Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072850
Gene name
Locationscaffold_4:1814715..1816833
Strand-
Gene length (bp)2118
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00977 His_biosynth Histidine biosynthesis protein 1.7E-34 10 237
PF00831 Ribosomal_L29 Ribosomal L29 protein 2.0E-17 285 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10184|HIS4_SCHPO 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3F10.09 PE=3 SV=1 2 264 5.0E-114
sp|Q7RXQ8|HIS4_NEUCR 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=his-7 PE=3 SV=1 8 253 6.0E-108
sp|Q6C2U0|HIS4_YARLI 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HIS6 PE=3 SV=1 8 253 1.0E-105
sp|P40545|HIS4_YEAST 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS6 PE=1 SV=1 8 253 1.0E-90
sp|Q6CQL7|HIS4_KLULA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIS6 PE=3 SV=1 8 253 1.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10184|HIS4_SCHPO 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3F10.09 PE=3 SV=1 2 264 5.0E-114
sp|Q7RXQ8|HIS4_NEUCR 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=his-7 PE=3 SV=1 8 253 6.0E-108
sp|Q6C2U0|HIS4_YARLI 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HIS6 PE=3 SV=1 8 253 1.0E-105
sp|P40545|HIS4_YEAST 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS6 PE=1 SV=1 8 253 1.0E-90
sp|Q6CQL7|HIS4_KLULA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIS6 PE=3 SV=1 8 253 1.0E-90
sp|Q6FPN5|HIS4_CANGA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HIS6 PE=3 SV=1 8 253 4.0E-90
sp|Q75AP1|HIS4_ASHGO 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HIS6 PE=3 SV=1 8 253 1.0E-88
sp|Q9HFV5|HIS4_CANAX 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Candida albicans GN=HIS6 PE=3 SV=1 8 253 7.0E-85
sp|Q6BUV9|HIS4_DEBHA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HIS6 PE=3 SV=2 8 253 8.0E-83
sp|O82782|HIS3_ARATH 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase, chloroplastic OS=Arabidopsis thaliana GN=HISN3 PE=2 SV=1 8 255 7.0E-80
sp|P17078|RL35_RAT 60S ribosomal protein L35 OS=Rattus norvegicus GN=Rpl35 PE=1 SV=3 279 400 2.0E-43
sp|Q6ZWV7|RL35_MOUSE 60S ribosomal protein L35 OS=Mus musculus GN=Rpl35 PE=1 SV=1 279 400 2.0E-43
sp|Q3MHM7|RL35_BOVIN 60S ribosomal protein L35 OS=Bos taurus GN=RPL35 PE=2 SV=3 279 400 2.0E-43
sp|P42766|RL35_HUMAN 60S ribosomal protein L35 OS=Homo sapiens GN=RPL35 PE=1 SV=2 279 400 6.0E-43
sp|Q29361|RL35_PIG 60S ribosomal protein L35 OS=Sus scrofa GN=RPL35 PE=1 SV=3 279 400 7.0E-43
sp|Q69CJ9|RL35_OPHHA 60S ribosomal protein L35 OS=Ophiophagus hannah GN=RPL35 PE=2 SV=3 279 400 1.0E-42
sp|Q98TF7|RL35_CHICK 60S ribosomal protein L35 OS=Gallus gallus GN=RPL35 PE=2 SV=3 279 400 1.0E-42
sp|Q6PBC1|RL35_XENTR 60S ribosomal protein L35 OS=Xenopus tropicalis GN=rpl35 PE=2 SV=3 279 400 3.0E-42
sp|Q5DVH6|RL35_PLAFE 60S ribosomal protein L35 OS=Platichthys flesus GN=rpl35 PE=2 SV=3 279 400 5.0E-41
sp|Q6UZF7|RL35_HIPCM 60S ribosomal protein L35 OS=Hippocampus comes GN=rpl35 PE=2 SV=3 279 400 6.0E-41
sp|O74904|RL35_SCHPO 60S ribosomal protein L35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl35 PE=1 SV=1 281 400 3.0E-40
sp|Q9LZ41|RL354_ARATH 60S ribosomal protein L35-4 OS=Arabidopsis thaliana GN=RPL35D PE=2 SV=1 279 399 6.0E-40
sp|Q9M3D2|RL353_ARATH 60S ribosomal protein L35-3 OS=Arabidopsis thaliana GN=RPL35C PE=2 SV=1 279 399 7.0E-40
sp|Q8JHJ1|RL35_DANRE 60S ribosomal protein L35 OS=Danio rerio GN=rpl35 PE=2 SV=3 279 400 8.0E-40
sp|Q9M5L0|RL35_EUPES 60S ribosomal protein L35 OS=Euphorbia esula GN=RPL35 PE=2 SV=1 279 400 1.0E-39
sp|O80626|RL352_ARATH 60S ribosomal protein L35-2 OS=Arabidopsis thaliana GN=RPL35B PE=2 SV=1 279 399 5.0E-39
sp|Q9SF53|RL351_ARATH 60S ribosomal protein L35-1 OS=Arabidopsis thaliana GN=RPL35A PE=2 SV=1 279 399 5.0E-39
sp|Q90YT4|RL35_ICTPU 60S ribosomal protein L35 OS=Ictalurus punctatus GN=rpl35 PE=2 SV=3 279 400 1.0E-38
sp|Q8L805|RL35_WHEAT 60S ribosomal protein L35 OS=Triticum aestivum GN=RPL35 PE=1 SV=1 279 400 2.0E-35
sp|P34662|RL35_CAEEL 60S ribosomal protein L35 OS=Caenorhabditis elegans GN=rpl-35 PE=3 SV=1 280 400 6.0E-34
sp|P0CX85|RL35B_YEAST 60S ribosomal protein L35-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL35B PE=1 SV=1 277 400 8.0E-32
sp|P0CX84|RL35A_YEAST 60S ribosomal protein L35-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL35A PE=1 SV=1 277 400 8.0E-32
sp|P52817|RL35_BABBO 60S ribosomal protein L35 OS=Babesia bovis GN=RPL35 PE=2 SV=1 280 398 5.0E-31
sp|Q54J23|RL35_DICDI 60S ribosomal protein L35 OS=Dictyostelium discoideum GN=rpl35 PE=3 SV=1 277 400 7.0E-30
sp|P0DJ51|RL35_TETTS 60S ribosomal protein L35 OS=Tetrahymena thermophila (strain SB210) GN=RPL35 PE=1 SV=1 277 400 2.0E-27
sp|Q4N756|RL35_THEPA 60S ribosomal protein L35 OS=Theileria parva GN=RPL35 PE=3 SV=1 280 398 1.0E-22
sp|Q4UIF8|RL35_THEAN 60S ribosomal protein L35 OS=Theileria annulata GN=RPL35 PE=3 SV=1 280 400 1.0E-22
sp|Q2VA69|RL36_THELE 60S ribosomal protein L35 OS=Theileria lestoquardi GN=RPL35 PE=2 SV=1 280 400 1.0E-22
sp|Q58927|HIS4_METJA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisA PE=3 SV=1 7 239 2.0E-16
sp|Q0C639|HIS4_HYPNA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisA PE=3 SV=1 10 220 7.0E-14
sp|Q2NHB3|HIS4_METST 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisA PE=3 SV=1 7 239 3.0E-13
sp|Q0K692|HIS4_CUPNH 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hisA PE=3 SV=1 10 221 1.0E-10
sp|A9KNX3|HIS4_CLOPH 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=hisA PE=3 SV=1 10 226 2.0E-10
sp|Q2G9L9|HIS4_NOVAD 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=hisA PE=3 SV=1 10 220 2.0E-10
sp|A7HSH1|HIS4_PARL1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=hisA PE=3 SV=1 7 220 3.0E-10
sp|Q8XV84|HIS4_RALSO 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Ralstonia solanacearum (strain GMI1000) GN=hisA PE=3 SV=1 10 221 3.0E-10
sp|A1W1K3|HIS4_CAMJJ 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hisA PE=3 SV=1 10 231 5.0E-10
sp|B3R795|HIS4_CUPTR 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=hisA PE=3 SV=1 10 221 5.0E-10
sp|Q46WL7|HIS4_CUPPJ 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisA PE=3 SV=1 10 221 8.0E-10
sp|Q13TQ9|HIS4_BURXL 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Burkholderia xenovorans (strain LB400) GN=hisA PE=3 SV=1 10 221 9.0E-10
sp|P05324|HIS4_METVA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanococcus vannielii GN=hisA PE=3 SV=1 10 220 1.0E-09
sp|Q5NMD5|HIS4_ZYMMO 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisA PE=3 SV=2 7 241 1.0E-09
sp|Q7TUA7|HIS4_PROMP 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hisA PE=3 SV=1 10 220 2.0E-09
sp|A5CVQ5|HIS4_VESOH 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hisA PE=3 SV=1 10 246 2.0E-09
sp|A6US29|HIS4_METVS 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisA PE=3 SV=1 10 220 2.0E-09
sp|A2SQR0|HIS4_METLZ 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=hisA PE=3 SV=1 10 239 2.0E-09
sp|A1AXM7|HIS4_RUTMC 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=hisA PE=3 SV=1 10 220 3.0E-09
sp|A8FNR3|HIS4_CAMJ8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=hisA PE=3 SV=1 10 231 3.0E-09
sp|Q1LIB1|HIS4_CUPMC 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hisA PE=3 SV=1 10 221 5.0E-09
sp|B2SZ60|HIS4_BURPP 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hisA PE=3 SV=1 10 221 5.0E-09
sp|A7GWX9|HIS4_CAMC5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Campylobacter curvus (strain 525.92) GN=hisA PE=3 SV=1 10 220 5.0E-09
sp|B1XX77|HIS4_LEPCP 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=hisA PE=3 SV=1 10 221 7.0E-09
sp|Q1GNC2|HIS4_SPHAL 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=hisA PE=3 SV=1 10 220 9.0E-09
sp|Q7UKJ9|HIS6_RHOBA Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisF PE=3 SV=1 10 243 1.0E-08
sp|Q31E65|HIS4_THICR 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Thiomicrospira crunogena (strain XCL-2) GN=hisA PE=3 SV=1 10 220 1.0E-08
sp|C5BMF4|HIS4_TERTT 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=hisA PE=3 SV=1 10 241 1.0E-08
sp|Q67KI0|HIS6_SYMTH Imidazole glycerol phosphate synthase subunit HisF OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisF PE=3 SV=1 10 239 2.0E-08
sp|Q31B81|HIS4_PROM9 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Prochlorococcus marinus (strain MIT 9312) GN=hisA PE=3 SV=1 10 239 2.0E-08
sp|Q2N8I7|HIS4_ERYLH 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Erythrobacter litoralis (strain HTCC2594) GN=hisA PE=3 SV=1 7 223 2.0E-08
sp|Q88UE3|HIS6_LACPL Imidazole glycerol phosphate synthase subunit HisF OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisF PE=3 SV=1 10 243 2.0E-08
sp|B3EEF2|HIS6_CHLL2 Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisF PE=3 SV=1 84 242 2.0E-08
sp|B2UQA2|HIS6_AKKM8 Imidazole glycerol phosphate synthase subunit HisF OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=hisF PE=3 SV=1 10 243 2.0E-08
sp|A3PCK5|HIS4_PROM0 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Prochlorococcus marinus (strain MIT 9301) GN=hisA PE=3 SV=1 10 239 2.0E-08
sp|Q9PM74|HIS4_CAMJE 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisA PE=1 SV=1 10 231 3.0E-08
sp|Q5HSJ0|HIS4_CAMJR 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Campylobacter jejuni (strain RM1221) GN=hisA PE=3 SV=1 10 231 5.0E-08
sp|Q1I3G7|HIS4_PSEE4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Pseudomonas entomophila (strain L48) GN=hisA PE=3 SV=1 10 246 5.0E-08
sp|A7H5V3|HIS4_CAMJD 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=hisA PE=3 SV=1 10 231 6.0E-08
sp|B3PGA3|HIS4_CELJU 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Cellvibrio japonicus (strain Ueda107) GN=hisA PE=3 SV=1 10 220 6.0E-08
sp|A5V9V9|HIS4_SPHWW 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=hisA PE=3 SV=1 7 220 6.0E-08
sp|Q0K693|HIS6_CUPNH Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hisF PE=3 SV=1 10 243 6.0E-08
sp|B2JHY0|HIS4_BURP8 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hisA PE=3 SV=1 10 221 6.0E-08
sp|A3DJF7|HIS6_CLOTH Imidazole glycerol phosphate synthase subunit HisF OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hisF PE=3 SV=1 10 239 6.0E-08
sp|B2UEE6|HIS4_RALPJ 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Ralstonia pickettii (strain 12J) GN=hisA PE=3 SV=1 10 221 7.0E-08
sp|Q50757|HIS4_METTL 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanothermococcus thermolithotrophicus GN=hisA PE=3 SV=1 7 220 9.0E-08
sp|A2BQT3|HIS4_PROMS 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Prochlorococcus marinus (strain AS9601) GN=hisA PE=3 SV=1 10 239 1.0E-07
sp|A5FYE4|HIS4_ACICJ 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Acidiphilium cryptum (strain JF-5) GN=hisA PE=3 SV=1 10 220 1.0E-07
sp|Q0BPX3|HIS4_GRABC 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=hisA PE=3 SV=1 10 231 2.0E-07
sp|A3M9P1|HIS6_ACIBT Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hisF PE=3 SV=2 84 243 2.0E-07
sp|B2I0P3|HIS6_ACIBC Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain ACICU) GN=hisF PE=3 SV=1 84 243 2.0E-07
sp|B7IBD7|HIS6_ACIB5 Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain AB0057) GN=hisF PE=3 SV=1 84 243 2.0E-07
sp|B7GVJ5|HIS6_ACIB3 Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baumannii (strain AB307-0294) GN=hisF PE=3 SV=1 84 243 2.0E-07
sp|Q11CK8|HIS4_CHESB 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Chelativorans sp. (strain BNC1) GN=hisA PE=3 SV=2 7 221 2.0E-07
sp|B3R794|HIS6_CUPTR Imidazole glycerol phosphate synthase subunit HisF OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=hisF PE=3 SV=1 10 243 2.0E-07
sp|Q1QRX1|HIS4_NITHX 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisA PE=3 SV=1 7 220 3.0E-07
sp|A6QBN6|HIS4_SULNB 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Sulfurovum sp. (strain NBC37-1) GN=hisA PE=3 SV=1 10 221 3.0E-07
sp|Q98CT3|HIS4_RHILO 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Rhizobium loti (strain MAFF303099) GN=hisA PE=3 SV=1 7 220 3.0E-07
sp|O26931|HIS4_METTH 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisA PE=3 SV=2 10 239 3.0E-07
sp|A5VX75|HIS4_PSEP1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hisA PE=3 SV=1 10 246 3.0E-07
sp|Q88R42|HIS4_PSEPK 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Pseudomonas putida (strain KT2440) GN=hisA PE=3 SV=1 10 246 4.0E-07
sp|A8AAK3|HIS6_IGNH4 Imidazole glycerol phosphate synthase subunit HisF OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=hisF PE=3 SV=1 10 243 4.0E-07
sp|Q21NH6|HIS4_SACD2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=hisA PE=3 SV=1 7 220 4.0E-07
sp|B0T799|HIS4_CAUSK 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Caulobacter sp. (strain K31) GN=hisA PE=3 SV=1 7 221 4.0E-07
sp|Q8TYD6|HIS4_METKA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisA PE=3 SV=1 7 220 4.0E-07
sp|A4SFU1|HIS6_CHLPM Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hisF PE=3 SV=1 84 242 5.0E-07
sp|B8D116|HIS6_HALOH Imidazole glycerol phosphate synthase subunit HisF OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=hisF PE=3 SV=1 84 214 5.0E-07
sp|A6VTA6|HIS6_MARMS Imidazole glycerol phosphate synthase subunit HisF OS=Marinomonas sp. (strain MWYL1) GN=hisF PE=3 SV=1 10 243 5.0E-07
sp|B0KI44|HIS4_PSEPG 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Pseudomonas putida (strain GB-1) GN=hisA PE=3 SV=1 10 246 5.0E-07
sp|C3MBC2|HIS4_RHISN 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Rhizobium sp. (strain NGR234) GN=hisA PE=3 SV=1 7 220 5.0E-07
sp|Q7W2X9|HIS6_BORPA Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisF PE=3 SV=1 10 243 6.0E-07
sp|Q9S4H7|HIS6_LEPIR Putative imidazole glycerol phosphate synthase subunit HisF OS=Leptospira interrogans GN=hisF PE=3 SV=1 84 237 6.0E-07
sp|A6VJ52|HIS4_METM7 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisA PE=3 SV=1 10 220 6.0E-07
sp|Q5NMD6|HIS6_ZYMMO Imidazole glycerol phosphate synthase subunit HisF OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisF PE=3 SV=1 10 243 7.0E-07
sp|C0QPQ6|HIS6_PERMH Imidazole glycerol phosphate synthase subunit HisF OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=hisF PE=3 SV=1 10 242 8.0E-07
sp|B1JED2|HIS4_PSEPW 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Pseudomonas putida (strain W619) GN=hisA PE=3 SV=1 10 246 8.0E-07
sp|A6Q4V9|HIS4_NITSB 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Nitratiruptor sp. (strain SB155-2) GN=hisA PE=3 SV=1 10 220 9.0E-07
sp|B1YL09|HIS6_EXIS2 Imidazole glycerol phosphate synthase subunit HisF OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=hisF PE=3 SV=1 84 220 1.0E-06
sp|B4U7M4|HIS6_HYDS0 Imidazole glycerol phosphate synthase subunit HisF OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=hisF PE=3 SV=1 10 214 1.0E-06
sp|A6UWA5|HIS4_META3 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisA PE=3 SV=1 7 220 1.0E-06
sp|Q12FC8|HIS4_POLSJ 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=hisA PE=3 SV=1 10 246 1.0E-06
sp|A7I416|HIS6_CAMHC Imidazole glycerol phosphate synthase subunit HisF OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=hisF PE=3 SV=1 10 214 2.0E-06
sp|Q28NK3|HIS4_JANSC 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Jannaschia sp. (strain CCS1) GN=hisA PE=3 SV=1 7 220 2.0E-06
sp|Q9RPQ4|HIS6_THEP3 Imidazole glycerol phosphate synthase subunit HisF OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisF PE=3 SV=1 10 239 2.0E-06
sp|A4G9I6|HIS6_HERAR Imidazole glycerol phosphate synthase subunit HisF OS=Herminiimonas arsenicoxydans GN=hisF PE=3 SV=1 10 243 2.0E-06
sp|Q6F799|HIS6_ACIAD Imidazole glycerol phosphate synthase subunit HisF OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisF PE=3 SV=2 84 243 2.0E-06
sp|A6QCU4|HIS6_SULNB Imidazole glycerol phosphate synthase subunit HisF OS=Sulfurovum sp. (strain NBC37-1) GN=hisF PE=3 SV=1 10 255 2.0E-06
sp|Q1IWD2|HIS4_DEIGD 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Deinococcus geothermalis (strain DSM 11300) GN=hisA PE=3 SV=1 2 223 2.0E-06
sp|B5EQF2|HIS6_ACIF5 Imidazole glycerol phosphate synthase subunit HisF OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=hisF PE=3 SV=1 84 243 2.0E-06
sp|B7JA19|HIS6_ACIF2 Imidazole glycerol phosphate synthase subunit HisF OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=hisF PE=3 SV=1 84 243 2.0E-06
sp|Q0BIW5|HIS4_BURCM 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hisA PE=3 SV=1 10 221 2.0E-06
sp|B1YRW0|HIS4_BURA4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Burkholderia ambifaria (strain MC40-6) GN=hisA PE=3 SV=1 10 221 2.0E-06
sp|A7ZES8|HIS4_CAMC1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Campylobacter concisus (strain 13826) GN=hisA PE=3 SV=1 10 220 2.0E-06
sp|Q3ZY29|HIS6_DEHMC Imidazole glycerol phosphate synthase subunit HisF OS=Dehalococcoides mccartyi (strain CBDB1) GN=hisF PE=3 SV=1 10 243 2.0E-06
sp|A5FFX6|HIS6_FLAJ1 Imidazole glycerol phosphate synthase subunit HisF OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=hisF PE=3 SV=1 84 239 2.0E-06
sp|A5G8T0|HIS4_GEOUR 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Geobacter uraniireducens (strain Rf4) GN=hisA PE=3 SV=1 7 256 3.0E-06
sp|A2SE08|HIS4_METPP 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methylibium petroleiphilum (strain PM1) GN=hisA PE=3 SV=1 10 221 3.0E-06
sp|C3K6V2|HIS4_PSEFS 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Pseudomonas fluorescens (strain SBW25) GN=hisA PE=3 SV=1 10 246 3.0E-06
sp|Q7MPK7|HIS63_VIBVY Putative imidazole glycerol phosphate synthase subunit hisF3 OS=Vibrio vulnificus (strain YJ016) GN=hisF3 PE=3 SV=1 84 220 3.0E-06
sp|Q2FN18|HIS4_METHJ 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=hisA PE=3 SV=1 85 239 3.0E-06
sp|A8ES24|HIS4_ARCB4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Arcobacter butzleri (strain RM4018) GN=hisA PE=3 SV=1 10 220 3.0E-06
sp|A6UEK4|HIS4_SINMW 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Sinorhizobium medicae (strain WSM419) GN=hisA PE=3 SV=1 7 220 3.0E-06
sp|Q7VSY6|HIS6_BORPE Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisF PE=3 SV=1 10 243 3.0E-06
sp|Q7WDX9|HIS6_BORBR Imidazole glycerol phosphate synthase subunit HisF OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisF PE=3 SV=1 10 243 3.0E-06
sp|Q89WM4|HIS6_BRADU Imidazole glycerol phosphate synthase subunit HisF OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisF PE=3 SV=1 84 243 3.0E-06
sp|A7I773|HIS4_METB6 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Methanoregula boonei (strain 6A8) GN=hisA PE=3 SV=1 10 239 3.0E-06
sp|Q3SEU8|HIS6_THIDA Imidazole glycerol phosphate synthase subunit HisF OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisF PE=3 SV=1 10 243 3.0E-06
sp|A8FHQ9|HIS6_BACP2 Imidazole glycerol phosphate synthase subunit HisF OS=Bacillus pumilus (strain SAFR-032) GN=hisF PE=3 SV=1 10 239 4.0E-06
sp|Q0VM71|HIS4_ALCBS 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hisA PE=3 SV=2 10 220 4.0E-06
sp|C5CQJ5|HIS4_VARPS 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Variovorax paradoxus (strain S110) GN=hisA PE=3 SV=1 10 221 4.0E-06
sp|Q8FY08|HIS4_BRUSU 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Brucella suis biovar 1 (strain 1330) GN=hisA PE=3 SV=1 7 220 5.0E-06
sp|A4JAW8|HIS4_BURVG 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hisA PE=3 SV=1 10 221 5.0E-06
sp|B4E640|HIS4_BURCJ 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hisA PE=3 SV=1 10 221 6.0E-06
sp|B1JUA4|HIS4_BURCC 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Burkholderia cenocepacia (strain MC0-3) GN=hisA PE=3 SV=1 10 221 6.0E-06
sp|Q1BS30|HIS4_BURCA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Burkholderia cenocepacia (strain AU 1054) GN=hisA PE=3 SV=1 10 221 6.0E-06
sp|Q3ATG0|HIS6_CHLCH Imidazole glycerol phosphate synthase subunit HisF OS=Chlorobium chlorochromatii (strain CaD3) GN=hisF PE=3 SV=1 84 242 6.0E-06
sp|Q3KJI6|HIS4_PSEPF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisA PE=3 SV=1 10 246 6.0E-06
sp|P59119|HIS6_LEPIN Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisF PE=3 SV=1 10 243 6.0E-06
sp|P62451|HIS6_LEPIC Imidazole glycerol phosphate synthase subunit HisF OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisF PE=3 SV=1 10 243 6.0E-06
sp|Q3SWF0|HIS4_NITWN 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisA PE=3 SV=1 7 220 7.0E-06
sp|A6T376|HIS6_JANMA Imidazole glycerol phosphate synthase subunit HisF OS=Janthinobacterium sp. (strain Marseille) GN=hisF PE=3 SV=1 10 272 7.0E-06
sp|Q4ZLQ1|HIS4_PSEU2 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisA PE=3 SV=1 10 246 7.0E-06
sp|B0JY78|HIS6_MICAN Imidazole glycerol phosphate synthase subunit HisF OS=Microcystis aeruginosa (strain NIES-843) GN=hisF PE=3 SV=1 10 230 7.0E-06
sp|Q07UQ9|HIS6_RHOP5 Imidazole glycerol phosphate synthase subunit HisF OS=Rhodopseudomonas palustris (strain BisA53) GN=hisF PE=3 SV=1 84 243 7.0E-06
sp|Q0AW41|HIS6_SYNWW Imidazole glycerol phosphate synthase subunit HisF OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=hisF PE=3 SV=1 10 242 7.0E-06
sp|P62355|HIS4_PHOPR 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Photobacterium profundum GN=hisA PE=3 SV=1 10 220 7.0E-06
sp|Q1D4M4|HIS6_MYXXD Imidazole glycerol phosphate synthase subunit HisF OS=Myxococcus xanthus (strain DK 1622) GN=hisF PE=3 SV=1 84 214 7.0E-06
sp|B3PGA4|HIS6_CELJU Imidazole glycerol phosphate synthase subunit HisF OS=Cellvibrio japonicus (strain Ueda107) GN=hisF PE=3 SV=1 84 242 8.0E-06
sp|Q30PY1|HIS4_SULDN 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hisA PE=3 SV=1 10 221 8.0E-06
sp|Q31E64|HIS6_THICR Imidazole glycerol phosphate synthase subunit HisF OS=Thiomicrospira crunogena (strain XCL-2) GN=hisF PE=3 SV=1 84 243 8.0E-06
sp|Q845U8|HIS4_BURM1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisA PE=3 SV=1 10 221 8.0E-06
sp|Q47AM3|HIS6_DECAR Imidazole glycerol phosphate synthase subunit HisF OS=Dechloromonas aromatica (strain RCB) GN=hisF PE=3 SV=1 10 243 1.0E-05
sp|Q4KJS5|HIS4_PSEF5 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisA PE=3 SV=2 10 246 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0000105 histidine biosynthetic process Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0044281 small molecule metabolic process No
GO:0019538 protein metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0005575 cellular_component No
GO:0006520 cellular amino acid metabolic process No
GO:0009058 biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0006547 histidine metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0044237 cellular metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0009987 cellular process No
GO:0006082 organic acid metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005198 structural molecule activity No
GO:0043170 macromolecule metabolic process No
GO:0043226 organelle No
GO:0006518 peptide metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072850
MQRRHSVFRPCIDLHDGQVKQIVGGTLSDKKPEELKTNFTTSRRPAEFARMYEERKLWGGHVIKLGPGNDDAAKE
ALAAWPGGLQIGGGITEQNAKEWIEAGASKVIITSYLFPNAKFALERLKAVSTAVGKDRLVVDVSCRRRDDKWMV
AMNRWQDITDMEVTKESLDLLAEYCSEILIHAADVEGLCQGIDEDLVQKLGEWTTIPTTYAGGAKDISDLDLVDK
LSKGRVDLTYGSSLDIFGGTLVKFEELVHHTISPSPSQESTQYDAPQDTLKMPGKVKAYELQSKSKTDLLKQLQE
LKQELLTLRVQKIAGGSAAKLTKIATVRKSIARVLTVINQKARQNLREYYKDKKYKPLDLRPKKTRAIRRRLTKN
EQSLKTLKQKKKDQNFPRRKYAVKA*
Coding >AgabiH97|072850
ATGCAGCGACGCCATAGCGTTTTTCGTCCATGTATCGATTTACACGACGGACAAGTAAAACAGATTGTCGGTGGA
ACCTTATCGGATAAGAAACCAGAAGAATTAAAAACCAATTTCACTACAAGTCGGAGACCTGCTGAATTTGCAAGA
ATGTACGAGGAAAGAAAGCTTTGGGGTGGGCATGTTATCAAACTTGGACCGGGCAATGATGATGCTGCGAAAGAG
GCTCTTGCTGCTTGGCCTGGTGGGCTGCAAATTGGTGGTGGAATAACTGAACAGAATGCGAAGGAGTGGATAGAG
GCTGGAGCGAGCAAGGTTATTATCACATCATACCTCTTTCCCAATGCCAAATTTGCTTTGGAACGCCTCAAGGCC
GTCTCGACAGCCGTTGGAAAAGATAGACTTGTCGTTGATGTGAGTTGTAGGAGGAGAGACGATAAATGGATGGTT
GCCATGAATAGGTGGCAGGATATCACCGACATGGAAGTAACAAAAGAATCATTGGATTTACTTGCAGAATATTGC
AGTGAAATTTTGATTCATGCGGCTGATGTGGAAGGGTTGTGTCAAGGTATTGACGAGGATCTCGTTCAAAAGCTC
GGCGAATGGACTACGATTCCGACGACATATGCTGGCGGGGCGAAAGATATCAGCGACTTGGACCTGGTCGACAAG
CTCTCCAAAGGACGTGTTGACTTGACGTATGGAAGTTCGTTGGATATTTTTGGTGGCACTTTGGTAAAGTTTGAG
GAACTGGTTCACCACACAATCTCTCCATCGCCAAGTCAGGAATCGACCCAATACGACGCTCCTCAAGACACCCTC
AAAATGCCCGGCAAAGTCAAGGCCTACGAGCTCCAATCCAAGTCAAAGACCGACTTGCTCAAACAGCTCCAGGAG
CTCAAACAAGAGCTGCTAACTTTACGGGTGCAGAAAATTGCCGGTGGATCTGCTGCTAAGCTTACTAAAATCGCA
ACTGTTCGCAAATCGATTGCACGGGTTTTGACTGTCATCAACCAAAAGGCCCGCCAGAACTTGCGTGAATACTAC
AAGGACAAGAAGTACAAGCCTCTTGACCTGCGACCCAAGAAAACACGGGCGATCAGACGGCGTCTGACAAAGAAC
GAGCAGTCTCTGAAGACGTTGAAGCAAAAGAAGAAAGACCAAAACTTCCCGAGGAGGAAGTATGCTGTGAAGGCG
TGA
Transcript >AgabiH97|072850
ATGCAGCGACGCCATAGCGTTTTTCGTCCATGTATCGATTTACACGACGGACAAGTAAAACAGATTGTCGGTGGA
ACCTTATCGGATAAGAAACCAGAAGAATTAAAAACCAATTTCACTACAAGTCGGAGACCTGCTGAATTTGCAAGA
ATGTACGAGGAAAGAAAGCTTTGGGGTGGGCATGTTATCAAACTTGGACCGGGCAATGATGATGCTGCGAAAGAG
GCTCTTGCTGCTTGGCCTGGTGGGCTGCAAATTGGTGGTGGAATAACTGAACAGAATGCGAAGGAGTGGATAGAG
GCTGGAGCGAGCAAGGTTATTATCACATCATACCTCTTTCCCAATGCCAAATTTGCTTTGGAACGCCTCAAGGCC
GTCTCGACAGCCGTTGGAAAAGATAGACTTGTCGTTGATGTGAGTTGTAGGAGGAGAGACGATAAATGGATGGTT
GCCATGAATAGGTGGCAGGATATCACCGACATGGAAGTAACAAAAGAATCATTGGATTTACTTGCAGAATATTGC
AGTGAAATTTTGATTCATGCGGCTGATGTGGAAGGGTTGTGTCAAGGTATTGACGAGGATCTCGTTCAAAAGCTC
GGCGAATGGACTACGATTCCGACGACATATGCTGGCGGGGCGAAAGATATCAGCGACTTGGACCTGGTCGACAAG
CTCTCCAAAGGACGTGTTGACTTGACGTATGGAAGTTCGTTGGATATTTTTGGTGGCACTTTGGTAAAGTTTGAG
GAACTGGTTCACCACACAATCTCTCCATCGCCAAGTCAGGAATCGACCCAATACGACGCTCCTCAAGACACCCTC
AAAATGCCCGGCAAAGTCAAGGCCTACGAGCTCCAATCCAAGTCAAAGACCGACTTGCTCAAACAGCTCCAGGAG
CTCAAACAAGAGCTGCTAACTTTACGGGTGCAGAAAATTGCCGGTGGATCTGCTGCTAAGCTTACTAAAATCGCA
ACTGTTCGCAAATCGATTGCACGGGTTTTGACTGTCATCAACCAAAAGGCCCGCCAGAACTTGCGTGAATACTAC
AAGGACAAGAAGTACAAGCCTCTTGACCTGCGACCCAAGAAAACACGGGCGATCAGACGGCGTCTGACAAAGAAC
GAGCAGTCTCTGAAGACGTTGAAGCAAAAGAAGAAAGACCAAAACTTCCCGAGGAGGAAGTATGCTGTGAAGGCG
TGA
Gene >AgabiH97|072850
ATGCAGCGACGCCATAGCGTTTTTCGTCCATGTATCGATTTACACGACGGACAAGTAAAACAGATTGTCGGTGGA
ACCTTATCGGATAAGAAACCAGAAGAATTAAAAACCAATTTCACTACAAGGCAAGCCTGGAGTTTAAATAAATCG
AATTGTCTTTTTGAACGAGAAAGGCCATATATTATTATAGTCGGAGACCTGCTGAATTTGCAAGAATGTACGAGG
AAAGAAAGCTTTGGGGTGGGCATGTTATCAAACTTGGACCGGGCAATGATGATGCTGCGAAAGAGGCTCTTGCTG
CTTGGCCTGGTAATATATATTGTGGCTATTCATTTCCCGTTGTTGATAATCGTGGATTGATTGACAGGTGGGCTG
CAAATTGGTGGTGGAATAACTGAACAGAATGCGAAGGAGTGGATAGAGGCTGGAGCGAGCAAGGCATATATCATT
TATTCTTTCTGTCTACTGGCGTTCCCGTGGGCTGAGACTGAACACCAGGTTATTATCACATCATACCTCTTTCCC
AATGCCAAATTTGCTTTGGAACGCCTCAAGGCCGTCTCGACAGCCGTTGGAAAAGATAGACTTGTCGTTGATGTG
AGGTAAGTAATTGCAGGGTCATCAAGAACCGATTTAATTCATTGATCAATAACAGTTGTAGGAGGAGAGACGATA
AATGGATGGTTGCCATGAATAGGTGGCAGGATATCACCGACATGGAAGTAACAAAAGGTGGGTATCTGTCGAGAG
AGAAGCGCTTTTCGAGGTCCTATTGACATCGTTATTTATCAGAATCATTGGATTTACTTGCAGAATATTGCAGGC
ACGTTGATCGAAACACCATTTAGGAGCCGGCTCTTAGGAATGACTAGTGAAATTTTGATTCATGCGGCTGATGTG
GAAGGGTTGTGTCAAGGTATTGACGAGGATCTCGTTCAAAGTAGGATCGGATGGAAGCGATTTCGAGTATTTTTA
GTGCTAATGTGATATTACAGAGCTCGGCGAATGGACTACGATTCCGACGACATATGCTGGCGGGGCGAAAGGTAA
GTGGTATTTTGAATTCATTTCTAGTCATCTTCTATACATCGGCACCGTAGATATCAGCGACTTGGACCTGGTCGA
CAAGCTCTCCAAAGGACGTGTTGACTTGACGTATGGAAGGTGGGTGTTTTTGAGCTTTTGCAGTCACGGCACTCA
TCAAGAGTTAGTTCGTTGGATATTTTTGGTGGCACTTTGGTAAAGTTTGAGGAACTGGTACGACGGAGCAATAGG
CAGGAGTAATTAGCAGTAGTAAAGAGCGGTGTATTAGTCAAGCGTGGGAATGACTTTACAGTTCTGCGAATTAAG
GTTCACCACACAATCTCTCCATCGCCAAGTCAGGAATCGACCCAATACGACGCTCCTCAAGGTGAGTAAACTATG
CCAGTTCACTTCACGATGGCCAGCACGGGATCTAGTGTTCGACAACTCTGTTCATTTGCGAATTGTCCGATTTCG
AGCGGCCGCGCGGTCATCGTGCAGCATTATCAGGACTATGAACACGTTATTAATCATTGTACTCGATAGACACCC
TCAAAATGCCCGGCAAAGTCAAGGCCTACGAGCTCCAATCCAAGTGCGCCATTTAACCATGTGCGCTGCGCAGTG
ACTCTAAACTTTGGTTATTAGGTCAAAGACCGACTTGCTCAAACAGCTCCAGGAGCTCAAACAAGAGCTGCTAAC
TTTACGGGTGCAGAAAATTGCCGGTGGATCTGCTGCTAAGCTTACTAAAATGTACGTCGTGTATTCTGGTGAGTC
TACAATTCAGGCTTATGGTTACTTTGGAAACACAGCGCAACTGTTCGCAAATCGATTGCACGGGTTTTGACTGTC
ATCAACCAAAAGGCCCGCCAGAACTTGCGTGAATACTACAAGGACAAGAAGTACAAGCCTCTTGACCTGCGACCC
AAGAAAACACGGGCGATCAGACGGCGTCTGACAAAGGTGGGCTTATCTCTCTTGATGAATGATAGTTGGGGTGCT
GATAATGAGTAGAACGAGCAGTCTCTGAAGACGTTGAAGCAAAAGAAGAAAGACCAAAACTTCCCGAGGAGGAAG
TATGCTGTGAAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail