Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072910
Gene name
Locationscaffold_4:1825863..1827637
Strand-
Gene length (bp)1774
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04597 Ribophorin_I Ribophorin I 3.8E-124 35 485

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4R4T0|RPN1_MACFA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Macaca fascicularis GN=RPN1 PE=2 SV=1 37 494 8.0E-55
sp|Q5RFB6|RPN1_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Pongo abelii GN=RPN1 PE=2 SV=1 37 494 2.0E-54
sp|P04843|RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens GN=RPN1 PE=1 SV=1 37 498 3.0E-54
sp|Q91YQ5|RPN1_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Mus musculus GN=Rpn1 PE=1 SV=1 37 498 3.0E-53
sp|Q54C27|OST1_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Dictyostelium discoideum GN=ost1 PE=2 SV=1 37 497 4.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4R4T0|RPN1_MACFA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Macaca fascicularis GN=RPN1 PE=2 SV=1 37 494 8.0E-55
sp|Q5RFB6|RPN1_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Pongo abelii GN=RPN1 PE=2 SV=1 37 494 2.0E-54
sp|P04843|RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens GN=RPN1 PE=1 SV=1 37 498 3.0E-54
sp|Q91YQ5|RPN1_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Mus musculus GN=Rpn1 PE=1 SV=1 37 498 3.0E-53
sp|Q54C27|OST1_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Dictyostelium discoideum GN=ost1 PE=2 SV=1 37 497 4.0E-53
sp|Q9GMB0|RPN1_PIG Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Sus scrofa GN=RPN1 PE=1 SV=1 37 494 3.0E-52
sp|P07153|RPN1_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Rattus norvegicus GN=Rpn1 PE=2 SV=1 37 498 1.0E-51
sp|Q0DJC5|OST1A_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A OS=Oryza sativa subsp. japonica GN=OST1A PE=2 SV=1 115 494 1.0E-44
sp|Q9GZH4|RPN1_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Caenorhabditis elegans GN=ribo-1 PE=3 SV=2 34 492 2.0E-41
sp|Q9ZUA0|OST1B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B OS=Arabidopsis thaliana GN=OST1B PE=2 SV=1 119 495 4.0E-40
sp|B9FDT1|OST1B_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B OS=Oryza sativa subsp. japonica GN=OST1B PE=2 SV=1 134 494 4.0E-39
sp|Q9SFX3|OST1A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A OS=Arabidopsis thaliana GN=OST1A PE=2 SV=1 38 494 3.0E-38
sp|P41543|OST1_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST1 PE=1 SV=1 14 492 3.0E-37
sp|Q10176|OST1_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ost1 PE=3 SV=1 35 467 3.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0016021 integral component of membrane Yes
GO:0043170 macromolecule metabolic process No
GO:0043412 macromolecule modification No
GO:0044238 primary metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0110165 cellular anatomical entity No
GO:0070085 glycosylation No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0036211 protein modification process No
GO:0005575 cellular_component No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 468 485 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072910
MPLGWRTLPQLLFVALASIIHTSCSAAAAETGVAFENSAIVRTVALGGSVVHVTTTIAIKSLADEQDIYTVSFPR
RERDASSFLEVRVKNQKDPLQIREKPFYGNAKFTEVDVVLPEKLAVNATLNLVVETIQTHMTDPWPEFASQTDQQ
ALRYTTDLYVISRYPTLVQRTKIKALVPRIISYTTPTNVDAFTTGNVVAKSGAVVTYGPFSSIPVSTNKDFLKTY
QQPVTVRYYHEQPVLEVTSYKRAVEISHWGSNINTEDQVVLKNAGPKLKGHFSRVDYQGQLYKGSQVPHVLHSLS
LDLPPGIDNVYYYDQIGNVSTSKLNVAPAVAKGEPVMKTSLLNMKLRYPLMGGWNYTFTVGWDADLAGVAGYNSA
TGEYNVEIPIMTTIPGAVVNQHELKIVLPEGATDVEVVTPYPSLTLWLDKHTAYLDTIGRPAIMFEYKDLTPAHA
KNIYVRYKLSSGDHFRKPVAVSAVFFGLFFFTFVVRRIDLTIPKKQKAT*
Coding >AgabiH97|072910
ATGCCACTTGGTTGGCGAACGCTCCCTCAACTTCTCTTCGTCGCTCTCGCCTCTATCATCCACACATCATGCTCC
GCAGCGGCGGCGGAAACAGGCGTAGCTTTTGAGAACAGCGCGATCGTGCGCACAGTAGCGTTAGGTGGTTCAGTC
GTCCACGTCACGACGACAATCGCAATCAAGAGTCTGGCCGACGAGCAAGATATATACACAGTCTCATTCCCTCGC
AGGGAGAGGGACGCTTCGAGTTTCCTAGAGGTTAGAGTAAAAAACCAAAAGGACCCGCTTCAGATCAGGGAGAAG
CCGTTCTATGGCAACGCTAAGTTCACCGAAGTGGATGTTGTATTACCCGAGAAGTTGGCAGTGAATGCAACACTA
AACCTTGTGGTGGAGACTATCCAGACTCATATGACAGACCCGTGGCCAGAATTTGCTAGTCAGACCGATCAACAG
GCATTGAGGTATACCACCGACCTCTATGTCATCAGCAGATACCCAACGTTGGTCCAGCGCACCAAAATCAAAGCT
CTGGTTCCCCGCATCATCTCCTATACAACTCCTACAAATGTAGATGCCTTTACAACGGGCAATGTGGTTGCGAAG
TCTGGTGCTGTCGTTACCTATGGTCCTTTCAGTAGTATCCCGGTTTCGACCAACAAGGACTTCCTCAAGACTTAC
CAGCAACCCGTTACCGTCCGTTATTACCACGAACAGCCCGTCTTAGAGGTAACAAGCTATAAGCGTGCTGTGGAA
ATTAGTCATTGGGGATCGAATATCAATACTGAGGATCAAGTTGTCTTGAAAAATGCCGGTCCCAAGCTGAAAGGC
CACTTTTCGCGCGTCGATTATCAAGGTCAACTTTACAAGGGCTCACAAGTACCTCATGTATTGCATTCCCTGTCT
CTCGACCTCCCACCGGGCATCGACAACGTTTATTACTACGACCAAATCGGCAATGTCTCCACATCTAAGCTGAAT
GTTGCTCCGGCAGTCGCTAAGGGCGAGCCAGTCATGAAGACAAGCTTGTTAAATATGAAGTTGAGGTATCCCCTG
ATGGGCGGTTGGAATTATACATTCACTGTGGGCTGGGATGCAGACTTGGCTGGTGTTGCCGGCTACAATTCGGCA
ACAGGAGAGTATAACGTTGAAATACCAATAATGACGACCATTCCCGGCGCTGTTGTAAACCAACACGAGCTCAAG
ATTGTGTTACCCGAAGGTGCAACTGACGTCGAAGTCGTTACTCCCTACCCTTCTCTGACACTTTGGCTCGACAAA
CACACAGCCTACTTGGATACGATTGGTCGTCCAGCCATCATGTTCGAGTACAAAGATCTTACCCCTGCGCATGCA
AAGAATATCTATGTTCGCTATAAACTCAGCAGCGGGGACCATTTCAGAAAACCGGTGGCGGTATCCGCTGTTTTC
TTTGGGTTGTTCTTCTTCACATTTGTTGTGAGGCGAATCGACCTAACAATCCCAAAAAAGCAAAAGGCGACATAG
Transcript >AgabiH97|072910
ATGCCACTTGGTTGGCGAACGCTCCCTCAACTTCTCTTCGTCGCTCTCGCCTCTATCATCCACACATCATGCTCC
GCAGCGGCGGCGGAAACAGGCGTAGCTTTTGAGAACAGCGCGATCGTGCGCACAGTAGCGTTAGGTGGTTCAGTC
GTCCACGTCACGACGACAATCGCAATCAAGAGTCTGGCCGACGAGCAAGATATATACACAGTCTCATTCCCTCGC
AGGGAGAGGGACGCTTCGAGTTTCCTAGAGGTTAGAGTAAAAAACCAAAAGGACCCGCTTCAGATCAGGGAGAAG
CCGTTCTATGGCAACGCTAAGTTCACCGAAGTGGATGTTGTATTACCCGAGAAGTTGGCAGTGAATGCAACACTA
AACCTTGTGGTGGAGACTATCCAGACTCATATGACAGACCCGTGGCCAGAATTTGCTAGTCAGACCGATCAACAG
GCATTGAGGTATACCACCGACCTCTATGTCATCAGCAGATACCCAACGTTGGTCCAGCGCACCAAAATCAAAGCT
CTGGTTCCCCGCATCATCTCCTATACAACTCCTACAAATGTAGATGCCTTTACAACGGGCAATGTGGTTGCGAAG
TCTGGTGCTGTCGTTACCTATGGTCCTTTCAGTAGTATCCCGGTTTCGACCAACAAGGACTTCCTCAAGACTTAC
CAGCAACCCGTTACCGTCCGTTATTACCACGAACAGCCCGTCTTAGAGGTAACAAGCTATAAGCGTGCTGTGGAA
ATTAGTCATTGGGGATCGAATATCAATACTGAGGATCAAGTTGTCTTGAAAAATGCCGGTCCCAAGCTGAAAGGC
CACTTTTCGCGCGTCGATTATCAAGGTCAACTTTACAAGGGCTCACAAGTACCTCATGTATTGCATTCCCTGTCT
CTCGACCTCCCACCGGGCATCGACAACGTTTATTACTACGACCAAATCGGCAATGTCTCCACATCTAAGCTGAAT
GTTGCTCCGGCAGTCGCTAAGGGCGAGCCAGTCATGAAGACAAGCTTGTTAAATATGAAGTTGAGGTATCCCCTG
ATGGGCGGTTGGAATTATACATTCACTGTGGGCTGGGATGCAGACTTGGCTGGTGTTGCCGGCTACAATTCGGCA
ACAGGAGAGTATAACGTTGAAATACCAATAATGACGACCATTCCCGGCGCTGTTGTAAACCAACACGAGCTCAAG
ATTGTGTTACCCGAAGGTGCAACTGACGTCGAAGTCGTTACTCCCTACCCTTCTCTGACACTTTGGCTCGACAAA
CACACAGCCTACTTGGATACGATTGGTCGTCCAGCCATCATGTTCGAGTACAAAGATCTTACCCCTGCGCATGCA
AAGAATATCTATGTTCGCTATAAACTCAGCAGCGGGGACCATTTCAGAAAACCGGTGGCGGTATCCGCTGTTTTC
TTTGGGTTGTTCTTCTTCACATTTGTTGTGAGGCGAATCGACCTAACAATCCCAAAAAAGCAAAAGGCGACATAG
Gene >AgabiH97|072910
ATGCCACTTGGTTGGCGAACGCTCCCTCAACTTCTCTTCGTCGCTCTCGCCTCTATCATCCACACATCATGCTCC
GCAGCGGCGGCGGAAACAGGCGTAGCTTTTGAGAACAGCGCGATCGTGCGCACAGTAGCGTTAGGTGGTTCAGTC
GTCCACGTCACGACGACAATCGCAATCAAGAGTCTGGCCGACGAGCAAGATATATACACAGTCTCATTCCCTCGC
AGGGAGAGGGACGCTTCGAGTTTCCTAGAGGTTAGAGTAAAAAACCAAAAGGACCCGCTTCAGATCAGGGAGAAG
CCGTTCTATGGCAACGCGTGAGTCTAGTTATTACACGATTAAATCTCTCTGATCCGACTTGAACTCGTCGACAGT
AAGTTCACCGAAGTGGATGTTGTATTACCCGAGAAGTTGGCAGTGAATGCAACACTAAACCTTGTGGTGGAGACT
ATCCAGACTCATATGACAGACCCGTGGCCAGAATTTGCTAGTCAGACCGATCAACAGGCATTGAGGTATACCACC
GACCTCTATGTCATCAGCAGATACCCAACGTTGGTCCAGCGCACCAAAATCAAGTGAGTTTATTTGCGCCCATAT
GCGATGAAATTATTCACAGGACCAGAGCTCTGGTTCCCCGCATCATCTCCTATACAACTCCTACAAATGTAGATG
CCTTTACAACGGGCAATGTGGTTGCGAAGTCTGGTGCTGTCGTTACCTATGGTCCTTTCAGTAGTATCCCGGTTT
CGACCAACAAGGACTTCCTCAAGACTTACCAGCAACCCGTTACCGTCCGTTATTACCACGAACAGCCCGTCTTAG
AGGTAACAAGCTATAAGCGTGCTGTGGAAATTAGTCATTGGGGATCGAATATCAATACTGAGGATCAAGTTGTCT
TGAAAAATGCCGGTCCCAAGTACGTTCTTCCCTCCGCTTCAGGCCTGCGAGTTGGCTGACGCGATATTTTCCTAG
GCTGAAAGGCCACTTTTCGCGCGTCGATTATCAAGGTCAACTTTACAAGGGCTCACAAGTACCTCATGTATTGCA
TTCCCTGTCTCTCGACCTCCCACCGGGCATCGACAACGTTTATTACTACGACCAAATCGGCAATGTCTCCACATC
TAAGCTGAATGTTGCTCCGGCAGTCGCTAAGGGCGAGCCAGTCATGAAGACAAGCTTGTTAAATATGAAGTTGAG
GTATCCCCTGATGGGCGGTTGGAATTATACATTCACTGTGGGCTGGGATGCAGACTTGGCTGGTGTTGCCGGCTA
CAATTCGGCAACAGGAGAGTATAACGTTGAAATACCAATAATGACGACCATTCCCGGCGCTGTTGTAAACCAACA
CGAGCTCAAGATTGTGTTACCCGAAGGTGCAACGTAAGGAGGTTCTTTCCACGCTCAAGTAATTTTTGTTTATCT
AACAAAACTGCATTATAGTGACGTCGAAGTCGTTACTCCCTACCCTTCTCTGACACTTTGGCTCGACAAACACAC
AGCCTACTTGGATACGATTGGTCGTCCAGCCATCATGTTCGAGTACAAAGATCTTACCCCTGCGCATGCAAAGAA
TATCTATGTAAGTTGACACCACTCGTCGTTGTCGTTTATCGTATCTCATTCGAGAAAAAAGGTTCGCTATAAACT
CAGCAGCGGGGACCATTTCAGAAAACCGGTGGCGGTATCCGCTGTTTTCTTTGGGTTGTTCTTCTTCACATTTGT
TGTGAGGCGAATCGACCTAACAATCCCAAAAAAGCAAAAGGCGACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail