Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072930
Gene name
Locationscaffold_4:1828897..1829286
Strand+
Gene length (bp)389
Transcript length (bp)294
Coding sequence length (bp)294
Protein length (aa) 98

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08571 Yos1 Yos1-like 2.9E-30 5 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13825|YOS1_SCHPO Protein transport protein yos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yos1 PE=3 SV=1 1 97 3.0E-19
sp|Q3B8G7|IR3IP_XENLA Immediate early response 3-interacting protein 1 OS=Xenopus laevis GN=ier3ip1 PE=3 SV=1 2 97 3.0E-16
sp|Q3E834|YOS1_YEAST Protein transport protein YOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOS1 PE=1 SV=1 1 97 7.0E-16
sp|Q4VBI2|IR3IP_DANRE Immediate early response 3-interacting protein 1 OS=Danio rerio GN=ier3ip1 PE=3 SV=1 2 97 8.0E-16
sp|Q9Y5U9|IR3IP_HUMAN Immediate early response 3-interacting protein 1 OS=Homo sapiens GN=IER3IP1 PE=1 SV=1 2 97 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13825|YOS1_SCHPO Protein transport protein yos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yos1 PE=3 SV=1 1 97 3.0E-19
sp|Q3B8G7|IR3IP_XENLA Immediate early response 3-interacting protein 1 OS=Xenopus laevis GN=ier3ip1 PE=3 SV=1 2 97 3.0E-16
sp|Q3E834|YOS1_YEAST Protein transport protein YOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOS1 PE=1 SV=1 1 97 7.0E-16
sp|Q4VBI2|IR3IP_DANRE Immediate early response 3-interacting protein 1 OS=Danio rerio GN=ier3ip1 PE=3 SV=1 2 97 8.0E-16
sp|Q9Y5U9|IR3IP_HUMAN Immediate early response 3-interacting protein 1 OS=Homo sapiens GN=IER3IP1 PE=1 SV=1 2 97 2.0E-14
sp|Q1JQC2|IR3IP_BOVIN Immediate early response 3-interacting protein 1 OS=Bos taurus GN=IER3IP1 PE=3 SV=1 2 97 2.0E-14
sp|P85007|IR3IP_RAT Immediate early response 3-interacting protein 1 OS=Rattus norvegicus GN=Ier3ip1 PE=3 SV=1 2 97 3.0E-14
sp|Q9CR20|IR3IP_MOUSE Immediate early response 3-interacting protein 1 OS=Mus musculus GN=Ier3ip1 PE=3 SV=1 2 97 3.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072930
MFLIGTILQVSLLLVNAIAILNEERFLARIGWVSTSRLRTHSANAGYNHPYEQNGYGNEDVGIKARLIDLIGAVR
TLMRIPLIAINVAVILYELVWG*
Coding >AgabiH97|072930
ATGTTTCTGATTGGTACTATTCTTCAAGTCTCCCTTCTGCTTGTAAATGCCATTGCTATCCTGAACGAGGAACGC
TTTCTAGCCAGAATCGGATGGGTTTCGACAAGTCGACTCCGAACCCACAGTGCAAATGCGGGATACAATCACCCT
TACGAACAGAATGGCTACGGAAACGAAGACGTTGGAATCAAAGCCCGCCTGATAGACCTTATAGGCGCTGTCCGC
ACCCTCATGCGTATTCCACTCATAGCAATAAACGTAGCCGTCATTCTATACGAATTGGTCTGGGGATGA
Transcript >AgabiH97|072930
ATGTTTCTGATTGGTACTATTCTTCAAGTCTCCCTTCTGCTTGTAAATGCCATTGCTATCCTGAACGAGGAACGC
TTTCTAGCCAGAATCGGATGGGTTTCGACAAGTCGACTCCGAACCCACAGTGCAAATGCGGGATACAATCACCCT
TACGAACAGAATGGCTACGGAAACGAAGACGTTGGAATCAAAGCCCGCCTGATAGACCTTATAGGCGCTGTCCGC
ACCCTCATGCGTATTCCACTCATAGCAATAAACGTAGCCGTCATTCTATACGAATTGGTCTGGGGATGA
Gene >AgabiH97|072930
ATGTTTCTGATTGGTACTATTCTTCAAGTCTCCCTTCTGCTTGTAAATGCCATTGCTATCCTGAACGAGGAACGC
TTTCTAGCCAGAAGTATGTCCTAAGCTCTTCCTATGTCTGCACATGCTCATACCCATCCAGTCGGATGGGTTTCG
ACAAGTCGACTCCGAACCCACAGTGCAAATGCGGGATACAATCACCCTTACGAACAGAATGGCTACGGAAACGAA
GACGTTGGAATCAAAGCCCGCCTGATAGACCTTATAGGCGCTGTCCGCACCCTCATGCGTAGTCAGTGGTCACTA
CGTTCGCCTGGCTTTTCACTGATGGCTTTGCAGTTCCACTCATAGCAATAAACGTAGCCGTCATTCTATACGAAT
TGGTCTGGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail