG PE=3 SV=1 22 735 6.0E-79
sp|P61187|HTPG_RHOPA Chaperone protein HtpG OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=htpG PE=3 SV=1 31 680 8.0E-79
sp|P57555|HTPG_BUCAI Chaperone protein HtpG OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=htpG PE=3 SV=1 29 735 2.0E-78
sp|Q313E8|HTPG_DESAG Chaperone protein HtpG OS=Desulfovibrio alaskensis (strain G20) GN=htpG PE=3 SV=1 28 714 2.0E-78
sp|Q1CUU4|HTPG_HELPH Chaperone protein HtpG OS=Helicobacter pylori (strain HPAG1) GN=htpG PE=3 SV=1 29 739 9.0E-78
sp|Q2YA09|HTPG_NITMU Chaperone protein HtpG OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=htpG PE=3 SV=1 24 735 2.0E-77
sp|Q728G0|HTPG_DESVH Chaperone protein HtpG OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=htpG PE=3 SV=1 29 714 2.0E-77
sp|P56116|HTPG_HELPY Chaperone protein HtpG OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=htpG PE=3 SV=1 29 739 4.0E-77
sp|Q89CK8|HTPG_BRADU Chaperone protein HtpG OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=htpG PE=3 SV=1 31 740 1.0E-76
sp|Q5WJE6|HTPG_BACSK Chaperone protein HtpG OS=Bacillus clausii (strain KSM-K16) GN=htpG PE=3 SV=1 28 712 2.0E-76
sp|Q8K981|HTPG_BUCAP Chaperone protein HtpG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=htpG PE=3 SV=1 29 735 4.0E-76
sp|A7I226|HTPG_CAMHC Chaperone protein HtpG OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=htpG PE=3 SV=1 28 739 6.0E-76
sp|Q1QHD7|HTPG_NITHX Chaperone protein HtpG OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=htpG PE=3 SV=1 31 739 7.0E-76
sp|A8EV23|HTPG_ARCB4 Chaperone protein HtpG OS=Arcobacter butzleri (strain RM4018) GN=htpG PE=3 SV=1 28 739 1.0E-75
sp|B0UN89|HTPG_METS4 Chaperone protein HtpG OS=Methylobacterium sp. (strain 4-46) GN=htpG PE=3 SV=1 28 718 3.0E-75
sp|Q17VU7|HTPG_HELAH Chaperone protein HtpG OS=Helicobacter acinonychis (strain Sheeba) GN=htpG PE=3 SV=1 29 739 5.0E-75
sp|B1LZG0|HTPG_METRJ Chaperone protein HtpG OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=htpG PE=3 SV=1 28 718 5.0E-75
sp|Q9ZMM2|HTPG_HELPJ Chaperone protein HtpG OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=htpG PE=3 SV=1 29 739 6.0E-75
sp|A5CCZ2|HTPG_ORITB Chaperone protein HtpG OS=Orientia tsutsugamushi (strain Boryong) GN=htpG PE=3 SV=1 29 740 2.0E-73
sp|B1Z9Y8|HTPG_METPB Chaperone protein HtpG OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=htpG PE=3 SV=1 28 718 6.0E-73
sp|Q12ZX1|HTPG_RHOPS Chaperone protein HtpG OS=Rhodopseudomonas palustris (strain BisB5) GN=htpG PE=3 SV=1 31 677 7.0E-73
sp|A6QBI2|HTPG_SULNB Chaperone protein HtpG OS=Sulfurovum sp. (strain NBC37-1) GN=htpG PE=3 SV=1 28 739 8.0E-73
sp|Q98JB6|HTPG_RHILO Chaperone protein HtpG OS=Rhizobium loti (strain MAFF303099) GN=htpG PE=3 SV=1 31 739 3.0E-71
sp|Q9PHZ3|HTPG_CAMJE Chaperone protein HtpG OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=htpG PE=3 SV=1 31 739 7.0E-71
sp|A7H4M0|HTPG_CAMJD Chaperone protein HtpG OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=htpG PE=3 SV=1 31 739 3.0E-70
sp|P08712|ENPL_MESAU Endoplasmin (Fragment) OS=Mesocricetus auratus GN=HSP90B1 PE=1 SV=1 381 741 4.0E-70
sp|P58477|HTPG_RHIME Chaperone protein HtpG OS=Rhizobium meliloti (strain 1021) GN=htpG PE=3 SV=1 28 739 4.0E-70
sp|Q24VT7|HTPG_DESHY Chaperone protein HtpG OS=Desulfitobacterium hafniense (strain Y51) GN=htpG PE=3 SV=1 30 692 4.0E-70
sp|A1VYN0|HTPG_CAMJJ Chaperone protein HtpG OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=htpG PE=3 SV=1 31 739 8.0E-70
sp|Q5HVP5|HTPG_CAMJR Chaperone protein HtpG OS=Campylobacter jejuni (strain RM1221) GN=htpG PE=3 SV=1 31 739 1.0E-69
sp|A8FKU4|HTPG_CAMJ8 Chaperone protein HtpG OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=htpG PE=3 SV=1 31 739 2.0E-69
sp|Q5GTE5|HTPG_WOLTR Chaperone protein HtpG OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=htpG PE=3 SV=1 31 739 2.0E-69
sp|P46598|HSP90_CANAL Heat shock protein 90 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSP90 PE=3 SV=1 311 771 6.0E-69
sp|P46208|HTPG_BACSU Chaperone protein HtpG OS=Bacillus subtilis (strain 168) GN=htpG PE=3 SV=1 28 724 6.0E-69
sp|A8HVS4|HTPG_AZOC5 Chaperone protein HtpG OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=htpG PE=3 SV=1 21 739 6.0E-69
sp|P54650|HTPG_ALIFS Chaperone protein HtpG (Fragment) OS=Aliivibrio fischeri GN=htpG PE=3 SV=1 19 475 1.0E-68
sp|Q8SSE8|HSP82_ENCCU Heat shock protein 90 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HSP90 PE=1 SV=1 29 728 2.0E-68
sp|Q057D9|HTPG_BUCCC Chaperone protein HtpG OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=htpG PE=3 SV=1 23 676 3.0E-68
sp|Q7VFD7|HTPG_HELHP Chaperone protein HtpG OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=htpG PE=3 SV=1 27 739 1.0E-67
sp|P27890|HSP83_LEIDO Heat shock protein 83 (Fragment) OS=Leishmania donovani GN=HSP83 PE=2 SV=1 304 741 1.0E-67
sp|Q9KE51|HTPG_BACHD Chaperone protein HtpG OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=htpG PE=3 SV=1 28 647 2.0E-67
sp|B2A875|HTPG_NATTJ Chaperone protein HtpG OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=htpG PE=3 SV=1 29 647 6.0E-67
sp|P36182|HSP82_TOBAC Heat shock protein 82 (Fragment) OS=Nicotiana tabacum GN=HSP82 PE=2 SV=1 304 741 1.0E-66
sp|A1BFP7|HTPG_CHLPD Chaperone protein HtpG OS=Chlorobium phaeobacteroides (strain DSM 266) GN=htpG PE=3 SV=1 19 738 3.0E-66
sp|P04810|HSP83_DROSI Heat shock protein 83 (Fragment) OS=Drosophila simulans GN=Hsp83 PE=3 SV=1 31 416 4.0E-66
sp|A7ZAI5|HTPG_BACMF Chaperone protein HtpG OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=htpG PE=3 SV=1 28 735 8.0E-66
sp|P04811|HSP83_DROVI Heat shock protein 83 (Fragment) OS=Drosophila virilis GN=Hsp83 PE=3 SV=1 31 416 2.0E-65
sp|Q07078|HSP83_ORYSJ Heat shock protein 81-3 OS=Oryza sativa subsp. japonica GN=HSP81-3 PE=1 SV=2 307 743 2.0E-65
sp|Q69QQ6|HSP82_ORYSJ Heat shock protein 81-2 OS=Oryza sativa subsp. japonica GN=HSP81-2 PE=2 SV=1 307 743 3.0E-65
sp|B1YG43|HTPG_EXIS2 Chaperone protein HtpG OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=htpG PE=3 SV=1 31 647 4.0E-64
sp|Q2JZH2|HTPG_RHIEC Chaperone protein HtpG OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=htpG PE=3 SV=1 29 739 8.0E-63
sp|Q65CZ5|HTPG_BACLD Chaperone protein HtpG OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=htpG PE=3 SV=1 28 680 1.0E-60
sp|Q8XNC2|HTPG_CLOPE Chaperone protein HtpG OS=Clostridium perfringens (strain 13 / Type A) GN=htpG PE=3 SV=1 28 736 3.0E-60
sp|Q0J4P2|HSP81_ORYSJ Heat shock protein 81-1 OS=Oryza sativa subsp. japonica GN=HSP81-1 PE=3 SV=2 307 753 4.0E-60
sp|A2YWQ1|HSP81_ORYSI Heat shock protein 81-1 OS=Oryza sativa subsp. indica GN=HSP81-1 PE=2 SV=1 307 753 4.0E-60
sp|Q0SVV8|HTPG_CLOPS Chaperone protein HtpG OS=Clostridium perfringens (strain SM101 / Type A) GN=htpG PE=3 SV=1 28 736 6.0E-60
sp|Q0TU16|HTPG_CLOP1 Chaperone protein HtpG OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=htpG PE=3 SV=1 28 576 1.0E-59
sp|Q58FF6|H90B4_HUMAN Putative heat shock protein HSP 90-beta 4 OS=Homo sapiens GN=HSP90AB4P PE=5 SV=1 41 633 1.0E-58
sp|C3KXP4|HTPG_CLOB6 Chaperone protein HtpG OS=Clostridium botulinum (strain 657 / Type Ba4) GN=htpG PE=3 SV=1 31 736 2.0E-58
sp|A8MGJ3|HTPG_ALKOO Chaperone protein HtpG OS=Alkaliphilus oremlandii (strain OhILAs) GN=htpG PE=3 SV=1 31 724 2.0E-58
sp|C1FPN9|HTPG_CLOBJ Chaperone protein HtpG OS=Clostridium botulinum (strain Kyoto / Type A2) GN=htpG PE=3 SV=1 31 736 3.0E-58
sp|A7GEU9|HTPG_CLOBL Chaperone protein HtpG OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=htpG PE=3 SV=1 31 736 3.0E-58
sp|B1IN79|HTPG_CLOBK Chaperone protein HtpG OS=Clostridium botulinum (strain Okra / Type B1) GN=htpG PE=3 SV=1 31 736 3.0E-58
sp|A5I3B0|HTPG_CLOBH Chaperone protein HtpG OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=htpG PE=3 SV=1 31 736 4.0E-58
sp|A7FV42|HTPG_CLOB1 Chaperone protein HtpG OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=htpG PE=3 SV=1 31 736 4.0E-58
sp|Q58FF3|ENPLL_HUMAN Putative endoplasmin-like protein OS=Homo sapiens GN=HSP90B2P PE=5 SV=1 327 695 2.0E-56
sp|B1KUN4|HTPG_CLOBM Chaperone protein HtpG OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=htpG PE=3 SV=1 31 736 5.0E-56
sp|Q97E05|HTPG_CLOAB Chaperone protein HtpG OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=htpG PE=3 SV=1 31 578 1.0E-55
sp|Q14568|HS902_HUMAN Heat shock protein HSP 90-alpha A2 OS=Homo sapiens GN=HSP90AA2P PE=1 SV=2 31 367 3.0E-55
sp|Q894P6|HTPG_CLOTE Chaperone protein HtpG OS=Clostridium tetani (strain Massachusetts / E88) GN=htpG PE=3 SV=2 31 721 1.0E-54
sp|Q8CX68|HTPG_OCEIH Chaperone protein HtpG OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=htpG PE=3 SV=1 28 735 1.0E-54
sp|A6TKN0|HTPG_ALKMQ Chaperone protein HtpG OS=Alkaliphilus metalliredigens (strain QYMF) GN=htpG PE=3 SV=1 27 721 2.0E-53
sp|A1TZH7|HTPG_MARHV Chaperone protein HtpG OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=htpG PE=3 SV=1 311 735 2.0E-52
sp|P36183|ENPL_HORVU Endoplasmin homolog OS=Hordeum vulgare PE=2 SV=1 28 253 3.0E-52
sp|A8F060|HTPG_RICCK Chaperone protein HtpG OS=Rickettsia canadensis (strain McKiel) GN=htpG PE=3 SV=1 310 739 8.0E-51
sp|O16087|HSP83_DROMI Heat shock protein 83 (Fragment) OS=Drosophila miranda GN=Hsp83 PE=3 SV=1 31 252 3.0E-48
sp|Q9BLC5|HSP83_BOMMO Heat shock protein 83 OS=Bombyx mori GN=Hsp83 PE=1 SV=1 31 252 5.0E-48
sp|P35016|ENPL_CATRO Endoplasmin homolog OS=Catharanthus roseus GN=HSP90 PE=2 SV=1 28 249 6.0E-48
sp|A4SEX9|HTPG_CHLPM Chaperone protein HtpG OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=htpG PE=3 SV=1 309 738 4.0E-46
sp|O16076|HSP83_DROPE Heat shock protein 83 (Fragment) OS=Drosophila persimilis GN=Hsp83 PE=3 SV=1 31 252 3.0E-45
sp|Q162C5|HTPG_ROSDO Chaperone protein HtpG OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=htpG PE=3 SV=1 309 739 6.0E-45
sp|Q3B3E6|HTPG_CHLL7 Chaperone protein HtpG OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=htpG PE=3 SV=1 304 738 8.0E-44
sp|O16068|HSP83_DROPB Heat shock protein 83 (Fragment) OS=Drosophila pseudoobscura bogotana GN=Hsp83 PE=3 SV=1 31 251 1.0E-41
sp|Q8A9B8|HTPG_BACTN Chaperone protein HtpG OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=htpG PE=3 SV=1 41 562 3.0E-41
sp|P0CJ84|HTPG_BACFR Chaperone protein htpG OS=Bacteroides fragilis (strain YCH46) GN=htpG PE=3 SV=1 41 562 3.0E-41
sp|E1WNR6|HTPG_BACF6 Chaperone protein htpG OS=Bacteroides fragilis (strain 638R) GN=htpG PE=3 SV=1 41 562 5.0E-41
sp|Q5LCH4|HTPG_BACFN Chaperone protein HtpG OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=htpG PE=3 SV=1 41 562 5.0E-41
sp|P0C938|HTPG_PORGI Chaperone protein HtpG OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=htpG PE=3 SV=1 41 553 2.0E-40
sp|B2RGR5|HTPG_PORG3 Chaperone protein HtpG OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=htpG PE=3 SV=1 41 553 9.0E-40
sp|Q5HBT2|HTPG_EHRRW Chaperone protein HtpG OS=Ehrlichia ruminantium (strain Welgevonden) GN=htpG PE=3 SV=1 307 737 1.0E-39
sp|Q58FF7|H90B3_HUMAN Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens GN=HSP90AB3P PE=5 SV=1 31 436 1.0E-39
sp|Q5FHC4|HTPG_EHRRG Chaperone protein HtpG OS=Ehrlichia ruminantium (strain Gardel) GN=htpG PE=3 SV=1 307 737 2.0E-39
sp|B8IU50|HTPG_METNO Chaperone protein HtpG OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=htpG PE=3 SV=1 312 718 1.0E-38
sp|Q6ARM0|HTPG_DESPS Chaperone protein HtpG OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=htpG PE=3 SV=1 309 721 1.0E-38
sp|Q3ARP2|HTPG_CHLCH Chaperone protein HtpG OS=Chlorobium chlorochromatii (strain CaD3) GN=htpG PE=3 SV=1 310 718 1.0E-38
sp|Q8KE61|HTPG_CHLTE Chaperone protein HtpG OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=htpG PE=3 SV=1 310 718 1.0E-38
sp|Q2GJI3|HTPG_ANAPZ Chaperone protein HtpG OS=Anaplasma phagocytophilum (strain HZ) GN=htpG PE=3 SV=1 307 737 6.0E-38
sp|Q12931|TRAP1_HUMAN Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens GN=TRAP1 PE=1 SV=3 28 245 3.0E-37
sp|Q5PB86|HTPG_ANAMM Chaperone protein HtpG OS=Anaplasma marginale (strain St. Maries) GN=htpG PE=3 SV=1 309 737 4.0E-37
sp|Q2GDR7|HTPG_NEOSM Chaperone protein HtpG OS=Neorickettsia sennetsu (strain Miyayama) GN=htpG PE=3 SV=1 26 275 4.0E-37
sp|Q3YSL9|HTPG_EHRCJ Chaperone protein HtpG OS=Ehrlichia canis (strain Jake) GN=htpG PE=3 SV=1 307 738 5.0E-37
sp|Q2GFY5|HTPG_EHRCR Chaperone protein HtpG OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=htpG PE=3 SV=1 307 738 1.0E-36
sp|A9W1H7|HTPG_METEP Chaperone protein HtpG OS=Methylobacterium extorquens (strain PA1) GN=htpG PE=3 SV=1 309 718 1.0E-36
sp|A8F060|HTPG_RICCK Chaperone protein HtpG OS=Rickettsia canadensis (strain McKiel) GN=htpG PE=3 SV=1 28 246 2.0E-36
sp|Q162C5|HTPG_ROSDO Chaperone protein HtpG OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=htpG PE=3 SV=1 31 271 2.0E-36
sp|P61189|HTPG_WOLPM Chaperone protein HtpG OS=Wolbachia pipientis wMel GN=htpG PE=3 SV=1 309 682 2.0E-36
sp|A1TZH7|HTPG_MARHV Chaperone protein HtpG OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=htpG PE=3 SV=1 31 245 2.0E-35
sp|A4SEX9|HTPG_CHLPM Chaperone protein HtpG OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=htpG PE=3 SV=1 23 245 2.0E-35
sp|B7KPG0|HTPG_METC4 Chaperone protein HtpG OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=htpG PE=3 SV=1 309 718 2.0E-35
sp|Q2TBI4|TRAP1_BOVIN Heat shock protein 75 kDa, mitochondrial OS=Bos taurus GN=TRAP1 PE=2 SV=1 16 245 2.0E-35
sp|Q5HBT2|HTPG_EHRRW Chaperone protein HtpG OS=Ehrlichia ruminantium (strain Welgevonden) GN=htpG PE=3 SV=1 31 252 3.0E-35
sp|Q3ARP2|HTPG_CHLCH Chaperone protein HtpG OS=Chlorobium chlorochromatii (strain CaD3) GN=htpG PE=3 SV=1 24 245 3.0E-35
sp|Q86L04|TRAP1_DICDI TNF receptor-associated protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=trap1 PE=2 SV=1 311 689 3.0E-35
sp|Q5XHZ0|TRAP1_RAT Heat shock protein 75 kDa, mitochondrial OS=Rattus norvegicus GN=Trap1 PE=1 SV=1 28 245 3.0E-35
sp|Q5FHC4|HTPG_EHRRG Chaperone protein HtpG OS=Ehrlichia ruminantium (strain Gardel) GN=htpG PE=3 SV=1 31 252 4.0E-35
sp|Q8RGH4|HTPG_FUSNN Chaperone protein HtpG OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=htpG PE=3 SV=1 31 237 9.0E-35
sp|Q9CQN1|TRAP1_MOUSE Heat shock protein 75 kDa, mitochondrial OS=Mus musculus GN=Trap1 PE=1 SV=1 28 245 1.0E-34
sp|Q6ARM0|HTPG_DESPS Chaperone protein HtpG OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=htpG PE=3 SV=1 29 245 5.0E-34
sp|Q3B3E6|HTPG_CHLL7 Chaperone protein HtpG OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=htpG PE=3 SV=1 30 249 3.0E-33
sp|Q2GDR7|HTPG_NEOSM Chaperone protein HtpG OS=Neorickettsia sennetsu (strain Miyayama) GN=htpG PE=3 SV=1 307 723 1.0E-32
sp|Q3YSL9|HTPG_EHRCJ Chaperone protein HtpG OS=Ehrlichia canis (strain Jake) GN=htpG PE=3 SV=1 23 267 1.0E-32
sp|Q86L04|TRAP1_DICDI TNF receptor-associated protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=trap1 PE=2 SV=1 28 245 1.0E-32
sp|Q8KE61|HTPG_CHLTE Chaperone protein HtpG OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=htpG PE=3 SV=1 30 249 2.0E-32
sp|B8IU50|HTPG_METNO Chaperone protein HtpG OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=htpG PE=3 SV=1 28 272 5.0E-32
sp|Q2GFY5|HTPG_EHRCR Chaperone protein HtpG OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=htpG PE=3 SV=1 23 275 7.0E-32
sp|A9W1H7|HTPG_METEP Chaperone protein HtpG OS=Methylobacterium extorquens (strain PA1) GN=htpG PE=3 SV=1 28 233 3.0E-31
sp|B7KPG0|HTPG_METC4 Chaperone protein HtpG OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=htpG PE=3 SV=1 28 233 3.0E-31
sp|P61189|HTPG_WOLPM Chaperone protein HtpG OS=Wolbachia pipientis wMel GN=htpG PE=3 SV=1 31 243 1.0E-30
sp|Q5XHZ0|TRAP1_RAT Heat shock protein 75 kDa, mitochondrial OS=Rattus norvegicus GN=Trap1 PE=1 SV=1 310 680 2.0E-30
sp|Q8RGH4|HTPG_FUSNN Chaperone protein HtpG OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=htpG PE=3 SV=1 309 736 2.0E-30
sp|Q9CQN1|TRAP1_MOUSE Heat shock protein 75 kDa, mitochondrial OS=Mus musculus GN=Trap1 PE=1 SV=1 309 682 2.0E-30
sp|Q5PB86|HTPG_ANAMM Chaperone protein HtpG OS=Anaplasma marginale (strain St. Maries) GN=htpG PE=3 SV=1 31 245 3.0E-30
sp|Q2GJI3|HTPG_ANAPZ Chaperone protein HtpG OS=Anaplasma phagocytophilum (strain HZ) GN=htpG PE=3 SV=1 31 252 7.0E-30
sp|Q12931|TRAP1_HUMAN Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens GN=TRAP1 PE=1 SV=3 310 680 2.0E-29
sp|Q2TBI4|TRAP1_BOVIN Heat shock protein 75 kDa, mitochondrial OS=Bos taurus GN=TRAP1 PE=2 SV=1 310 680 3.0E-27
sp|Q58FF7|H90B3_HUMAN Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens GN=HSP90AB3P PE=5 SV=1 504 758 2.0E-20
sp|Q58FF8|H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens GN=HSP90AB2P PE=1 SV=2 31 125 1.0E-14
sp|P20147|HSP90_PLAFP Heat shock 90 kDa protein homolog (Fragment) OS=Plasmodium falciparum (isolate Palo Alto / Uganda) PE=2 SV=1 573 771 5.0E-14
sp|Q58FF8|H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens GN=HSP90AB2P PE=1 SV=2 501 647 1.0E-11
sp|Q58FG0|HS905_HUMAN Putative heat shock protein HSP 90-alpha A5 OS=Homo sapiens GN=HSP90AA5P PE=2 SV=1 220 351 1.0E-09
sp|Q58FF8|H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens GN=HSP90AB2P PE=1 SV=2 162 351 8.0E-09
sp|Q58FG1|HS904_HUMAN Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens GN=HSP90AA4P PE=5 SV=1 102 194 1.0E-08
sp|Q58FG1|HS904_HUMAN Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens GN=HSP90AA4P PE=5 SV=1 329 428 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006457 protein folding Yes
GO:0051082 unfolded protein binding Yes
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0036094 small molecule binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|073010
MKPLQPLVFALSLFSVRTLAAEDAPKVKHDYQSDVARMRKIVINSLYSHKEIFLRELVSNANDAIEKLRITSLTD
KDAWSGADPLNITIKAEKSEDGKTGKLVISDSGIGMSDEELTTNLGTLAKSGTADFVARAEGEDISAQGNLIGAF
GLGFYSSFLVADRVEVASIPAPSKKNPNPKQYVFSSAADDSMFEVYPDPRGNTLGRGTEITLHLNDDALEYLEEQ
NIKDLISKHSSYSSSFPIYLFTQKEKEVPDEDVSMEPENKEEQPTESQDDDSDEDEAVVEEVSEDEDREPPAPKM
KTIIVDEWEQLNAQPPIWTRDPKTISDEEYKTFYKSFFKDYEAPLAWQHFSGDFGSGVSFKAILFIPSNLDESYW
QQPLEQRSRDVKLMVKRTFITSDFGEYSPPKWASWVKVVIDADDLPLNVSRETLQSNRFLRQLKDIIMKRLIQLM
KKIEEEDPEKFEKIQDVYGSIFKLGAVEDTKNRDKLTELTRFATNQRNITSLDQYLENKKKGQRQIFYLAEVGKE
ANQLAESVFIEKLDARGYEVLLLTEPLDEIMFGNLREWKSFAFQDVAKANLKFGDEDQDPEEEKAERKRLTEEYK
PLLEWLKAEAKDIVMDVVITNRLVKSACAIVAAPGGYTANVQRMMTASRGQVNRGGMIHEYALKAKLLEVNPRSP
LIEGLLRRIKDMPAEEDERDLENEEELREVASILIDGALVRSGFEVPNSNGFLFKIDRVLRRALGVSETAPTDET
VKPAPPVDPSLPTEEELMEEALKALEEDGKPKVIMPDHMKDDINIEMEEIDDDDFPVVQTEAAHDEL*
Coding >AgabiH97|073010
ATGAAGCCCCTTCAGCCGCTCGTCTTTGCTCTCTCCCTTTTTTCTGTTAGAACTCTAGCCGCTGAAGATGCGCCG
AAAGTTAAACACGACTACCAGAGTGATGTTGCTCGCATGCGAAAAATTGTGATTAATAGTCTTTATTCACACAAA
GAAATCTTCCTTCGCGAGTTGGTTTCTAATGCCAATGATGCTATTGAGAAACTGCGGATAACCAGCTTAACGGAT
AAAGATGCGTGGAGCGGGGCTGATCCTTTGAATATTACAATCAAAGCTGAGAAAAGCGAGGATGGAAAGACTGGC
AAGCTAGTTATTTCCGACTCTGGAATTGGTATGTCGGACGAAGAGCTTACTACCAATCTGGGAACCCTCGCCAAA
TCTGGTACTGCTGATTTTGTTGCACGGGCTGAAGGCGAGGACATAAGTGCACAAGGCAACCTCATCGGGGCATTT
GGTCTCGGTTTCTACAGTAGTTTCTTGGTTGCAGATCGTGTCGAAGTTGCTTCAATTCCTGCGCCATCGAAGAAG
AATCCGAACCCAAAGCAGTATGTCTTCAGCTCCGCCGCTGATGATAGCATGTTTGAAGTCTATCCTGATCCCCGT
GGAAATACACTTGGTCGTGGGACTGAGATCACACTCCACCTGAATGACGATGCTTTAGAATACCTTGAAGAACAG
AACATCAAAGACCTCATTTCCAAACATTCGTCATATTCATCTTCCTTTCCCATATATTTGTTCACTCAAAAAGAA
AAGGAAGTTCCTGACGAGGATGTCAGTATGGAGCCTGAAAACAAGGAGGAACAACCTACAGAATCTCAGGACGAT
GATTCAGATGAAGATGAGGCTGTTGTTGAAGAGGTATCCGAAGATGAAGACCGAGAACCTCCAGCTCCTAAGATG
AAGACGATCATTGTTGATGAATGGGAACAGCTTAACGCCCAGCCTCCCATTTGGACACGTGACCCCAAGACCATC
TCAGACGAGGAATACAAAACTTTTTATAAATCGTTCTTCAAAGACTATGAGGCTCCTTTAGCCTGGCAGCACTTT
TCGGGTGATTTCGGTTCTGGTGTTTCATTCAAAGCGATTCTCTTCATCCCGTCAAACCTGGATGAGTCATACTGG
CAGCAACCACTGGAACAAAGATCTAGAGATGTCAAGCTCATGGTCAAGCGAACTTTCATTACTTCAGATTTCGGT
GAATATTCCCCGCCAAAATGGGCCAGTTGGGTCAAGGTCGTTATTGATGCTGATGATCTTCCGTTGAATGTTTCG
CGAGAGACACTTCAGTCAAATCGTTTCCTCAGACAGCTTAAGGACATTATCATGAAGCGCCTCATTCAGTTGATG
AAAAAGATCGAGGAGGAAGATCCGGAGAAATTCGAAAAAATCCAGGACGTCTATGGTTCCATCTTCAAGCTTGGT
GCTGTGGAAGACACCAAGAATCGAGATAAACTTACAGAACTTACCCGATTCGCAACGAACCAGCGTAACATTACT
TCGCTTGATCAATATCTCGAAAACAAGAAGAAAGGTCAAAGACAGATCTTTTACCTCGCTGAAGTTGGAAAGGAG
GCCAATCAGCTTGCGGAAAGCGTTTTCATCGAGAAACTTGACGCCCGCGGTTACGAAGTACTCCTTCTCACTGAG
CCCCTCGACGAGATCATGTTTGGTAACTTACGGGAATGGAAAAGCTTTGCATTCCAAGATGTTGCGAAGGCCAAT
CTAAAATTTGGCGACGAAGATCAAGACCCCGAGGAAGAGAAGGCTGAGCGGAAGAGATTAACAGAGGAGTACAAG
CCGTTGCTCGAGTGGTTGAAGGCGGAAGCCAAAGACATTGTTATGGATGTCGTCATCACAAATCGACTTGTCAAG
AGCGCATGCGCAATCGTCGCAGCTCCGGGTGGTTACACGGCCAACGTACAAAGAATGATGACTGCTTCGCGTGGT
CAAGTCAATCGCGGTGGAATGATTCATGAGTATGCCCTCAAGGCCAAGCTCCTTGAGGTTAATCCTCGGTCACCC
CTTATCGAGGGACTCTTGCGCCGCATTAAGGATATGCCTGCTGAAGAAGATGAGAGGGATCTTGAAAATGAGGAA
GAGTTGCGGGAAGTTGCCTCTATACTAATCGATGGCGCTCTTGTTCGTTCAGGTTTTGAAGTCCCGAATAGCAAT
GGATTCCTCTTCAAGATTGACCGTGTGCTTCGGAGAGCTCTAGGCGTATCCGAGACCGCTCCCACCGATGAGACC
GTCAAACCTGCACCTCCTGTGGATCCATCACTTCCAACTGAAGAAGAACTCATGGAGGAAGCACTCAAAGCTTTG
GAGGAGGACGGAAAGCCCAAGGTCATTATGCCAGATCACATGAAGGATGATATAAACATTGAGATGGAGGAGATA
GACGATGACGATTTCCCCGTTGTCCAGACCGAGGCTGCTCATGATGAGCTTTAA
Transcript >AgabiH97|073010
ATGAAGCCCCTTCAGCCGCTCGTCTTTGCTCTCTCCCTTTTTTCTGTTAGAACTCTAGCCGCTGAAGATGCGCCG
AAAGTTAAACACGACTACCAGAGTGATGTTGCTCGCATGCGAAAAATTGTGATTAATAGTCTTTATTCACACAAA
GAAATCTTCCTTCGCGAGTTGGTTTCTAATGCCAATGATGCTATTGAGAAACTGCGGATAACCAGCTTAACGGAT
AAAGATGCGTGGAGCGGGGCTGATCCTTTGAATATTACAATCAAAGCTGAGAAAAGCGAGGATGGAAAGACTGGC
AAGCTAGTTATTTCCGACTCTGGAATTGGTATGTCGGACGAAGAGCTTACTACCAATCTGGGAACCCTCGCCAAA
TCTGGTACTGCTGATTTTGTTGCACGGGCTGAAGGCGAGGACATAAGTGCACAAGGCAACCTCATCGGGGCATTT
GGTCTCGGTTTCTACAGTAGTTTCTTGGTTGCAGATCGTGTCGAAGTTGCTTCAATTCCTGCGCCATCGAAGAAG
AATCCGAACCCAAAGCAGTATGTCTTCAGCTCCGCCGCTGATGATAGCATGTTTGAAGTCTATCCTGATCCCCGT
GGAAATACACTTGGTCGTGGGACTGAGATCACACTCCACCTGAATGACGATGCTTTAGAATACCTTGAAGAACAG
AACATCAAAGACCTCATTTCCAAACATTCGTCATATTCATCTTCCTTTCCCATATATTTGTTCACTCAAAAAGAA
AAGGAAGTTCCTGACGAGGATGTCAGTATGGAGCCTGAAAACAAGGAGGAACAACCTACAGAATCTCAGGACGAT
GATTCAGATGAAGATGAGGCTGTTGTTGAAGAGGTATCCGAAGATGAAGACCGAGAACCTCCAGCTCCTAAGATG
AAGACGATCATTGTTGATGAATGGGAACAGCTTAACGCCCAGCCTCCCATTTGGACACGTGACCCCAAGACCATC
TCAGACGAGGAATACAAAACTTTTTATAAATCGTTCTTCAAAGACTATGAGGCTCCTTTAGCCTGGCAGCACTTT
TCGGGTGATTTCGGTTCTGGTGTTTCATTCAAAGCGATTCTCTTCATCCCGTCAAACCTGGATGAGTCATACTGG
CAGCAACCACTGGAACAAAGATCTAGAGATGTCAAGCTCATGGTCAAGCGAACTTTCATTACTTCAGATTTCGGT
GAATATTCCCCGCCAAAATGGGCCAGTTGGGTCAAGGTCGTTATTGATGCTGATGATCTTCCGTTGAATGTTTCG
CGAGAGACACTTCAGTCAAATCGTTTCCTCAGACAGCTTAAGGACATTATCATGAAGCGCCTCATTCAGTTGATG
AAAAAGATCGAGGAGGAAGATCCGGAGAAATTCGAAAAAATCCAGGACGTCTATGGTTCCATCTTCAAGCTTGGT
GCTGTGGAAGACACCAAGAATCGAGATAAACTTACAGAACTTACCCGATTCGCAACGAACCAGCGTAACATTACT
TCGCTTGATCAATATCTCGAAAACAAGAAGAAAGGTCAAAGACAGATCTTTTACCTCGCTGAAGTTGGAAAGGAG
GCCAATCAGCTTGCGGAAAGCGTTTTCATCGAGAAACTTGACGCCCGCGGTTACGAAGTACTCCTTCTCACTGAG
CCCCTCGACGAGATCATGTTTGGTAACTTACGGGAATGGAAAAGCTTTGCATTCCAAGATGTTGCGAAGGCCAAT
CTAAAATTTGGCGACGAAGATCAAGACCCCGAGGAAGAGAAGGCTGAGCGGAAGAGATTAACAGAGGAGTACAAG
CCGTTGCTCGAGTGGTTGAAGGCGGAAGCCAAAGACATTGTTATGGATGTCGTCATCACAAATCGACTTGTCAAG
AGCGCATGCGCAATCGTCGCAGCTCCGGGTGGTTACACGGCCAACGTACAAAGAATGATGACTGCTTCGCGTGGT
CAAGTCAATCGCGGTGGAATGATTCATGAGTATGCCCTCAAGGCCAAGCTCCTTGAGGTTAATCCTCGGTCACCC
CTTATCGAGGGACTCTTGCGCCGCATTAAGGATATGCCTGCTGAAGAAGATGAGAGGGATCTTGAAAATGAGGAA
GAGTTGCGGGAAGTTGCCTCTATACTAATCGATGGCGCTCTTGTTCGTTCAGGTTTTGAAGTCCCGAATAGCAAT
GGATTCCTCTTCAAGATTGACCGTGTGCTTCGGAGAGCTCTAGGCGTATCCGAGACCGCTCCCACCGATGAGACC
GTCAAACCTGCACCTCCTGTGGATCCATCACTTCCAACTGAAGAAGAACTCATGGAGGAAGCACTCAAAGCTTTG
GAGGAGGACGGAAAGCCCAAGGTCATTATGCCAGATCACATGAAGGATGATATAAACATTGAGATGGAGGAGATA
GACGATGACGATTTCCCCGTTGTCCAGACCGAGGCTGCTCATGATGAGCTTTAA
Gene >AgabiH97|073010
ATGAAGCCCCTTCAGCCGCTCGTCTTTGCTCTCTCCCTTTTTTCTGTTAGAACTCTAGCCGCTGAAGATGCGCCG
AAAGTTAAACACGACTACCAGGTAGATTGGTCCGTCCTCAACCGGTTGCGGTTGGCTAACACGCGCTTTACAGAG
TGATGTTGCTCGCATGCGAAAAATTGTGATTAATAGGTGTGTTCTTCTACAATGTTTGGCCAAGTTGTCAGCTAA
TTCGTGTTTCTTGAGTCTTTATTCACACAAGCAAGTGCTGTTACGTGAATTCTATTCCATTTTTTAATGTCTTCA
AAGAGAAATCTTCCTTCGCGAGTTGGTTTCTAATGCCAATGATGCTATTGAGAAACTGCGGATAACCAGCTTAAC
GGATAAAGATGCGTGGAGCGGGGCTGATCCTTTGAATATTACAATCAAAGCTGAGAAAAGCGAGGATGGAAAGAC
TGGCAAGCTAGTTATTTCCGACTCTGGAATTGGTATGTCGGACGAAGAGCTTACTACCAATCTGGTGTGTTCACT
GCGCATTCCATGGCGAACAACTCAATGACCTCTACACAGGGAACCCTCGCCAAATCTGGTACTGCTGATTTTGTT
GCACGGGCTGAAGGCGAGGACATAAGTGCACAAGGCAACCTCATCGGGGCATTTGGTCTCGGTTTCTACAGTAGT
TTCTTGGTTGCAGATCGTGTCGAAGTTGCTTCAATTCCTGCGCCATCGAAGAAGAATCCGAACCCAAAGCAGTAT
GTCTTCAGCTCCGCCGCTGATGATAGCATGTTTGAAGTCTATCCTGATCCCCGTGGAAATACACTTGGTCGTGGG
ACTGAGATCACACTCCACCTGAATGACGATGCTTTAGAATACCTTGAAGAACAGAACATCAAAGACCTCATGTGA
GACTTTCCTTGTCCTTTCGTCTTTAAGCCAGCTGAACACGGTATTTTATGTGTGTAGTTCCAAACATTCGTCATA
TTCATCTTCCTTTCCCATATATTTGTTCACTCAAAAAGAAAAGGAAGTTCCTGACGAGGATGTCAGTATGGAGCC
TGAAAACAAGGAGGAACAACCTACAGAATCTCAGGACGATGATTCAGATGAAGATGAGGCTGTTGTTGAAGAGGT
ATCCGAAGATGAAGACCGAGAACCTCCAGCTCCTAAGATGAAGACGATCATTGTTGATGAATGGGAACAGCTTAA
CGCCCAGCCTCCCATTTGGACACGGTGAGTTAGTTCATACATTTAAATTTAGCTGAACTTACTGTTTTGCTAGTG
ACCCCAAGACCATCTCAGACGAGGAATACAAAACTTTTTATAAATCGTTCTTCAAAGACTATGAGGCTCCTTTAG
CCTGGCAGCACTTTTCGGGTGATTTCGGTTCTGGTGTTTCATTCAAAGCGATTCTCTTCATCCCGTCAAACCTGT
TAGTCAAAATAAAATATATGAGAGTAGGAGCTGGCGCTGATATCTTACAGGGATGAGTCATACTGGCAGCAACCA
CTGGAACAAAGATCTAGAGATGTCAAGCTCATGGTCAAGCGAACTTTCATTACTTCAGATTTCGGTGAATATTCC
CCGCCAAAATGGGCCAGTTGGGTCAAGGTCGTTATTGATGGTATGTTTTCCTCATATTTAAATAAGAAACAAAGG
TATCGATGGTCTTTTACATAGCTGATGATCTTCCGTTGAATGTTTCGCGAGAGACACTTCAGTCAAATCGTTTCC
TCAGACAGCTTAAGGACATTATCATGAAGCGCCTCATTCAGTTGATGAAAAAGATCGAGGAGGAAGATCCGGAGA
AATTCGAAAAAATCCAGGACGTCTATGGTTCCATCTTCAAGCTTGGTGCTGTGGAAGACACCAAGAATCGAGATA
AACTTACAGAACTTACCCGATTCGCAACGAACCAGCGTAACATTACTTCGCTTGATCAATATCTCGAAAACAAGA
AGAAAGGTCAAAGACAGGTAAACATTCTCTTCACATAGTGTTCAATATAATTCTAATGCTGCAAGCATTGTTTAG
ATCTTTTACCTCGCTGAAGTTGGAAAGGAGGCCAATCAGCTTGCGGAAAGCGTTTTCATCGAGAAACTTGACGCC
CGCGGTTACGAAGTACTCCTTCTCACTGAGCCCCTCGACGAGATCATGTTTGGTAACTTACGGGAATGGAAGTGG
GTATTCACTTATTTTGATGATTAACAGTTAGTGAAACTTTGTCACAGAAGCTTTGCATTCCAAGATGTTGCGAAG
GCCAATCTAAAATTTGGCGACGAAGGTTTGTAGGTATCTCATGGTTGTAACCACTGTGTTCTAAGCACTCGTTAG
ATCAAGACCCCGAGGAAGAGAAGGCTGAGCGGAAGAGATTAACAGAGGAGTACAAGCCGTTGCTCGAGTGGTTGA
AGGCGGAAGCCAAAGACATTGTTATGGATGGTAAGCTGATTAAAATAAAAATCAAGCAAGGAAAGGTCTGACGTG
GTACTCCAAAGTCGTCATCACAAATCGACTTGTCAAGAGCGCATGCGCAATCGTCGCAGCTCCGGGTGGTTACAC
GGCCAACGTACAAAGAATGATGAGTAAGTTTCGTTGAAAACCTTTTCGTGGAATAATTGTGACATATTCTTAGCT
GCTTCGCGTGGTCAAGTCAATCGCGGTGGAATGATTCATGAGTATGCCCTCAAGGCCAAGCTCCTTGAGGTTAAT
CCTCGGTCACCCCTTATCGAGGGACTCTTGCGCCGCATTAAGGATATGCCTGCTGAAGAAGATGAGAGGGATCTT
GAAAATGAGGAAGAGTTGCGGGAAGTTGCCTCTATACTAATCGATGGCGCTCTTGTTCGTTCAGGTTTTGAAGTC
CCGAATAGCAATGGGTAAGGACCTCAGACAATTTGACGGTCGCGTGATTAACAGTCCGGTAGATTCCTCTTCAAG
ATTGACCGTGTGCTTCGGAGAGCTCTAGGCGTATCCGAGACCGCTCCCACCGATGAGACCGTCAAACCTGCACCT
CCTGTGGATCCATCACTTCCAACTGAAGAAGAACTCATGGAGGAAGCACTCAAAGCTTTGGAGGAGGACGGAAAG
CCCAAGGTCATTATGCCAGATCACATGAAGGATGATATAAACATTGAGATGGAGGAGATAGACGATGACGATTTC
CCCGTTGTCCAGACCGAGGCTGCTCATGATGAGCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail