Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072880
Gene name
Locationscaffold_4:1820346..1822551
Strand+
Gene length (bp)2205
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 3.4E-28 65 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 66 379 2.0E-14
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 59 390 4.0E-14
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 59 390 2.0E-13
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 3 379 4.0E-13
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 46 376 4.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 66 379 2.0E-14
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 59 390 4.0E-14
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 59 390 2.0E-13
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 3 379 4.0E-13
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 46 376 4.0E-12
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 59 379 2.0E-11
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 22 386 3.0E-11
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 59 379 5.0E-11
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 62 387 5.0E-11
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 59 379 2.0E-10
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 77 390 2.0E-10
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 64 387 2.0E-10
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 62 387 3.0E-10
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 23 379 3.0E-10
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 54 386 4.0E-10
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 29 379 4.0E-10
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 62 387 8.0E-10
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 59 379 1.0E-09
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 30 386 1.0E-09
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 46 379 2.0E-09
sp|P18276|CHYM_SHEEP Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 71 376 3.0E-09
sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 31 376 3.0E-09
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 18 376 4.0E-09
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 7 381 5.0E-09
sp|C5PEI9|PEPA_COCP7 Aspartic protease PEP3 OS=Coccidioides posadasii (strain C735) GN=PEP3 PE=3 SV=1 36 377 6.0E-09
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 59 376 7.0E-09
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 59 376 7.0E-09
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 59 379 7.0E-09
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 51 379 1.0E-08
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 59 376 1.0E-08
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 59 379 2.0E-08
sp|P55956|ASP3_CAEEL Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 71 379 3.0E-08
sp|P00794|CHYM_BOVIN Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 71 376 5.0E-08
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 54 387 7.0E-08
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 59 376 1.0E-07
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 64 376 2.0E-07
sp|Q4WZS3|Y5950_ASPFU Putative aspergillopepsin A-like aspartic endopeptidase AFUA_2G15950 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G15950 PE=3 SV=2 55 377 2.0E-07
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 59 379 3.0E-07
sp|C5FZ57|Y7979_ARTOC Putative aspergillopepsin A-like aspartic endopeptidase MCYG_07979 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07979 PE=3 SV=1 56 377 3.0E-07
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 64 376 3.0E-07
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 4 299 4.0E-07
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 34 378 4.0E-07
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 64 376 1.0E-06
sp|P83495|PAG4_SHEEP Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 54 386 1.0E-06
sp|D4AIC4|Y4018_ARTBC Probable aspartic-type endopeptidase ARB_04018 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04018 PE=3 SV=1 46 376 1.0E-06
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 64 376 1.0E-06
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 64 379 2.0E-06
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 36 379 2.0E-06
sp|Q4LAL9|CATD_CANLF Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 31 376 2.0E-06
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 64 376 2.0E-06
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 64 376 3.0E-06
sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 51 376 3.0E-06
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 64 376 4.0E-06
sp|E5A7T3|PEPA_LEPMJ Aspartic protease PEP1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=PEP1 PE=3 SV=2 59 376 6.0E-06
sp|Q05744|CATD_CHICK Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1 50 376 7.0E-06
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 259 377 8.0E-06
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 64 376 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 453 475 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 133.16 77.95 188.38
Initials Initials knots 81.09 48.64 113.54
Pileal_Stipeal_center Stage I stipe center 130.05 76.41 183.69
Pileal_Stipeal_shell Stage I stipe shell 122.80 72.59 173.00
DIF_stipe_center Stage II stipe center 112.34 66.57 158.11
DIF_stipe_shell Stage II stipe shell 139.47 80.73 198.21
DIF_stipe_skin Stage II stipe skin 121.10 71.01 171.18
DIF_cap_skin Stage II cap skin 132.49 77.81 187.17
DIF_cap_tissue Stage II cap tissue 128.68 75.64 181.72
DIF_gill_tissue Stage II gill tissue 128.45 75.60 181.30
YFB_stipe_center Young fruiting body stipe center 115.45 67.90 163.00
YFB_stipe_shell Young fruiting body stipe shell 145.43 85.02 205.85
YFB_stipe_skin Young fruiting body stipe skin 112.73 66.69 158.76
YFB_cap_skin Young fruiting body cap skin 139.16 81.19 197.12
YFB_cap_tissue Young fruiting body cap tissue 173.72 99.77 247.67
YFB_gill_tissue Young fruiting body gill tissue 158.74 91.82 225.65
YFB_veil Young fruiting body veil 146.30 85.51 207.09

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.948021 no
Casing YFB_stipe_center 0.739199 no
Casing YFB_stipe_shell 0.857404 no
Casing YFB_stipe_skin 0.685822 no
Casing YFB_cap_skin 0.934697 no
Casing YFB_cap_tissue 0.447983 no
Casing YFB_gill_tissue 0.671439 no
Casing YFB_veil 0.845018 no
Casing Initials 0.067147 no
Casing Pileal_Stipeal_center 0.965117 no
Casing Pileal_Stipeal_shell 0.866657 no
Casing DIF_stipe_center 0.677559 no
Casing DIF_stipe_shell 0.932271 no
Casing DIF_stipe_skin 0.842129 no
Casing DIF_cap_skin 0.991727 no
Casing DIF_cap_tissue 0.949986 no
DIF_gill_tissue YFB_stipe_center 0.820718 no
DIF_gill_tissue YFB_stipe_shell 0.786378 no
DIF_gill_tissue YFB_stipe_skin 0.769622 no
DIF_gill_tissue YFB_cap_skin 0.874613 no
DIF_gill_tissue YFB_cap_tissue 0.365647 no
DIF_gill_tissue YFB_gill_tissue 0.585974 no
DIF_gill_tissue YFB_veil 0.770526 no
YFB_stipe_center YFB_stipe_shell 0.526528 no
YFB_stipe_center YFB_stipe_skin 0.966718 no
YFB_stipe_center YFB_cap_skin 0.631428 no
YFB_stipe_center YFB_cap_tissue 0.173722 no
YFB_stipe_center YFB_gill_tissue 0.335521 no
YFB_stipe_center YFB_veil 0.511124 no
YFB_stipe_shell YFB_stipe_skin 0.468413 no
YFB_stipe_shell YFB_cap_skin 0.936701 no
YFB_stipe_shell YFB_cap_tissue 0.664028 no
YFB_stipe_shell YFB_gill_tissue 0.858816 no
YFB_stipe_shell YFB_veil 0.991476 no
YFB_stipe_skin YFB_cap_skin 0.562579 no
YFB_stipe_skin YFB_cap_tissue 0.133562 no
YFB_stipe_skin YFB_gill_tissue 0.275834 no
YFB_stipe_skin YFB_veil 0.440776 no
YFB_cap_skin YFB_cap_tissue 0.553436 no
YFB_cap_skin YFB_gill_tissue 0.766457 no
YFB_cap_skin YFB_veil 0.925466 no
YFB_cap_tissue YFB_gill_tissue 0.855303 no
YFB_cap_tissue YFB_veil 0.670953 no
YFB_gill_tissue YFB_veil 0.871542 no
Initials DIF_gill_tissue 0.103148 no
Initials YFB_stipe_center 0.246933 no
Initials YFB_stipe_shell 0.030372 yes
Initials YFB_stipe_skin 0.282797 no
Initials YFB_cap_skin 0.040947 yes
Initials YFB_cap_tissue 0.002525 yes
Initials YFB_gill_tissue 0.010093 yes
Initials YFB_veil 0.026215 yes
Initials Pileal_Stipeal_center 0.092165 no
Initials Pileal_Stipeal_shell 0.145790 no
Initials DIF_stipe_center 0.285035 no
Initials DIF_stipe_shell 0.044418 yes
Initials DIF_stipe_skin 0.165288 no
Initials DIF_cap_skin 0.076262 no
Initials DIF_cap_tissue 0.096785 no
Pileal_Stipeal_center DIF_gill_tissue 0.983101 no
Pileal_Stipeal_center YFB_stipe_center 0.792055 no
Pileal_Stipeal_center YFB_stipe_shell 0.810780 no
Pileal_Stipeal_center YFB_stipe_skin 0.740388 no
Pileal_Stipeal_center YFB_cap_skin 0.895004 no
Pileal_Stipeal_center YFB_cap_tissue 0.394192 no
Pileal_Stipeal_center YFB_gill_tissue 0.616585 no
Pileal_Stipeal_center YFB_veil 0.794896 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.910865 no
Pileal_Stipeal_center DIF_stipe_center 0.732128 no
Pileal_Stipeal_center DIF_stipe_shell 0.892318 no
Pileal_Stipeal_center DIF_stipe_skin 0.887102 no
Pileal_Stipeal_center DIF_cap_skin 0.972845 no
Pileal_Stipeal_center DIF_cap_tissue 0.984759 no
Pileal_Stipeal_shell DIF_gill_tissue 0.934257 no
Pileal_Stipeal_shell YFB_stipe_center 0.902139 no
Pileal_Stipeal_shell YFB_stipe_shell 0.670483 no
Pileal_Stipeal_shell YFB_stipe_skin 0.859229 no
Pileal_Stipeal_shell YFB_cap_skin 0.774103 no
Pileal_Stipeal_shell YFB_cap_tissue 0.267567 no
Pileal_Stipeal_shell YFB_gill_tissue 0.463602 no
Pileal_Stipeal_shell YFB_veil 0.655527 no
Pileal_Stipeal_shell DIF_stipe_center 0.852863 no
Pileal_Stipeal_shell DIF_stipe_shell 0.772290 no
Pileal_Stipeal_shell DIF_stipe_skin 0.978999 no
Pileal_Stipeal_shell DIF_cap_skin 0.878244 no
Pileal_Stipeal_shell DIF_cap_tissue 0.929545 no
DIF_stipe_center DIF_gill_tissue 0.760540 no
DIF_stipe_center YFB_stipe_center 0.961456 no
DIF_stipe_center YFB_stipe_shell 0.457845 no
DIF_stipe_center YFB_stipe_skin 0.994908 no
DIF_stipe_center YFB_cap_skin 0.557529 no
DIF_stipe_center YFB_cap_tissue 0.136602 no
DIF_stipe_center YFB_gill_tissue 0.278888 no
DIF_stipe_center YFB_veil 0.443173 no
DIF_stipe_center DIF_stipe_shell 0.560991 no
DIF_stipe_center DIF_stipe_skin 0.879399 no
DIF_stipe_center DIF_cap_skin 0.684297 no
DIF_stipe_center DIF_cap_tissue 0.754255 no
DIF_stipe_shell DIF_gill_tissue 0.872170 no
DIF_stipe_shell YFB_stipe_center 0.633455 no
DIF_stipe_shell YFB_stipe_shell 0.940101 no
DIF_stipe_shell YFB_stipe_skin 0.577094 no
DIF_stipe_shell YFB_cap_skin 0.996811 no
DIF_stipe_shell YFB_cap_tissue 0.566324 no
DIF_stipe_shell YFB_gill_tissue 0.777716 no
DIF_stipe_shell YFB_veil 0.929701 no
DIF_stipe_shell DIF_stipe_skin 0.747978 no
DIF_stipe_shell DIF_cap_skin 0.924238 no
DIF_stipe_shell DIF_cap_tissue 0.873640 no
DIF_stipe_skin DIF_gill_tissue 0.913849 no
DIF_stipe_skin YFB_stipe_center 0.930098 no
DIF_stipe_skin YFB_stipe_shell 0.647532 no
DIF_stipe_skin YFB_stipe_skin 0.890687 no
DIF_stipe_skin YFB_cap_skin 0.746095 no
DIF_stipe_skin YFB_cap_tissue 0.254947 no
DIF_stipe_skin YFB_gill_tissue 0.443716 no
DIF_stipe_skin YFB_veil 0.631806 no
DIF_stipe_skin DIF_cap_skin 0.858156 no
DIF_stipe_skin DIF_cap_tissue 0.909635 no
DIF_cap_skin DIF_gill_tissue 0.956568 no
DIF_cap_skin YFB_stipe_center 0.748971 no
DIF_cap_skin YFB_stipe_shell 0.847433 no
DIF_cap_skin YFB_stipe_skin 0.695734 no
DIF_cap_skin YFB_cap_skin 0.927453 no
DIF_cap_skin YFB_cap_tissue 0.435649 no
DIF_cap_skin YFB_gill_tissue 0.656939 no
DIF_cap_skin YFB_veil 0.833249 no
DIF_cap_skin DIF_cap_tissue 0.957909 no
DIF_cap_tissue DIF_gill_tissue 0.997123 no
DIF_cap_tissue YFB_stipe_center 0.814939 no
DIF_cap_tissue YFB_stipe_shell 0.787885 no
DIF_cap_tissue YFB_stipe_skin 0.764874 no
DIF_cap_tissue YFB_cap_skin 0.876933 no
DIF_cap_tissue YFB_cap_tissue 0.367653 no
DIF_cap_tissue YFB_gill_tissue 0.587521 no
DIF_cap_tissue YFB_veil 0.773079 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072880
MRLSFSLPLAFLALAAARTYPFKRLKHPSHLLPRAQITEDGQVTTSNAGTPFSLSTIQDLIYLVDITVAGHNYTV
QLDTGSSDLWIKGETNPLPGVTTTDSFYNITYVLGWASGHLAYAPVEFISLKVDKQALLDVDAADNPVLGYGLDG
ICGLGFDSLSSIDYGVNQTSSDSGRSLLHNLFALNPSEPNFIAFSLHRSTAGGGDDDDVEGSFSIGEYEPEYAAV
ANTSKISTWPLHFPKRWTVLLDSLIVGDHLVVPHTQISTAPSNKAVVLLDSGASYTYAPKSIVDAIYANITGARF
DEKSNQWLVPCDHEVNMALQIGGQVFPLNPLDVTPTTPGNNKTCVGSFIPSQLSAESQFDWLIGDNFLRSVYAVY
DFGDFDDKGVAGPPYMRLLSLVNPDDASADFHEIRGGSPQHNITYKGLNETANTPSFFISDDVSESIETISKLVP
AMLAVVAFNAIVLVVLIIGGVVCWMKKRRLRSFQRRVTRGREGLSPMPMNPVSSYTPGGQLPSSMPVAYEPVSMA
LTEDTFVPPSPAFHKLDRNMQPGDRPKSIA*
Coding >AgabiH97|072880
ATGCGTCTCTCTTTCTCCCTGCCCCTCGCTTTTCTTGCCCTCGCTGCTGCCCGTACATACCCCTTCAAGCGCCTA
AAACACCCCTCCCACCTCCTCCCCCGTGCACAAATCACCGAAGACGGCCAGGTCACCACTTCAAATGCAGGGACG
CCCTTCAGCCTCAGCACCATTCAGGACCTCATTTATCTCGTCGATATCACTGTTGCCGGCCACAACTATACCGTC
CAGCTCGACACGGGCTCTTCTGACCTCTGGATAAAAGGGGAAACAAACCCGCTACCTGGCGTGACTACCACCGAC
TCTTTCTACAACATCACTTATGTCCTCGGTTGGGCTTCCGGCCACCTTGCTTATGCCCCCGTCGAGTTTATATCG
TTGAAAGTCGACAAACAAGCTTTGCTTGACGTTGATGCCGCCGACAACCCAGTTCTCGGATACGGTCTTGATGGA
ATATGCGGCCTCGGCTTTGATAGTCTTTCTAGCATTGACTACGGTGTCAACCAAACCTCGTCAGATTCTGGTCGC
AGTCTCCTACACAACCTCTTCGCTCTCAACCCGTCCGAGCCCAATTTTATCGCCTTTTCTCTTCACCGCAGCACA
GCAGGTGGCGGAGATGATGATGATGTTGAAGGCAGCTTTTCCATAGGTGAATATGAACCCGAGTATGCTGCCGTC
GCCAATACTTCCAAGATTTCCACTTGGCCTCTACATTTTCCCAAGAGGTGGACTGTACTCTTGGACTCTCTAATT
GTCGGAGATCATCTTGTGGTTCCCCATACACAAATTTCCACCGCTCCGAGTAACAAGGCAGTTGTTTTGTTGGAC
AGCGGCGCGTCTTATACTTATGCCCCCAAATCAATTGTTGACGCAATCTATGCGAACATCACAGGCGCGCGCTTT
GATGAGAAAAGCAACCAATGGTTGGTACCATGCGATCATGAGGTCAACATGGCACTTCAAATTGGAGGCCAAGTC
TTTCCGCTCAATCCGCTTGATGTGACGCCCACGACGCCCGGGAACAACAAAACATGTGTGGGTTCTTTTATTCCA
TCTCAACTTTCCGCGGAGAGTCAATTTGACTGGCTCATCGGTGACAACTTTCTTCGCTCCGTTTATGCTGTATAC
GATTTCGGTGACTTCGACGACAAGGGTGTTGCAGGTCCTCCCTATATGCGCCTTCTTTCGCTCGTCAATCCCGAT
GACGCCTCTGCCGATTTCCACGAGATCAGAGGTGGTTCCCCCCAACATAACATCACCTACAAGGGTCTCAATGAA
ACTGCCAACACGCCTTCCTTCTTTATTTCGGACGACGTTTCCGAATCGATAGAGACGATAAGCAAACTTGTCCCC
GCCATGTTGGCTGTGGTTGCATTCAATGCTATCGTACTTGTTGTGCTGATAATTGGTGGAGTCGTCTGCTGGATG
AAAAAGAGAAGATTGAGAAGCTTCCAGCGAAGGGTCACAAGAGGTCGCGAGGGTTTGAGTCCCATGCCCATGAAC
CCCGTGTCGAGTTATACACCAGGTGGGCAGTTGCCATCGAGCATGCCCGTTGCTTATGAGCCAGTATCGATGGCT
CTTACCGAGGATACTTTCGTACCACCCTCCCCCGCGTTCCATAAGCTCGACCGCAACATGCAGCCTGGTGATCGA
CCAAAATCGATTGCATAA
Transcript >AgabiH97|072880
ATGCGTCTCTCTTTCTCCCTGCCCCTCGCTTTTCTTGCCCTCGCTGCTGCCCGTACATACCCCTTCAAGCGCCTA
AAACACCCCTCCCACCTCCTCCCCCGTGCACAAATCACCGAAGACGGCCAGGTCACCACTTCAAATGCAGGGACG
CCCTTCAGCCTCAGCACCATTCAGGACCTCATTTATCTCGTCGATATCACTGTTGCCGGCCACAACTATACCGTC
CAGCTCGACACGGGCTCTTCTGACCTCTGGATAAAAGGGGAAACAAACCCGCTACCTGGCGTGACTACCACCGAC
TCTTTCTACAACATCACTTATGTCCTCGGTTGGGCTTCCGGCCACCTTGCTTATGCCCCCGTCGAGTTTATATCG
TTGAAAGTCGACAAACAAGCTTTGCTTGACGTTGATGCCGCCGACAACCCAGTTCTCGGATACGGTCTTGATGGA
ATATGCGGCCTCGGCTTTGATAGTCTTTCTAGCATTGACTACGGTGTCAACCAAACCTCGTCAGATTCTGGTCGC
AGTCTCCTACACAACCTCTTCGCTCTCAACCCGTCCGAGCCCAATTTTATCGCCTTTTCTCTTCACCGCAGCACA
GCAGGTGGCGGAGATGATGATGATGTTGAAGGCAGCTTTTCCATAGGTGAATATGAACCCGAGTATGCTGCCGTC
GCCAATACTTCCAAGATTTCCACTTGGCCTCTACATTTTCCCAAGAGGTGGACTGTACTCTTGGACTCTCTAATT
GTCGGAGATCATCTTGTGGTTCCCCATACACAAATTTCCACCGCTCCGAGTAACAAGGCAGTTGTTTTGTTGGAC
AGCGGCGCGTCTTATACTTATGCCCCCAAATCAATTGTTGACGCAATCTATGCGAACATCACAGGCGCGCGCTTT
GATGAGAAAAGCAACCAATGGTTGGTACCATGCGATCATGAGGTCAACATGGCACTTCAAATTGGAGGCCAAGTC
TTTCCGCTCAATCCGCTTGATGTGACGCCCACGACGCCCGGGAACAACAAAACATGTGTGGGTTCTTTTATTCCA
TCTCAACTTTCCGCGGAGAGTCAATTTGACTGGCTCATCGGTGACAACTTTCTTCGCTCCGTTTATGCTGTATAC
GATTTCGGTGACTTCGACGACAAGGGTGTTGCAGGTCCTCCCTATATGCGCCTTCTTTCGCTCGTCAATCCCGAT
GACGCCTCTGCCGATTTCCACGAGATCAGAGGTGGTTCCCCCCAACATAACATCACCTACAAGGGTCTCAATGAA
ACTGCCAACACGCCTTCCTTCTTTATTTCGGACGACGTTTCCGAATCGATAGAGACGATAAGCAAACTTGTCCCC
GCCATGTTGGCTGTGGTTGCATTCAATGCTATCGTACTTGTTGTGCTGATAATTGGTGGAGTCGTCTGCTGGATG
AAAAAGAGAAGATTGAGAAGCTTCCAGCGAAGGGTCACAAGAGGTCGCGAGGGTTTGAGTCCCATGCCCATGAAC
CCCGTGTCGAGTTATACACCAGGTGGGCAGTTGCCATCGAGCATGCCCGTTGCTTATGAGCCAGTATCGATGGCT
CTTACCGAGGATACTTTCGTACCACCCTCCCCCGCGTTCCATAAGCTCGACCGCAACATGCAGCCTGGTGATCGA
CCAAAATCGATTGCATAA
Gene >AgabiH97|072880
ATGCGTCTCTCTTTCTCCCTGCCCCTCGCTTTTCTTGCCCTCGCTGCTGCCCGTACATACCCCTTCAAGCGCCTA
AAACACCCCTCCCACCTCCTCCCCCGTGCACAAATCACCGAAGACGGCCAGGTCACCACTTCAAATGCAGGGACG
CCCTTCAGCCTCAGGTCGGCTCCCCCAGCTCTCCACCTTTCCCTCAGCTCACACCCTTCCCACTAGCACCATTCA
GGACCTCATTTATCTCGTCGATGTATGTGTCAAGCTTGTCTTACCCAATAATTAGGCTTAACCTCTCACGCCCCG
CACAGATCACTGTTGCCGGCCACAGTTCCGTACCCTTCGCTTCCTTCGGCGTCCATCGCCCGCTTATATTCCTGC
AGACTATACCGTCCAGCTCGACACGGGCTCTTCTGACCTCTGGATAAAAGGGGAAACAAACCCGCTACCTGGCGT
GACTACCACCGTATGTTCTATTTCCGCACTCCTATGTCAATCGCCTGATTTTTTTTTTCTCAAGGACTCTTTCTA
CAACATCACTGTAAGTGGTCCAACTTCTTAGTCAACCCACACCTTCACCTCGTGGTAGTATGTCCTCGGTTGGGC
TTCCGGCCACCTTGCTTATGCCCCCGTCGAGTTTATATCGTAAGTGCTCCTCATCTACCCCTTTAATTGTGTAAG
CACATACATTCCAGGTTGAAAGTCGACAAACAAGCTTTGCTTGACGTTGATGCCGCCGACAACCCAGTTCTCGGA
TACGGTCTTGATGGAATATGCGGCCTCGGCTTTGATAGTCTTTCTAGCATTGACTACGGTGTCAACCAAACCTCG
TCAGATTCTGGTCGCAGTCTCCTACACAACCTCTTCGCTCTCAACCCGTCCGAGCCCAATTTTATCGCCTTTTCT
CTTCACCGCAGCACAGCAGGTGGCGGAGATGATGATGATGTTGAAGGCAGCTTTTCCATAGGTATCGTATACTTT
TGGGCGAGGTCCTCGTTCCCCTCTCCTCGCTGACTCTCTTCCACCTAGGTGAATATGAACCCGAGTATGCTGCCG
TCGCCAATACTTCCAAGATTTCCACTTGGCCTCTACATTTTCCCAAGAGGTGGACTGTACTCTTGGACTCTCTAA
TTGTCGGAGATCATCTTGTGGTTCCCCATACACAAATTTCCACCGCTCCGAGTAACAAGGCAGTTGTTTTGTTGG
ACAGCGGCGCGTCTTATACGTGAGTAATCGTCTCCGCTGTCGAGTGTATCAACTCAAGAAATCGCTCCTTGGACA
GTTATGCCCCCAAATCAATTGTTGACGCAATCTATGCGAACATCACAGGCGCGCGCTTTGATGAGAAAAGCAACC
AATGGTTGGTACCATGCGATCATGAGGTCAACATGGCACTTCAAATTGGGTATGTATAATAATCTCGTTGATCCT
GGAAAGGAAATTCATATTTCGTACAGAGGCCAAGTCTTTCCGCTCAATCCGCTTGATGTGACGCCCACGACGCCC
GGGAACAACAAAACATGTGTGGGTTCTTTTATTCCATCTCAACTTTCCGCGGAGAGTCAATTGTGAGTCCGCAAC
TATCTTTTATCCTTACATCATATTTACCGCGCGTGTAGTGACTGGCTCATCGGTGACAACTTTCTTCGCTCCGTT
TATGCTGTATACGATTTCGGTGACTTCGACGACAAGGGTGTTGCAGGTCCTCCCTATATGCGCCTTCTTTCGCTC
GTCAATCCCGATGACGCCTCTGCCGATTTCCACGAGATCAGAGGTGGTTCCCCCCAACATAACATCACCTACAAG
GGTCTCAATGAAACTGCCAACACGCCTTCCTTCTTTATTTCGGACGACGTTTCCGAATCGATAGAGACGATAAGC
AAACTTGTCCCCGCCATGTTGGCTGTGGTTGCATTCAATGCTATCGTACTTGTTGTGCTGATAATTGGTGGAGTC
GTCTGCTGGATGAAAAAGAGAAGATTGAGAAGCTTCCAGCGAAGGGTCACAAGAGGTCGCGAGGGTTTGAGTCCC
ATGCCCATGAACCCCGTGTCGAGTTATACACCAGGTGGGCAGTTGCCATCGAGCATGCCCGTTGCTTATGAGCCA
GTATCGATGGCTCTTACCGAGGATACTTTCGTACCACCCTCCCCCGCGTTCCATAAGCTCGACCGCAACATGCAG
CCTGGTGATCGACCAAAATCGATTGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail