Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072940
Gene name
Locationscaffold_4:1829391..1830234
Strand-
Gene length (bp)843
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT) 9.9E-09 37 117

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 36.62 18.52 54.72
Initials Initials knots 33.52 16.82 50.22
Pileal_Stipeal_center Stage I stipe center 43.66 23.10 64.22
Pileal_Stipeal_shell Stage I stipe shell 25.96 12.68 39.24
DIF_stipe_center Stage II stipe center 43.53 22.98 64.08
DIF_stipe_shell Stage II stipe shell 55.68 30.26 81.11
DIF_stipe_skin Stage II stipe skin 44.50 23.61 65.40
DIF_cap_skin Stage II cap skin 23.88 11.60 36.16
DIF_cap_tissue Stage II cap tissue 28.92 14.48 43.35
DIF_gill_tissue Stage II gill tissue 28.32 14.14 42.50
YFB_stipe_center Young fruiting body stipe center 54.41 29.66 79.15
YFB_stipe_shell Young fruiting body stipe shell 64.82 36.10 93.55
YFB_stipe_skin Young fruiting body stipe skin 54.16 29.39 78.93
YFB_cap_skin Young fruiting body cap skin 41.40 21.68 61.12
YFB_cap_tissue Young fruiting body cap tissue 36.24 18.62 53.86
YFB_gill_tissue Young fruiting body gill tissue 31.97 16.13 47.81
YFB_veil Young fruiting body veil 26.72 13.14 40.31

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.561491 no
Casing YFB_stipe_center 0.269957 no
Casing YFB_stipe_shell 0.070317 no
Casing YFB_stipe_skin 0.280663 no
Casing YFB_cap_skin 0.820773 no
Casing YFB_cap_tissue 0.987048 no
Casing YFB_gill_tissue 0.802696 no
Casing YFB_veil 0.440104 no
Casing Initials 0.884382 no
Casing Pileal_Stipeal_center 0.717176 no
Casing Pileal_Stipeal_shell 0.406764 no
Casing DIF_stipe_center 0.726437 no
Casing DIF_stipe_shell 0.236368 no
Casing DIF_stipe_skin 0.678980 no
Casing DIF_cap_skin 0.265754 no
Casing DIF_cap_tissue 0.607904 no
DIF_gill_tissue YFB_stipe_center 0.041603 yes
DIF_gill_tissue YFB_stipe_shell 0.008121 yes
DIF_gill_tissue YFB_stipe_skin 0.047373 yes
DIF_gill_tissue YFB_cap_skin 0.327300 no
DIF_gill_tissue YFB_cap_tissue 0.587298 no
DIF_gill_tissue YFB_gill_tissue 0.831993 no
DIF_gill_tissue YFB_veil 0.928923 no
YFB_stipe_center YFB_stipe_shell 0.706618 no
YFB_stipe_center YFB_stipe_skin 0.993959 no
YFB_stipe_center YFB_cap_skin 0.502436 no
YFB_stipe_center YFB_cap_tissue 0.260599 no
YFB_stipe_center YFB_gill_tissue 0.116868 no
YFB_stipe_center YFB_veil 0.023153 yes
YFB_stipe_shell YFB_stipe_skin 0.695780 no
YFB_stipe_shell YFB_cap_skin 0.186930 no
YFB_stipe_shell YFB_cap_tissue 0.073043 no
YFB_stipe_shell YFB_gill_tissue 0.027698 yes
YFB_stipe_shell YFB_veil 0.002084 yes
YFB_stipe_skin YFB_cap_skin 0.512543 no
YFB_stipe_skin YFB_cap_tissue 0.272155 no
YFB_stipe_skin YFB_gill_tissue 0.124559 no
YFB_stipe_skin YFB_veil 0.024698 yes
YFB_cap_skin YFB_cap_tissue 0.807183 no
YFB_cap_skin YFB_gill_tissue 0.561313 no
YFB_cap_skin YFB_veil 0.218531 no
YFB_cap_tissue YFB_gill_tissue 0.826827 no
YFB_cap_tissue YFB_veil 0.467871 no
YFB_gill_tissue YFB_veil 0.727013 no
Initials DIF_gill_tissue 0.752973 no
Initials YFB_stipe_center 0.174757 no
Initials YFB_stipe_shell 0.038047 yes
Initials YFB_stipe_skin 0.183946 no
Initials YFB_cap_skin 0.660263 no
Initials YFB_cap_tissue 0.904245 no
Initials YFB_gill_tissue 0.944299 no
Initials YFB_veil 0.640217 no
Initials Pileal_Stipeal_center 0.551575 no
Initials Pileal_Stipeal_shell 0.596493 no
Initials DIF_stipe_center 0.562962 no
Initials DIF_stipe_shell 0.152056 no
Initials DIF_stipe_skin 0.517309 no
Initials DIF_cap_skin 0.439090 no
Initials DIF_cap_tissue 0.791383 no
Pileal_Stipeal_center DIF_gill_tissue 0.239648 no
Pileal_Stipeal_center YFB_stipe_center 0.621178 no
Pileal_Stipeal_center YFB_stipe_shell 0.263203 no
Pileal_Stipeal_center YFB_stipe_skin 0.629128 no
Pileal_Stipeal_center YFB_cap_skin 0.931434 no
Pileal_Stipeal_center YFB_cap_tissue 0.701932 no
Pileal_Stipeal_center YFB_gill_tissue 0.450128 no
Pileal_Stipeal_center YFB_veil 0.151916 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.138841 no
Pileal_Stipeal_center DIF_stipe_center 0.995749 no
Pileal_Stipeal_center DIF_stipe_shell 0.563641 no
Pileal_Stipeal_center DIF_stipe_skin 0.976388 no
Pileal_Stipeal_center DIF_cap_skin 0.077698 no
Pileal_Stipeal_center DIF_cap_tissue 0.272443 no
Pileal_Stipeal_shell DIF_gill_tissue 0.894834 no
Pileal_Stipeal_shell YFB_stipe_center 0.021583 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.006387 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.024946 yes
Pileal_Stipeal_shell YFB_cap_skin 0.215847 no
Pileal_Stipeal_shell YFB_cap_tissue 0.435788 no
Pileal_Stipeal_shell YFB_gill_tissue 0.689665 no
Pileal_Stipeal_shell YFB_veil 0.966662 no
Pileal_Stipeal_shell DIF_stipe_center 0.156911 no
Pileal_Stipeal_shell DIF_stipe_shell 0.017783 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.129247 no
Pileal_Stipeal_shell DIF_cap_skin 0.902686 no
Pileal_Stipeal_shell DIF_cap_tissue 0.864132 no
DIF_stipe_center DIF_gill_tissue 0.246496 no
DIF_stipe_center YFB_stipe_center 0.618074 no
DIF_stipe_center YFB_stipe_shell 0.263696 no
DIF_stipe_center YFB_stipe_skin 0.625514 no
DIF_stipe_center YFB_cap_skin 0.935181 no
DIF_stipe_center YFB_cap_tissue 0.710446 no
DIF_stipe_center YFB_gill_tissue 0.463153 no
DIF_stipe_center YFB_veil 0.161964 no
DIF_stipe_center DIF_stipe_shell 0.558689 no
DIF_stipe_center DIF_stipe_skin 0.972860 no
DIF_stipe_center DIF_cap_skin 0.081927 no
DIF_stipe_center DIF_cap_tissue 0.280457 no
DIF_stipe_shell DIF_gill_tissue 0.032742 yes
DIF_stipe_shell YFB_stipe_center 0.970338 no
DIF_stipe_shell YFB_stipe_shell 0.758280 no
DIF_stipe_shell YFB_stipe_skin 0.964337 no
DIF_stipe_shell YFB_cap_skin 0.455567 no
DIF_stipe_shell YFB_cap_tissue 0.229368 no
DIF_stipe_shell YFB_gill_tissue 0.096785 no
DIF_stipe_shell YFB_veil 0.017783 yes
DIF_stipe_shell DIF_stipe_skin 0.613280 no
DIF_stipe_shell DIF_cap_skin 0.007782 yes
DIF_stipe_shell DIF_cap_tissue 0.043983 yes
DIF_stipe_skin DIF_gill_tissue 0.211238 no
DIF_stipe_skin YFB_stipe_center 0.660639 no
DIF_stipe_skin YFB_stipe_shell 0.295435 no
DIF_stipe_skin YFB_stipe_skin 0.668752 no
DIF_stipe_skin YFB_cap_skin 0.903993 no
DIF_stipe_skin YFB_cap_tissue 0.661997 no
DIF_stipe_skin YFB_gill_tissue 0.417331 no
DIF_stipe_skin YFB_veil 0.137455 no
DIF_stipe_skin DIF_cap_skin 0.071413 no
DIF_stipe_skin DIF_cap_tissue 0.242880 no
DIF_cap_skin DIF_gill_tissue 0.753475 no
DIF_cap_skin YFB_stipe_center 0.009123 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.011041 yes
DIF_cap_skin YFB_cap_skin 0.122169 no
DIF_cap_skin YFB_cap_tissue 0.292890 no
DIF_cap_skin YFB_gill_tissue 0.527470 no
DIF_cap_skin YFB_veil 0.850470 no
DIF_cap_skin DIF_cap_tissue 0.714955 no
DIF_cap_tissue DIF_gill_tissue 0.975429 no
DIF_cap_tissue YFB_stipe_center 0.050908 no
DIF_cap_tissue YFB_stipe_shell 0.007439 yes
DIF_cap_tissue YFB_stipe_skin 0.056561 no
DIF_cap_tissue YFB_cap_skin 0.360945 no
DIF_cap_tissue YFB_cap_tissue 0.634140 no
DIF_cap_tissue YFB_gill_tissue 0.869058 no
DIF_cap_tissue YFB_veil 0.898925 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072940
MHLPLLTLLFVLVSASPHVPLVDQTASDRTFDTRVPVQLGVMSKCPDALLCESTFNEVLGKVGDKMDLSLVYVAK
FDESKPDFGGIICKHGAEECAGNCQNFEGIAQIGKPSVALKCAEAAQIDWNASGAGQCAGEDGSGKGDEGVDLLR
KSVRLAHDLEVTKSCTIIINSRRVCVHDGTWKECEGGHTVNDFVRQINDEYDRLNSFRG*
Coding >AgabiH97|072940
ATGCACCTTCCTCTGCTCACTCTCCTTTTCGTCCTCGTCTCTGCATCCCCACATGTCCCCCTTGTTGACCAGACG
GCGTCAGATAGAACTTTTGACACCAGGGTACCAGTTCAGCTTGGGGTAATGAGCAAATGCCCCGACGCCCTCTTG
TGTGAATCTACTTTCAATGAGGTGCTCGGGAAAGTAGGCGACAAAATGGACCTATCGCTTGTCTATGTTGCGAAA
TTTGATGAATCCAAGCCTGACTTTGGGGGCATCATCTGCAAACATGGAGCAGAGGAATGCGCAGGAAATTGTCAG
AATTTTGAAGGGATAGCCCAGATAGGAAAGCCCAGTGTCGCCCTGAAATGCGCCGAAGCTGCGCAAATCGATTGG
AACGCGTCTGGGGCGGGCCAGTGTGCCGGGGAAGACGGTAGTGGTAAAGGAGATGAAGGTGTGGATCTTCTTCGG
AAAAGCGTGAGGCTGGCTCACGACTTGGAAGTCACTAAAAGCTGCACAATCATTATCAATTCACGTAGAGTATGC
GTGCACGATGGCACCTGGAAGGAATGCGAGGGCGGCCATACTGTTAATGACTTTGTTCGCCAAATCAACGACGAG
TATGATAGACTCAACTCTTTCCGAGGTTAG
Transcript >AgabiH97|072940
ATGCACCTTCCTCTGCTCACTCTCCTTTTCGTCCTCGTCTCTGCATCCCCACATGTCCCCCTTGTTGACCAGACG
GCGTCAGATAGAACTTTTGACACCAGGGTACCAGTTCAGCTTGGGGTAATGAGCAAATGCCCCGACGCCCTCTTG
TGTGAATCTACTTTCAATGAGGTGCTCGGGAAAGTAGGCGACAAAATGGACCTATCGCTTGTCTATGTTGCGAAA
TTTGATGAATCCAAGCCTGACTTTGGGGGCATCATCTGCAAACATGGAGCAGAGGAATGCGCAGGAAATTGTCAG
AATTTTGAAGGGATAGCCCAGATAGGAAAGCCCAGTGTCGCCCTGAAATGCGCCGAAGCTGCGCAAATCGATTGG
AACGCGTCTGGGGCGGGCCAGTGTGCCGGGGAAGACGGTAGTGGTAAAGGAGATGAAGGTGTGGATCTTCTTCGG
AAAAGCGTGAGGCTGGCTCACGACTTGGAAGTCACTAAAAGCTGCACAATCATTATCAATTCACGTAGAGTATGC
GTGCACGATGGCACCTGGAAGGAATGCGAGGGCGGCCATACTGTTAATGACTTTGTTCGCCAAATCAACGACGAG
TATGATAGACTCAACTCTTTCCGAGGTTAG
Gene >AgabiH97|072940
ATGCACCTTCCTCTGCTCACTCTCCTTTTCGTCCTCGTCTCTGCATCCCCACATGTCCCCCTTGTTGACCAGACG
GCGTCAGATAGAACTTTTGACACCAGGGTACCAGTTCAGCTTGGGGTAATGAGCAAATGCCCCGACGCCCTCTTG
TGTGAATCTACTTTCAATGAGGTGCTCGGGAAAGTAGGCGACAAAATGGACCTATCGCTTGTCTATGTTGCGAAG
TACATAGTTCTTCTCGTTGAATTACAACATTCTCCTTTTGACACATATCTAGATTTGATGAATCCAAGCCTGACT
TTGGGGGCATCATCTGCAAACATGGAGCAGAGGAATGCGCAGGAAATGTACAGCAACTATGTATCGCTAAATATG
CATCCCCGGACCAATGATGGAACTTTGTTCAGTGTCAGAATTTTGAAGGGATAGCCCAGATAGGAAAGCCCAGTG
TCGCCCTGAAATGCGCCGAAGCTGCGCAAATCGATTGGAACGCGTCTGGGGCGGGCCAGTGTGCCGGGGAAGACG
GTAGTGGTAAAGGAGATGAAGGTGTGGATCTTCTTCGGAAAAGCGTGAGGCTGGCTCACGACTTGGAAGTCACGT
AAGTTTCTCAAACCTTTGCCACGTTTTTCTCTATTCATCTCAATTACAGTAAAAGCTGCACAATCATTATCAATT
CACGTAGAGTATGCGTGCACGATGGCACCTGGAAGGAATGCGAGGTGTGTTTTCCCGACACTGTCTTTGATTTAG
AACTCAAGTGGTTCCCAGGGCGGCCATACTGTTAATGACTTTGTTCGCCAAATCAACGACGAGTATGATAGACTC
AACTCTTTCCGAGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail