Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072750
Gene name
Locationscaffold_4:1790820..1796579
Strand+
Gene length (bp)5759
Transcript length (bp)4329
Coding sequence length (bp)4329
Protein length (aa) 1443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02257 RFX_DNA_binding RFX DNA-binding domain 2.7E-27 772 848
PF00149 Metallophos Calcineurin-like phosphoesterase 1.4E-09 47 308

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPN1 PE=3 SV=1 18 531 2.0E-123
sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppn1 PE=3 SV=1 42 391 2.0E-81
sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPN1 PE=3 SV=1 42 391 2.0E-77
sp|Q756F2|PPN1_ASHGO Endopolyphosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPN1 PE=3 SV=2 44 485 1.0E-76
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPN1 PE=3 SV=3 44 314 7.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPN1 PE=3 SV=1 18 531 2.0E-123
sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppn1 PE=3 SV=1 42 391 2.0E-81
sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPN1 PE=3 SV=1 42 391 2.0E-77
sp|Q756F2|PPN1_ASHGO Endopolyphosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPN1 PE=3 SV=2 44 485 1.0E-76
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPN1 PE=3 SV=3 44 314 7.0E-74
sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=epp-1 PE=3 SV=3 7 392 1.0E-73
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPN1 PE=3 SV=1 42 394 1.0E-71
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPN1 PE=1 SV=1 24 314 3.0E-70
sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPN1 PE=3 SV=1 13 391 3.0E-69
sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium discoideum GN=sgmC PE=3 SV=1 34 396 1.0E-29
sp|P48379|RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus GN=Rfx2 PE=1 SV=2 998 1308 1.0E-28
sp|B2GV50|RFX2_RAT DNA-binding protein RFX2 OS=Rattus norvegicus GN=Rfx2 PE=1 SV=1 998 1308 9.0E-28
sp|Q92484|ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a OS=Homo sapiens GN=SMPDL3A PE=1 SV=2 46 312 9.0E-28
sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens GN=SMPDL3B PE=2 SV=2 46 351 1.0E-27
sp|A0JMF8|RFX3_DANRE Transcription factor RFX3 OS=Danio rerio GN=rfx3 PE=2 SV=1 996 1308 3.0E-27
sp|Q3ZC91|ASM3A_BOVIN Acid sphingomyelinase-like phosphodiesterase 3a OS=Bos taurus GN=SMPDL3A PE=2 SV=1 38 312 4.0E-27
sp|P70158|ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a OS=Mus musculus GN=Smpdl3a PE=1 SV=2 46 312 2.0E-26
sp|Q0V9K5|RFX3_XENTR Transcription factor RFX3 OS=Xenopus tropicalis GN=rfx3 PE=2 SV=2 965 1301 4.0E-26
sp|Q641Z7|ASM3A_RAT Acid sphingomyelinase-like phosphodiesterase 3a OS=Rattus norvegicus GN=Smpdl3a PE=2 SV=1 34 312 5.0E-26
sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium discoideum GN=sgmB PE=3 SV=1 47 315 6.0E-26
sp|Q5EAP5|RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio GN=rfx2 PE=2 SV=1 998 1308 6.0E-26
sp|Q5RDR2|RFX2_PONAB DNA-binding protein RFX2 OS=Pongo abelii GN=RFX2 PE=2 SV=1 998 1308 1.0E-25
sp|Q4R3Z4|RFX2_MACFA DNA-binding protein RFX2 OS=Macaca fascicularis GN=RFX2 PE=2 SV=1 998 1308 2.0E-25
sp|Q32NR3|RFX2_XENLA DNA-binding protein RFX2 OS=Xenopus laevis GN=rfx2 PE=2 SV=1 964 1308 2.0E-25
sp|P48378|RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens GN=RFX2 PE=2 SV=2 998 1308 3.0E-25
sp|A6QLW9|RFX2_BOVIN DNA-binding protein RFX2 OS=Bos taurus GN=RFX2 PE=2 SV=1 998 1308 4.0E-25
sp|Q59V88|RFX1_CANAL Transcriptional regulator RFX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFX1 PE=2 SV=1 738 1290 5.0E-25
sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b OS=Mus musculus GN=Smpdl3b PE=1 SV=1 46 314 5.0E-25
sp|Q4R3I8|RFX3_MACFA Transcription factor RFX3 OS=Macaca fascicularis GN=RFX3 PE=2 SV=1 996 1308 7.0E-25
sp|P48380|RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens GN=RFX3 PE=1 SV=2 996 1308 9.0E-25
sp|B1WAV2|RFX2_XENTR DNA-binding protein RFX2 OS=Xenopus tropicalis GN=rfx2 PE=2 SV=1 951 1308 2.0E-24
sp|P22670|RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens GN=RFX1 PE=1 SV=2 996 1289 2.0E-24
sp|P48381|RFX3_MOUSE Transcription factor RFX3 OS=Mus musculus GN=Rfx3 PE=1 SV=2 996 1308 2.0E-24
sp|P48377|RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus GN=Rfx1 PE=1 SV=2 996 1289 5.0E-24
sp|Q33E94|RFX4_HUMAN Transcription factor RFX4 OS=Homo sapiens GN=RFX4 PE=1 SV=2 1027 1289 8.0E-23
sp|Q7TNK1|RFX4_MOUSE Transcription factor RFX4 OS=Mus musculus GN=Rfx4 PE=1 SV=1 1027 1289 1.0E-22
sp|A2BGA0|RFX4_DANRE Transcription factor RFX4 OS=Danio rerio GN=rfx4 PE=2 SV=1 1027 1289 9.0E-22
sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium discoideum GN=sgmA PE=3 SV=1 46 326 1.0E-19
sp|P48383|SAK1_SCHPO Protein sak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sak1 PE=1 SV=2 740 847 1.0E-19
sp|Q5RJA1|RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio GN=rfx6 PE=2 SV=2 998 1293 4.0E-19
sp|D2HNW6|RFX6_AILME DNA-binding protein RFX6 OS=Ailuropoda melanoleuca GN=RFX6 PE=3 SV=2 998 1291 5.0E-19
sp|Q8HWS3|RFX6_HUMAN DNA-binding protein RFX6 OS=Homo sapiens GN=RFX6 PE=1 SV=2 998 1291 1.0E-18
sp|Q8C7R7|RFX6_MOUSE DNA-binding protein RFX6 OS=Mus musculus GN=Rfx6 PE=1 SV=2 998 1291 2.0E-18
sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis elegans GN=asm-1 PE=1 SV=2 17 319 3.0E-17
sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens GN=SMPD1 PE=1 SV=4 47 322 4.0E-17
sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis elegans GN=asm-2 PE=1 SV=3 83 321 3.0E-16
sp|Q09555|DAF19_CAEEL RFX-like transcription factor daf-19 OS=Caenorhabditis elegans GN=daf-19 PE=2 SV=3 953 1289 4.0E-16
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus GN=SMPD1 PE=2 SV=1 47 322 1.0E-15
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus GN=Smpd1 PE=2 SV=2 47 317 8.0E-15
sp|P48743|RFX1_YEAST RFX-like DNA-binding protein RFX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFX1 PE=1 SV=2 768 873 8.0E-15
sp|P48378|RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens GN=RFX2 PE=2 SV=2 778 847 3.0E-12
sp|Q0V9K5|RFX3_XENTR Transcription factor RFX3 OS=Xenopus tropicalis GN=rfx3 PE=2 SV=2 778 862 3.0E-12
sp|Q4R3Z4|RFX2_MACFA DNA-binding protein RFX2 OS=Macaca fascicularis GN=RFX2 PE=2 SV=1 778 847 3.0E-12
sp|P48379|RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus GN=Rfx2 PE=1 SV=2 778 847 3.0E-12
sp|P48380|RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens GN=RFX3 PE=1 SV=2 778 862 3.0E-12
sp|P48381|RFX3_MOUSE Transcription factor RFX3 OS=Mus musculus GN=Rfx3 PE=1 SV=2 778 862 3.0E-12
sp|Q4R3I8|RFX3_MACFA Transcription factor RFX3 OS=Macaca fascicularis GN=RFX3 PE=2 SV=1 778 862 4.0E-12
sp|Q5RDR2|RFX2_PONAB DNA-binding protein RFX2 OS=Pongo abelii GN=RFX2 PE=2 SV=1 778 847 4.0E-12
sp|B2GV50|RFX2_RAT DNA-binding protein RFX2 OS=Rattus norvegicus GN=Rfx2 PE=1 SV=1 778 847 4.0E-12
sp|A0JMF8|RFX3_DANRE Transcription factor RFX3 OS=Danio rerio GN=rfx3 PE=2 SV=1 778 862 4.0E-12
sp|Q09555|DAF19_CAEEL RFX-like transcription factor daf-19 OS=Caenorhabditis elegans GN=daf-19 PE=2 SV=3 778 847 4.0E-12
sp|A6QLW9|RFX2_BOVIN DNA-binding protein RFX2 OS=Bos taurus GN=RFX2 PE=2 SV=1 778 847 4.0E-12
sp|Q5EAP5|RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio GN=rfx2 PE=2 SV=1 778 847 5.0E-12
sp|B1WAV2|RFX2_XENTR DNA-binding protein RFX2 OS=Xenopus tropicalis GN=rfx2 PE=2 SV=1 778 847 5.0E-12
sp|Q32NR3|RFX2_XENLA DNA-binding protein RFX2 OS=Xenopus laevis GN=rfx2 PE=2 SV=1 778 847 5.0E-12
sp|Q2KHR2|RFX7_HUMAN DNA-binding protein RFX7 OS=Homo sapiens GN=RFX7 PE=1 SV=1 766 847 6.0E-12
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm-3 OS=Caenorhabditis elegans GN=asm-3 PE=3 SV=2 47 317 6.0E-12
sp|P22670|RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens GN=RFX1 PE=1 SV=2 760 847 3.0E-11
sp|P48377|RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus GN=Rfx1 PE=1 SV=2 760 847 3.0E-11
sp|Q6ZV50|RFX8_HUMAN DNA-binding protein RFX8 OS=Homo sapiens GN=RFX8 PE=2 SV=2 754 846 4.0E-11
sp|A2BGA0|RFX4_DANRE Transcription factor RFX4 OS=Danio rerio GN=rfx4 PE=2 SV=1 778 846 2.0E-10
sp|Q7TNK1|RFX4_MOUSE Transcription factor RFX4 OS=Mus musculus GN=Rfx4 PE=1 SV=1 778 846 2.0E-10
sp|Q33E94|RFX4_HUMAN Transcription factor RFX4 OS=Homo sapiens GN=RFX4 PE=1 SV=2 778 846 2.0E-10
sp|P48383|SAK1_SCHPO Protein sak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sak1 PE=1 SV=2 1019 1290 3.0E-10
sp|D3YU81|RFX8_MOUSE DNA-binding protein RFX8 OS=Mus musculus GN=Rfx8 PE=3 SV=1 778 846 3.0E-10
sp|P48382|RFX5_HUMAN DNA-binding protein RFX5 OS=Homo sapiens GN=RFX5 PE=1 SV=1 773 850 1.0E-09
sp|Q9JL61|RFX5_MOUSE DNA-binding protein Rfx5 OS=Mus musculus GN=Rfx5 PE=1 SV=2 773 850 2.0E-09
sp|D2HNW6|RFX6_AILME DNA-binding protein RFX6 OS=Ailuropoda melanoleuca GN=RFX6 PE=3 SV=2 759 881 3.0E-09
sp|Q8C7R7|RFX6_MOUSE DNA-binding protein RFX6 OS=Mus musculus GN=Rfx6 PE=1 SV=2 759 846 4.0E-09
sp|Q8HWS3|RFX6_HUMAN DNA-binding protein RFX6 OS=Homo sapiens GN=RFX6 PE=1 SV=2 759 881 4.0E-09
sp|Q5RJA1|RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio GN=rfx6 PE=2 SV=2 768 881 9.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:2001141 regulation of RNA biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0019222 regulation of metabolic process No
GO:0003824 catalytic activity No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0060255 regulation of macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
RFX DNA-binding domain

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072750
MIKVPLCALVVFLTTQVLASPAQTPLRDIVSENVTATPAAPRKLHGRFLHITDMHPDPHYSFHASTSKSCHGKKA
KKKKRKRAGYWGTPDVECDSPLRLIDLTLDYLDKNWADEIDFVVWTGDNARHDEDHHIPRTLDEILDQNKRMAMK
MEKIFSKKGIPVVPSLGNNDIWPHNILAPGPNKITNEFASLWSSFIPFPQRQVFQRGAYYSTEVIPGHLAVISLN
TLYFYDSNKAVGGCQYGDDDDPGNLEFDWLEVQLKQFRDKNIQVYLTGHIPPSLGNYYPECYVRYTEMSLRFQDT
ILGHLYGHMNLDYFSFMEEIDLEIIPGEEEEGPRAKGGRNGLYETLLREFEQLPEESEEEKLDGLAVINVAPSVV
PNPFVPAFRIFSYNVSGDGLMGARKQREHGHRRGRKGNKDDVCKDKRYDKSWKCHLQKSWHTDRDAPSRRNQALT
PLGYAQYYMPDIATANKTQPPRYELEYVTYPVSALGSGDWEPVPVRHLPRALREGRKGKRYAPYGLRDLTVGSWV
GLGRRLGQGAEKRDVVVVLTMENAYTYRVGFDCAVVEASAERQTSRAPPPAAVLPVSPILGWSDPPTILSQHDMT
AVNMHMPLDFLPHHSRSNSLSSASTHSRPHSSQGSIPRMQAAGTDDLYRPPYHLHPPPLHPDPSSSIHNTALKGP
LRPTHNRVRASPYPRDTDSVHSSSSEAEDISMYLGHHHTPEYQPLYGAPHTMAPSPETMHAANAFGRMAISQDHA
LEKLAANVRAATTTSASDRAKQIFVQAWLTANYAPYPDGNVPRQGLYFSYRRVCDQYGIPHINTATLGKAIRLCF
PTIKTRRLGVRGNSKYHYCGIRPATTAEAEFLQDYIQKSNNNAGQSSINAARLANEQADNTHRTNEDGSGDDDDD
DSEGNHSTAGSKRSSLVLSNELKTVVYADDLSDKTPTAATLLSHAQAQRPGTFPSQASIRRHPGQEPLLGPHSAH
PSQTIGSASAFISGQTALSVRQFPHFPSIDEAVGAGSTSTHGIAGREVWNWFQDHLDALLDSMRTFRFDQFEMHL
RSFWSNLAGNHREVVHAPAIAGLMAKADAIVYDEILEILRSQMLSPIPAASLTSLRQLALKMEKILLASLDGYGN
TFVEPKVELGARFGHLILRFLDIYQVTQALNTVLTNPKQLADMRRSWEKVDFESVRNQSALVCNCRHEELVQLLE
VEFVALLDSLTKTSEPVREVMAWADKCCDRLMGSSRVHSTPEERGGMSSRSVLIRWGYVTSQVMRDLTIRSDPAF
GAFQILKLFLDDWIAVNVLRSVALSTNSVAASVEPVMQQQYFTLSPMAGQESFGSIDVRPTLIAQTPTTSSMLAA
LQSDAFPSTSLDPTSSAFGSDSYGTMQYMDPSSGQDDALSSSHQATLSFSDFSGPGNAFDVGNYSQDLGISASGT
PTSESDHEPESVKSEQT*
Coding >AgabiH97|072750
ATGATTAAAGTTCCACTCTGCGCTCTGGTGGTCTTTTTGACCACACAAGTTCTGGCTTCTCCCGCTCAGACACCT
CTGCGGGACATCGTGTCGGAAAATGTAACAGCCACGCCTGCGGCCCCGAGGAAGCTGCACGGGCGCTTTTTGCAT
ATCACAGATATGCATCCAGACCCCCATTATAGTTTCCACGCATCAACTTCCAAGTCCTGTCACGGAAAGAAAGCG
AAGAAGAAGAAGAGAAAGCGTGCGGGCTATTGGGGGACACCTGACGTTGAATGCGATTCGCCTTTGCGATTAATT
GATTTGACGTTGGATTATCTGGACAAAAATTGGGCTGATGAGATAGATTTCGTTGTTTGGACGGGCGATAATGCT
AGGCATGATGAGGACCACCATATTCCTCGAACTCTTGACGAAATCCTCGACCAGAACAAGCGAATGGCAATGAAG
ATGGAAAAAATATTTTCGAAAAAAGGTATTCCAGTAGTACCAAGTCTCGGCAATAACGATATATGGCCTCATAAT
ATCCTGGCTCCGGGCCCTAACAAGATCACAAACGAGTTTGCATCCTTATGGAGCTCGTTTATCCCCTTTCCTCAA
CGTCAGGTGTTTCAACGGGGAGCATATTATTCGACCGAAGTTATTCCCGGGCATCTGGCGGTGATCTCGTTGAAT
ACGCTCTATTTCTACGATTCGAACAAGGCTGTCGGTGGTTGTCAGTATGGAGATGATGACGACCCTGGAAATCTT
GAGTTTGATTGGCTGGAGGTGCAGTTGAAGCAGTTCCGTGACAAAAATATACAGGTGTATCTTACGGGACATATT
CCTCCTTCACTGGGAAATTATTACCCTGAATGTTACGTCCGATACACAGAGATGTCTTTACGATTCCAGGACACT
ATTTTAGGACACCTTTATGGGCATATGAATCTAGATTATTTTTCATTCATGGAGGAGATTGATCTGGAAATCATT
CCAGGTGAGGAGGAAGAAGGGCCGAGGGCGAAAGGTGGTCGAAATGGGCTGTACGAAACGTTGCTACGGGAGTTT
GAACAGCTGCCCGAGGAATCTGAAGAAGAGAAGCTGGATGGACTGGCCGTTATCAATGTGGCGCCCTCGGTGGTG
CCGAATCCGTTTGTGCCGGCGTTCAGGATATTCTCGTACAATGTTTCGGGGGATGGGCTGATGGGAGCGAGGAAG
CAGCGGGAACACGGGCATCGACGAGGCCGGAAAGGGAACAAGGACGATGTTTGTAAGGACAAGCGGTATGACAAG
TCGTGGAAGTGCCACCTGCAAAAATCTTGGCACACGGATCGTGATGCGCCATCACGGAGGAATCAAGCATTGACG
CCGCTTGGGTATGCGCAGTACTATATGCCTGACATTGCGACGGCCAACAAGACGCAGCCGCCGCGGTACGAGTTG
GAGTATGTGACATATCCGGTATCAGCGCTTGGGTCAGGTGACTGGGAACCTGTGCCGGTGCGACACCTACCTCGG
GCGCTGCGGGAGGGGCGGAAGGGGAAGCGGTATGCGCCGTACGGGCTGCGGGATCTGACGGTCGGGTCGTGGGTG
GGGCTCGGACGGCGGCTGGGGCAGGGAGCGGAGAAAAGGGATGTCGTTGTTGTCTTGACGATGGAGAACGCATAT
ACTTACCGAGTTGGATTTGACTGCGCCGTCGTCGAGGCCAGTGCAGAGCGGCAGACATCCAGAGCCCCCCCGCCA
GCCGCCGTGCTGCCTGTTTCGCCCATCCTCGGCTGGTCCGACCCCCCCACGATCCTTTCCCAGCACGACATGACC
GCCGTCAACATGCACATGCCCCTTGACTTTCTCCCCCACCACTCCCGCTCAAACTCGCTCTCCTCCGCCTCCACT
CACTCCCGTCCTCATTCTTCCCAGGGCTCTATTCCTCGCATGCAGGCAGCAGGAACAGACGATCTCTATCGCCCC
CCCTACCACCTCCACCCTCCTCCCCTCCATCCCGATCCCTCCTCCTCGATCCACAACACAGCCCTAAAAGGCCCG
CTCCGTCCGACCCACAACCGTGTCCGCGCTTCCCCCTACCCCCGTGACACCGACAGCGTCCATTCTTCCTCCTCC
GAAGCAGAAGACATCTCCATGTATCTAGGCCATCATCACACTCCCGAATACCAACCCTTGTATGGCGCTCCCCAC
ACCATGGCCCCTAGCCCCGAGACCATGCATGCCGCAAACGCCTTTGGTCGCATGGCAATCAGCCAGGATCATGCC
CTCGAGAAACTCGCTGCCAATGTCCGTGCCGCCACCACCACCAGCGCTTCCGACCGGGCCAAACAAATCTTTGTC
CAAGCATGGCTAACTGCCAACTATGCCCCCTACCCCGATGGAAATGTCCCCCGTCAAGGATTGTATTTTTCATAC
CGTCGTGTCTGTGACCAGTACGGGATCCCCCACATCAACACAGCCACGTTAGGCAAGGCCATCCGTCTCTGCTTC
CCAACAATCAAAACACGGCGCCTAGGTGTCAGAGGCAACAGCAAATATCATTATTGCGGCATCAGACCCGCCACC
ACCGCTGAAGCCGAATTTCTCCAGGACTATATCCAAAAGTCGAACAATAATGCCGGACAATCGTCCATTAATGCT
GCTCGCCTCGCAAATGAACAAGCTGATAACACTCATAGAACTAATGAAGACGGATCCGGGGATGATGATGACGAC
GATTCCGAAGGTAATCACTCCACCGCTGGTTCCAAACGCAGCTCGCTCGTCCTTTCAAACGAACTCAAAACTGTC
GTCTACGCTGATGACCTGAGCGACAAGACACCAACTGCCGCAACTCTGCTATCTCATGCTCAGGCTCAACGGCCT
GGCACCTTTCCATCCCAGGCCTCCATACGAAGACATCCAGGTCAAGAACCTCTCCTAGGCCCGCACTCTGCTCAT
CCCTCGCAGACTATTGGATCAGCGTCCGCCTTCATCTCTGGACAGACTGCTTTGTCAGTTCGACAGTTCCCCCAC
TTCCCCTCGATCGATGAGGCCGTTGGAGCTGGTTCGACGTCTACCCATGGCATCGCTGGTCGCGAAGTTTGGAAC
TGGTTTCAAGATCATTTGGATGCTCTTCTGGATAGTATGAGGACATTCCGCTTTGACCAATTTGAGATGCACCTG
CGCTCGTTCTGGTCCAATCTGGCTGGTAATCACCGTGAGGTTGTACATGCACCAGCAATCGCTGGATTAATGGCA
AAGGCCGATGCTATTGTATACGATGAAATTTTGGAGATTCTTCGCTCGCAGATGTTGTCCCCTATCCCTGCTGCG
TCTTTAACTAGTCTACGCCAGCTTGCTCTCAAGATGGAAAAAATTCTTTTGGCGTCCCTAGATGGCTATGGAAAT
ACCTTTGTTGAACCAAAGGTGGAGTTGGGTGCTCGTTTTGGTCATCTTATCTTGCGCTTCCTTGATATTTATCAA
GTCACACAAGCCTTGAATACGGTCCTCACTAATCCTAAACAACTCGCTGATATGAGAAGGTCCTGGGAAAAAGTC
GATTTTGAGTCTGTCCGCAACCAGTCGGCTTTGGTGTGCAATTGTCGTCACGAAGAATTGGTGCAGTTGCTGGAG
GTTGAATTCGTTGCTCTCTTGGACAGTCTAACAAAAACCAGTGAGCCAGTTCGAGAAGTCATGGCTTGGGCGGAC
AAATGTTGCGACAGGCTCATGGGAAGCAGTCGTGTTCACAGCACTCCGGAAGAGAGGGGTGGCATGAGTTCGCGC
AGTGTTCTCATTCGTTGGGGCTATGTCACAAGTCAAGTCATGAGAGATCTTACCATTCGCAGTGATCCCGCTTTC
GGTGCTTTTCAGATACTAAAATTATTCCTTGATGATTGGATTGCCGTCAACGTCCTTCGAAGCGTCGCTTTGTCC
ACCAACTCTGTTGCTGCCTCTGTTGAACCCGTGATGCAACAGCAGTATTTCACACTTTCTCCAATGGCAGGCCAA
GAAAGCTTTGGATCGATCGACGTACGGCCGACGCTGATAGCTCAAACCCCCACTACCTCGAGTATGCTTGCAGCA
CTTCAGTCTGACGCCTTCCCTTCTACTTCGTTGGATCCCACTTCATCGGCGTTTGGCTCCGATTCTTATGGGACA
ATGCAGTACATGGATCCTTCGAGCGGTCAGGATGACGCTTTATCATCGAGTCACCAAGCTACCCTGAGCTTCAGT
GATTTTTCTGGTCCCGGAAATGCGTTTGATGTGGGTAATTATTCTCAAGATTTGGGTATCAGCGCCTCTGGCACT
CCGACGAGCGAGTCTGACCACGAACCAGAATCAGTCAAGTCGGAGCAAACTTAA
Transcript >AgabiH97|072750
ATGATTAAAGTTCCACTCTGCGCTCTGGTGGTCTTTTTGACCACACAAGTTCTGGCTTCTCCCGCTCAGACACCT
CTGCGGGACATCGTGTCGGAAAATGTAACAGCCACGCCTGCGGCCCCGAGGAAGCTGCACGGGCGCTTTTTGCAT
ATCACAGATATGCATCCAGACCCCCATTATAGTTTCCACGCATCAACTTCCAAGTCCTGTCACGGAAAGAAAGCG
AAGAAGAAGAAGAGAAAGCGTGCGGGCTATTGGGGGACACCTGACGTTGAATGCGATTCGCCTTTGCGATTAATT
GATTTGACGTTGGATTATCTGGACAAAAATTGGGCTGATGAGATAGATTTCGTTGTTTGGACGGGCGATAATGCT
AGGCATGATGAGGACCACCATATTCCTCGAACTCTTGACGAAATCCTCGACCAGAACAAGCGAATGGCAATGAAG
ATGGAAAAAATATTTTCGAAAAAAGGTATTCCAGTAGTACCAAGTCTCGGCAATAACGATATATGGCCTCATAAT
ATCCTGGCTCCGGGCCCTAACAAGATCACAAACGAGTTTGCATCCTTATGGAGCTCGTTTATCCCCTTTCCTCAA
CGTCAGGTGTTTCAACGGGGAGCATATTATTCGACCGAAGTTATTCCCGGGCATCTGGCGGTGATCTCGTTGAAT
ACGCTCTATTTCTACGATTCGAACAAGGCTGTCGGTGGTTGTCAGTATGGAGATGATGACGACCCTGGAAATCTT
GAGTTTGATTGGCTGGAGGTGCAGTTGAAGCAGTTCCGTGACAAAAATATACAGGTGTATCTTACGGGACATATT
CCTCCTTCACTGGGAAATTATTACCCTGAATGTTACGTCCGATACACAGAGATGTCTTTACGATTCCAGGACACT
ATTTTAGGACACCTTTATGGGCATATGAATCTAGATTATTTTTCATTCATGGAGGAGATTGATCTGGAAATCATT
CCAGGTGAGGAGGAAGAAGGGCCGAGGGCGAAAGGTGGTCGAAATGGGCTGTACGAAACGTTGCTACGGGAGTTT
GAACAGCTGCCCGAGGAATCTGAAGAAGAGAAGCTGGATGGACTGGCCGTTATCAATGTGGCGCCCTCGGTGGTG
CCGAATCCGTTTGTGCCGGCGTTCAGGATATTCTCGTACAATGTTTCGGGGGATGGGCTGATGGGAGCGAGGAAG
CAGCGGGAACACGGGCATCGACGAGGCCGGAAAGGGAACAAGGACGATGTTTGTAAGGACAAGCGGTATGACAAG
TCGTGGAAGTGCCACCTGCAAAAATCTTGGCACACGGATCGTGATGCGCCATCACGGAGGAATCAAGCATTGACG
CCGCTTGGGTATGCGCAGTACTATATGCCTGACATTGCGACGGCCAACAAGACGCAGCCGCCGCGGTACGAGTTG
GAGTATGTGACATATCCGGTATCAGCGCTTGGGTCAGGTGACTGGGAACCTGTGCCGGTGCGACACCTACCTCGG
GCGCTGCGGGAGGGGCGGAAGGGGAAGCGGTATGCGCCGTACGGGCTGCGGGATCTGACGGTCGGGTCGTGGGTG
GGGCTCGGACGGCGGCTGGGGCAGGGAGCGGAGAAAAGGGATGTCGTTGTTGTCTTGACGATGGAGAACGCATAT
ACTTACCGAGTTGGATTTGACTGCGCCGTCGTCGAGGCCAGTGCAGAGCGGCAGACATCCAGAGCCCCCCCGCCA
GCCGCCGTGCTGCCTGTTTCGCCCATCCTCGGCTGGTCCGACCCCCCCACGATCCTTTCCCAGCACGACATGACC
GCCGTCAACATGCACATGCCCCTTGACTTTCTCCCCCACCACTCCCGCTCAAACTCGCTCTCCTCCGCCTCCACT
CACTCCCGTCCTCATTCTTCCCAGGGCTCTATTCCTCGCATGCAGGCAGCAGGAACAGACGATCTCTATCGCCCC
CCCTACCACCTCCACCCTCCTCCCCTCCATCCCGATCCCTCCTCCTCGATCCACAACACAGCCCTAAAAGGCCCG
CTCCGTCCGACCCACAACCGTGTCCGCGCTTCCCCCTACCCCCGTGACACCGACAGCGTCCATTCTTCCTCCTCC
GAAGCAGAAGACATCTCCATGTATCTAGGCCATCATCACACTCCCGAATACCAACCCTTGTATGGCGCTCCCCAC
ACCATGGCCCCTAGCCCCGAGACCATGCATGCCGCAAACGCCTTTGGTCGCATGGCAATCAGCCAGGATCATGCC
CTCGAGAAACTCGCTGCCAATGTCCGTGCCGCCACCACCACCAGCGCTTCCGACCGGGCCAAACAAATCTTTGTC
CAAGCATGGCTAACTGCCAACTATGCCCCCTACCCCGATGGAAATGTCCCCCGTCAAGGATTGTATTTTTCATAC
CGTCGTGTCTGTGACCAGTACGGGATCCCCCACATCAACACAGCCACGTTAGGCAAGGCCATCCGTCTCTGCTTC
CCAACAATCAAAACACGGCGCCTAGGTGTCAGAGGCAACAGCAAATATCATTATTGCGGCATCAGACCCGCCACC
ACCGCTGAAGCCGAATTTCTCCAGGACTATATCCAAAAGTCGAACAATAATGCCGGACAATCGTCCATTAATGCT
GCTCGCCTCGCAAATGAACAAGCTGATAACACTCATAGAACTAATGAAGACGGATCCGGGGATGATGATGACGAC
GATTCCGAAGGTAATCACTCCACCGCTGGTTCCAAACGCAGCTCGCTCGTCCTTTCAAACGAACTCAAAACTGTC
GTCTACGCTGATGACCTGAGCGACAAGACACCAACTGCCGCAACTCTGCTATCTCATGCTCAGGCTCAACGGCCT
GGCACCTTTCCATCCCAGGCCTCCATACGAAGACATCCAGGTCAAGAACCTCTCCTAGGCCCGCACTCTGCTCAT
CCCTCGCAGACTATTGGATCAGCGTCCGCCTTCATCTCTGGACAGACTGCTTTGTCAGTTCGACAGTTCCCCCAC
TTCCCCTCGATCGATGAGGCCGTTGGAGCTGGTTCGACGTCTACCCATGGCATCGCTGGTCGCGAAGTTTGGAAC
TGGTTTCAAGATCATTTGGATGCTCTTCTGGATAGTATGAGGACATTCCGCTTTGACCAATTTGAGATGCACCTG
CGCTCGTTCTGGTCCAATCTGGCTGGTAATCACCGTGAGGTTGTACATGCACCAGCAATCGCTGGATTAATGGCA
AAGGCCGATGCTATTGTATACGATGAAATTTTGGAGATTCTTCGCTCGCAGATGTTGTCCCCTATCCCTGCTGCG
TCTTTAACTAGTCTACGCCAGCTTGCTCTCAAGATGGAAAAAATTCTTTTGGCGTCCCTAGATGGCTATGGAAAT
ACCTTTGTTGAACCAAAGGTGGAGTTGGGTGCTCGTTTTGGTCATCTTATCTTGCGCTTCCTTGATATTTATCAA
GTCACACAAGCCTTGAATACGGTCCTCACTAATCCTAAACAACTCGCTGATATGAGAAGGTCCTGGGAAAAAGTC
GATTTTGAGTCTGTCCGCAACCAGTCGGCTTTGGTGTGCAATTGTCGTCACGAAGAATTGGTGCAGTTGCTGGAG
GTTGAATTCGTTGCTCTCTTGGACAGTCTAACAAAAACCAGTGAGCCAGTTCGAGAAGTCATGGCTTGGGCGGAC
AAATGTTGCGACAGGCTCATGGGAAGCAGTCGTGTTCACAGCACTCCGGAAGAGAGGGGTGGCATGAGTTCGCGC
AGTGTTCTCATTCGTTGGGGCTATGTCACAAGTCAAGTCATGAGAGATCTTACCATTCGCAGTGATCCCGCTTTC
GGTGCTTTTCAGATACTAAAATTATTCCTTGATGATTGGATTGCCGTCAACGTCCTTCGAAGCGTCGCTTTGTCC
ACCAACTCTGTTGCTGCCTCTGTTGAACCCGTGATGCAACAGCAGTATTTCACACTTTCTCCAATGGCAGGCCAA
GAAAGCTTTGGATCGATCGACGTACGGCCGACGCTGATAGCTCAAACCCCCACTACCTCGAGTATGCTTGCAGCA
CTTCAGTCTGACGCCTTCCCTTCTACTTCGTTGGATCCCACTTCATCGGCGTTTGGCTCCGATTCTTATGGGACA
ATGCAGTACATGGATCCTTCGAGCGGTCAGGATGACGCTTTATCATCGAGTCACCAAGCTACCCTGAGCTTCAGT
GATTTTTCTGGTCCCGGAAATGCGTTTGATGTGGGTAATTATTCTCAAGATTTGGGTATCAGCGCCTCTGGCACT
CCGACGAGCGAGTCTGACCACGAACCAGAATCAGTCAAGTCGGAGCAAACTTAA
Gene >AgabiH97|072750
ATGATTAAAGTTCCACTCTGCGCTCTGGTGGTCTTTTTGACCACACAAGTTCTGGCTTCTCCCGCTCAGACACCT
CTGCGGGACATCGTGTCGGAAAATGTAACAGCCACGCCTGCGGGTAAGTTTATGTTCGGCCACAACGTTGCGATA
TCCAGAATAACCTTTGTCTTATAAGCCCCGAGGAAGCTGCACGGGCGCTTTTTGCATATCACAGATATGCATCCA
GACCCCCATTATAGTTTCCACGCATCAACTTCCAAGTCCTGTCACGGAAAGAAAGCGAAGAAGAAGAAGAGAAAG
CGTGCGGGCTATTGGGGGACACCTGACGTGTATGTTAAACATAGTTCAAGCCAGCCTCAGATGCTTATTGATTGA
TGTTATTCTAACACAAAGTGAATGCGATTCGCCTTTGCGATTAATTGATTTGACGTTGGATTATCTGGACAAAAA
TTGGGCTGATGAGATAGATTTCGTTGTTTGTACGTCATCTTTTTCAAAAAAAAATTTCTAATGCACATAATTTGA
GAAGGGACGGGCGATAATGCTAGGTGCGTATCTTATCTGTATCTGATTAACCAACCAATGGCCTAATGCAATCTG
TCGATGTTTTCAAAAAATCAGGCATGATGAGGACCACCATATTCCTCGAACTCTTGACGAAATCCTCGACCAGAA
CAAGCGAATGGCAATGAAGATGGAAAAAATATTTTCGAAAAAAGGTATTCCAGTAGTACCAAGTCTCGGTGAGAG
AATCTATATCTTATTTAAATTCTTGGTGTAACCTTTTTTTTTTTTGACACTAGGCAATAACGATATATGGCGTGA
GTTGAATCATTCTCTCATGTACCACTTGGGTGTTGATTGTATGTGTTCTTGTGTCCATTTAGCTCATGTAAGTGC
TTTGCCGCGCGCTTCTGCAAAACGCAAAACTCATTTATACAAATCCAACAACTTGACAACAGAATATCCTGGCTC
CGGGTGAGTTTGACGTCTGATTGGATGGAGTACGAATTAATATCTTCCTCTTAGGCCCTAACAAGATCACAAACG
AGTTTGCATCGTTGGTGGCCATTCTCATCACTGACGTATTCCTCGGCTGAATAAGTCATAGCTTATGGAGCTCGT
TTATCCCCTTTCCTCAACGTCAGGTGTTTCAACGGGGAGCATATTATTCGACCGAAGTTATTCCCGGGCATCTGG
CGGTGATCTCGTTGAATACGCTCTATTTCTACGATTCGAACAAGGGTGAGCCAACAAGAAATGATTATCATGTTT
TGTTCGATGGTTCTTAACGTGATCGATTCAATAGCTGTCGGTGGTTGTCAGTATGGAGATGATGACGACCCTGGA
AATCTTGAGTTTGATTGGCTGGAGGTGCAGTTGAAGCAGTTCCGTGACAAAAATATACAGGTAAGCATGCGGTTG
AATTTAAAAAGTGGGTCACGGATGACTGATGCAAATAAAATTGCATTTTTTCCGGCAGGTGTATCTTACGGGTGG
GTGACATTCGCTCGCGCTTTATCGTGTTTAATGAGTGATAACAGGACATATTCCTCCTTCACTGGGAAATTATTA
CCCTGAATGTGTGAGTATCAAAGCATAATTGTTGACAGAGAACACAGCTTTTGATCGATGAAACGGTACATGGAT
ACGAACAGTACGTCCGATACACAGAGATGTCTTTACGATTCCAGGACACTATTTTAGGACACCTTTATGGGGTAA
GAGACAACTCGATTGAGAACTATAGATGGCTGATCGGATGCGATATTTTCCCAGCATATGAATCTAGATTATGTA
GGTGCCTTTTTAGATGAATTGAAACGCGGGAGTTGAATTAAGATGTAGTTTTCATTCATGGAGGAGATTGATCTG
GAAATCATTCCAGGTGAGGAGGAAGAAGGGCCGAGGGCGAAAGGTGGTCGAAATGGGCTGTACGAAACGTTGCTA
CGGGAGTTTGAACAGCTGCCCGAGGAATCTGAAGAAGAGAAGCTGGATGGACTGGCCGTTATCAATGTGGCGCCC
TCGGTGGTGCCGAATCCGTTTGTGCCGGCGTTCAGGATATTCTCGTACAATGTTTCGGGGGATGGGCTGATGGGA
GCGAGGAAGCAGCGGGAACACGGGCATCGACGAGGCCGGAAAGGGAACAAGGACGATGTTTGTAAGGACAAGCGG
TATGACAAGTCGTGGAAGTGCCACCTGCAAAAATCTTGGCACACGGATCGTGATGCGCCATCACGGAGGAATCAA
GCATTGACGCCGCTTGGGTATGCGCAGGTAGGGGCACTGTTTCATCGGGGGTACATAGAGCTGAGGAGGTATATG
CAGTACTATATGCCTGACATTGCGACGGCCAACAAGACGCAGCCGCCGCGGTACGAGTTGGAGTATGTGACATAT
CCGGTATCAGCGCTTGGGTCAGGTGACTGGGAACCTGTGCCGGTGCGACACCTACCTCGGGCGCTGCGGGAGGGG
CGGAAGGGGAAGCGGTATGCGCCGTACGGGCTGCGGGATCTGACGGTCGGGTCGTGGGTGGGGCTCGGACGGCGG
CTGGGGCAGGGAGCGGAGAAAAGGGTGCGGCGACGGTTCAGGGAATACATGGGGGTGTCCGGCTGAGTAAACAGA
AATAAACAGGATGTCGTTGTTGTCTTGACGATGGAGAACGCATATACTTACCGAGTTGGATTTGACTGCGCCGTC
GTCGAGGCCAGTGCAGAGCGGCAGACATCCAGAGCCCCCCCGCCAGCCGCCGTGCTGCCTGTTTCGCCCATCCTC
GGCTGGTCCGACCCCCCCACGATCCTTTCCCAGCACGACATGACCGCCGTCAACATGCACATGCCCCTTGACTTT
CTCCCCCACCACTCCCGCTCAAACTCGCTCTCCTCCGCCTCCACTCACTCCCGTCCTCATTCTTCCCAGGGCTCT
ATTCCTCGCATGCAGGCAGCAGGAACAGACGATCTCTATCGCCCCCCCTACCACCTCCACCCTCCTCCCCTCCAT
CCCGATCCCGTACGTCTCTCCTTTGACCCTTTCCACTCTCTTTCTCACACTCCTCTAGTCCTCCTCGATCCACAA
CACAGCCCTAAAAGGCCCGCTCCGTCCGACCCACAACCGTGTCCGCGCTTCCCCCTACCCCCGTGACACCGACAG
CGTCCATTCTTCCTCCTCCGAAGCAGAAGACATCTCCATGTATCTAGGCCATCATCACACTCCCGAATACCAACC
CTTGTATGGCGCTCCCCACACCATGGCCCCTAGCCCCGAGACCATGCATGCCGCAAACGCCTTTGGTCGCATGGC
AATCAGCCAGGATCATGCCCTCGAGAAACTCGCTGCCAATGTCCGTGCCGCCACCACCACCAGCGCTTCCGACCG
GGCCAAACAAATCTTTGTCCAAGCATGGCAAGTTTTGTTTCCTTATTGTTCTTTCTTTCTCTCTCTTTCCTTTTC
CTCTCACTGATCCGCTCTACACCCACAGGCTAACTGCCAACTATGCCCCCTACCCCGATGGAAATGTCCCCCGTC
AAGGATTGTATTTTTCATACCGTCGTGTCTGTGACCAGTACGGGATCCCCCACATCAACACAGCCACGTTAGGCA
AGGCCATCCGTCTCTGCTTCCCAACAATCAAAACACGGCGCCTAGGTGTCAGAGGCAACAGCAAATATCATTGCA
AGTGTTTGATCATCTTTGTCCAGCACTGGATCGGCCACTGATTTCGCATCCGTTGACAGATTGCGGCATCAGACC
CGCCACCACCGCTGAAGCCGAATTTCTCCAGGACTATATCCAAAAGTCGAACAATAATGCCGGACAATCGTCCAT
TAATGCTGCTCGCCTCGCAAATGAACAAGCTGATAACACTCATAGAACTAATGAAGACGGATCCGGGGATGATGA
TGACGACGATTCCGAAGGTAATCACTCCACCGCTGGTTCCAAACGCAGCTCGCTCGTCCTTTCAAACGAACTCAA
AACTGTCGTCTACGCTGATGACCTGAGCGACAAGACACCAACTGCCGCAACTCTGCTATCTCATGCTCAGGCTCA
ACGGCCTGGCACCTTTCCATCCCAGGCCTCCATACGAAGACATCCAGGTCAAGAACCTCTCCTAGGCCCGCACTC
TGCTCATCCCTCGCAGACTATTGGATCAGCGTCCGCCTTCATCTCTGGACAGACTGCTTTGTCAGTTCGACAGTT
CCCCCACTTCCCCTCGATCGATGAGGCCGTTGGAGCTGGTTCGACGTCTACCCATGGCATCGCTGGTCGCGAAGT
TTGGAACTGGTTTCAAGATCATTTGGATGCTCTTCTGGATAGTATGAGGACATTCCGCTTTGACCAATTTGAGAT
GCACCTGCGCTCGTTCTGGTCCAATCTGGCTGGTAATCACCGTGAGGTTGTACATGCACCAGCAATCGCTGGATT
AATGGCAAAGGCCGATGCTATTGTATACGATGTACGTATTTCTCTGGGCGTGGACTAAGCTGTCTCTGATCCGAG
TTTTCTCAAGGAAATTTTGGAGATTCTTCGCTCGCAGATGTTGTCCCCTATCCCTGCTGCGTCTTTAACTAGTCT
ACGCCAGCTTGCTCTCAAGATGGAAAAAATTCTTTTGGCGTCCCTAGATGGCTATGGAAATACCTTTGTTGAACC
AAAGGTGGAGTTGGGTGCTCGTTTTGGTCATCTTATCTGTGCGTTCATTTTGTTTTGCTTCAACATTGCCCTTGA
CAAATCGGTCTATAGTGCGCTTCCTTGATATTTATCAAGTCACACAAGCCTTGAATACGGTCCTCACTAATCCTA
AACAACTCGCTGATATGAGAAGGTCCTGGGAAAAAGTCGATTTTGAGTCTGTCCGCAACCAGTCGGCTTTGGTGT
GCAATTGTCGTCACGAAGAATTGGTGCAGTTGCTGGAGGTTGAATTCGTTGCTCTCTTGGACAGTCTAACAAAAA
CCAGTGAGCCAGTTCGAGAAGTCATGGCTTGGGCGGACAAATGTTGCGACAGGCTCATGGGAAGCAGTCGTGTTC
ACAGCACTCCGGAAGAGAGGGGTGGCATGAGTTCGCGCAGTGTTCTCATTCGTTGGGGCTATGTCACAAGTCAAG
TCATGAGAGATCTTGTGCGTCTTGACAATTGTTCTGTTTCTATCTTCGTTTTGATTGATGATCATGTGTAGACCA
TTCGCAGTGATCCCGCTTTCGGTGCTTTTCAGATACTAAAATTATTCCTTGAGTAAGTGCTTCGCCTGTCATGAT
AGACGGCTGTTGGTCTCGAACTCACGTTTACTCGTAGTGATTGGATTGCCGTCAACGTCCTTCGAAGCGTCGCTT
TGTCCACCAACTCTGTTGCTGCCTCTGTTGAACCCGTGATGCAACAGCAGTATTTCACACTTTCTCCAATGGCAG
GCCAAGAAAGCTTTGGATCGATCGACGTACGGCCGACGCTGATAGCTCAAACCCCCACTACCTCGAGTATGCTTG
CAGCACTTCAGTCTGACGCCTTCCCTTCTACTTCGTTGGATCCCACTTCATCGGCGTTTGGCTCCGATTCTTATG
GGACAATGCAGTACATGGATCCTTCGAGCGGTCAGGATGACGCTTTATCATCGAGTCACCAAGCTACCCTGAGCT
TCAGTGATTTTTCTGGTCCCGGAAATGCGTTTGATGTGGGTAATTATTCTCAAGATTTGGGTATCAGCGCCTCTG
GCACTCCGACGAGCGAGTCTGACCACGAACCAGAATCAGTCAAGTCGGAGCAAACTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail