Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072570
Gene name
Locationscaffold_4:1753098..1755527
Strand-
Gene length (bp)2429
Transcript length (bp)1833
Coding sequence length (bp)1833
Protein length (aa) 611

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01251 Ribosomal_S7e Ribosomal protein S7e 1.4E-82 36 213
PF00071 Ras Ras family 6.0E-42 261 388
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 3.1E-32 261 376
PF00025 Arf ADP-ribosylation factor family 1.3E-10 260 383
PF01926 MMR_HSR1 50S ribosome-binding GTPase 2.3E-05 261 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10101|RS7_SCHPO 40S ribosomal protein S7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps7 PE=1 SV=2 24 217 2.0E-77
sp|P48164|RS7B_YEAST 40S ribosomal protein S7-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS7B PE=1 SV=1 25 214 7.0E-74
sp|P26786|RS7A_YEAST 40S ribosomal protein S7-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS7A PE=1 SV=4 34 214 9.0E-74
sp|O43105|RS7_NEUCR 40S ribosomal protein S7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-15 PE=3 SV=2 28 219 2.0E-72
sp|P02362|RS7_XENLA 40S ribosomal protein S7 OS=Xenopus laevis GN=rps7 PE=2 SV=2 41 214 6.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10101|RS7_SCHPO 40S ribosomal protein S7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps7 PE=1 SV=2 24 217 2.0E-77
sp|P48164|RS7B_YEAST 40S ribosomal protein S7-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS7B PE=1 SV=1 25 214 7.0E-74
sp|P26786|RS7A_YEAST 40S ribosomal protein S7-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS7A PE=1 SV=4 34 214 9.0E-74
sp|O43105|RS7_NEUCR 40S ribosomal protein S7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-15 PE=3 SV=2 28 219 2.0E-72
sp|P02362|RS7_XENLA 40S ribosomal protein S7 OS=Xenopus laevis GN=rps7 PE=2 SV=2 41 214 6.0E-70
sp|Q90YR7|RS7_ICTPU 40S ribosomal protein S7 OS=Ictalurus punctatus GN=rps7 PE=2 SV=1 32 214 8.0E-70
sp|P62083|RS7_RAT 40S ribosomal protein S7 OS=Rattus norvegicus GN=Rps7 PE=1 SV=1 41 214 1.0E-69
sp|P62082|RS7_MOUSE 40S ribosomal protein S7 OS=Mus musculus GN=Rps7 PE=2 SV=1 41 214 1.0E-69
sp|P62081|RS7_HUMAN 40S ribosomal protein S7 OS=Homo sapiens GN=RPS7 PE=1 SV=1 41 214 1.0E-69
sp|Q5RT64|RS7_FELCA 40S ribosomal protein S7 OS=Felis catus GN=RPS7 PE=2 SV=1 41 214 1.0E-69
sp|A6H769|RS7_BOVIN 40S ribosomal protein S7 OS=Bos taurus GN=RPS7 PE=2 SV=1 41 214 1.0E-69
sp|P62084|RS7_DANRE 40S ribosomal protein S7 OS=Danio rerio GN=rps7 PE=2 SV=1 41 214 2.0E-69
sp|P50894|RS7_TAKRU 40S ribosomal protein S7 OS=Takifugu rubripes GN=rps7 PE=3 SV=1 41 214 5.0E-69
sp|Q962S0|RS7_SPOFR 40S ribosomal protein S7 OS=Spodoptera frugiperda GN=RpS7 PE=2 SV=1 32 214 1.0E-62
sp|Q9VA91|RS7_DROME 40S ribosomal protein S7 OS=Drosophila melanogaster GN=RpS7 PE=1 SV=1 24 214 3.0E-62
sp|P48155|RS7_MANSE 40S ribosomal protein S7 OS=Manduca sexta GN=RpS7 PE=2 SV=1 26 214 7.0E-62
sp|P62085|RS7_DROYA 40S ribosomal protein S7 OS=Drosophila yakuba GN=RpS7 PE=2 SV=1 24 214 1.0E-61
sp|P33514|RS7_ANOGA 40S ribosomal protein S7 OS=Anopheles gambiae GN=RpS7 PE=2 SV=2 24 214 6.0E-61
sp|Q9NB21|RS7_CULQU 40S ribosomal protein S7 OS=Culex quinquefasciatus GN=RpS7 PE=2 SV=1 24 214 6.0E-60
sp|Q8LD03|RS73_ARATH 40S ribosomal protein S7-3 OS=Arabidopsis thaliana GN=RPS7C PE=1 SV=2 25 215 3.0E-57
sp|Q9M885|RS72_ARATH 40S ribosomal protein S7-2 OS=Arabidopsis thaliana GN=RPS7B PE=2 SV=1 41 216 3.0E-57
sp|Q9C514|RS71_ARATH 40S ribosomal protein S7-1 OS=Arabidopsis thaliana GN=RPS7A PE=2 SV=1 24 215 5.0E-57
sp|Q9ZNS1|RS7_AVIMR 40S ribosomal protein S7 OS=Avicennia marina GN=RPS7 PE=2 SV=1 39 215 6.0E-56
sp|Q9XH45|RS7_BRAOL 40S ribosomal protein S7 OS=Brassica oleracea GN=RPS7 PE=2 SV=1 24 215 2.0E-55
sp|Q8LJU5|RS7_ORYSJ 40S ribosomal protein S7 OS=Oryza sativa subsp. japonica GN=RPS7 PE=2 SV=2 41 215 5.0E-55
sp|Q54I41|RS7_DICDI 40S ribosomal protein S7 OS=Dictyostelium discoideum GN=rps7 PE=1 SV=1 26 213 9.0E-55
sp|Q9XET4|RS7_SECCE 40S ribosomal protein S7 OS=Secale cereale GN=RPS7 PE=2 SV=1 41 215 3.0E-54
sp|Q23312|RS7_CAEEL 40S ribosomal protein S7 OS=Caenorhabditis elegans GN=rps-7 PE=3 SV=1 26 214 5.0E-53
sp|Q949H0|RS7_HORVU 40S ribosomal protein S7 OS=Hordeum vulgare GN=RPS7 PE=2 SV=1 41 215 2.0E-51
sp|P41925|RYL2_YARLI Ras-like GTP-binding protein RYL2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL2 PE=3 SV=2 258 377 4.0E-37
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 252 389 4.0E-36
sp|Q8MYF2|RABJ_DICDI Ras-related protein RabJ OS=Dictyostelium discoideum GN=rabJ PE=3 SV=1 258 390 9.0E-36
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 256 390 2.0E-35
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 261 386 1.0E-34
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 261 389 1.0E-34
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 261 389 1.0E-34
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 261 389 1.0E-34
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 261 389 1.0E-34
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 261 389 1.0E-34
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 261 389 1.0E-34
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 261 389 1.0E-34
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 261 389 1.0E-34
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 261 389 1.0E-34
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 261 389 1.0E-34
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 261 389 1.0E-34
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 261 389 1.0E-34
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 261 389 2.0E-34
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 261 389 2.0E-34
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 253 390 2.0E-34
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 253 386 2.0E-34
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 254 383 3.0E-34
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 255 389 5.0E-34
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 253 389 6.0E-34
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 261 384 6.0E-34
sp|Q54RX9|RAB5B_DICDI Putative ras-related protein Rab-5B OS=Dictyostelium discoideum GN=rab5B PE=5 SV=1 230 389 7.0E-34
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 254 389 9.0E-34
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 254 389 9.0E-34
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 261 384 1.0E-33
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 248 389 1.0E-33
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 248 389 1.0E-33
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 248 389 1.0E-33
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 261 384 1.0E-33
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 253 386 1.0E-33
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 261 389 1.0E-33
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 261 384 1.0E-33
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 250 379 1.0E-33
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 255 390 1.0E-33
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 261 389 1.0E-33
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 261 389 1.0E-33
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 261 389 2.0E-33
sp|P36412|RB11A_DICDI Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 261 389 2.0E-33
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 261 383 2.0E-33
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 261 389 2.0E-33
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 246 386 2.0E-33
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 261 384 2.0E-33
sp|P51996|YPT32_YEAST GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 254 389 2.0E-33
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 261 383 2.0E-33
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 261 383 2.0E-33
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 261 383 2.0E-33
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 261 383 2.0E-33
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 261 386 3.0E-33
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 261 389 4.0E-33
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 255 389 5.0E-33
sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 261 389 5.0E-33
sp|P28185|RAA1A_ARATH Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 261 389 6.0E-33
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 261 383 6.0E-33
sp|Q1PEX3|RAA1H_ARATH Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 261 386 7.0E-33
sp|P28187|RAA5C_ARATH Ras-related protein RABA5c OS=Arabidopsis thaliana GN=RABA5C PE=1 SV=1 261 384 1.0E-32
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 261 383 1.0E-32
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 261 386 2.0E-32
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 261 383 2.0E-32
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 261 389 2.0E-32
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 261 383 2.0E-32
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 261 383 2.0E-32
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 261 383 2.0E-32
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 244 386 2.0E-32
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 261 383 2.0E-32
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 261 383 2.0E-32
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 246 386 3.0E-32
sp|Q9CB01|RABF1_ARATH Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 261 394 3.0E-32
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 261 388 4.0E-32
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 261 388 4.0E-32
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 261 388 4.0E-32
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 261 379 4.0E-32
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 253 384 5.0E-32
sp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 261 384 6.0E-32
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 261 383 7.0E-32
sp|Q9VP48|RAB26_DROME Ras-related protein Rab-26 OS=Drosophila melanogaster GN=Rab26 PE=2 SV=2 254 376 9.0E-32
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 261 383 1.0E-31
sp|P36863|YPTV4_VOLCA GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 261 386 3.0E-31
sp|Q39570|YPTC4_CHLRE GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 261 386 4.0E-31
sp|Q5R8Z8|RAB14_PONAB Ras-related protein Rab-14 OS=Pongo abelii GN=RAB14 PE=2 SV=3 254 389 6.0E-31
sp|Q91V41|RAB14_MOUSE Ras-related protein Rab-14 OS=Mus musculus GN=Rab14 PE=1 SV=3 254 389 6.0E-31
sp|P61106|RAB14_HUMAN Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 254 389 6.0E-31
sp|Q5ZKU5|RAB14_CHICK Ras-related protein Rab-14 OS=Gallus gallus GN=RAB14 PE=2 SV=3 254 389 6.0E-31
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 261 383 7.0E-31
sp|P61107|RAB14_RAT Ras-related protein Rab-14 OS=Rattus norvegicus GN=Rab14 PE=1 SV=3 254 389 7.0E-31
sp|Q52NJ6|RAB14_PIG Ras-related protein Rab-14 OS=Sus scrofa GN=RAB14 PE=2 SV=3 254 389 7.0E-31
sp|Q9JKM7|RAB37_MOUSE Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 244 386 7.0E-31
sp|Q559X6|RAB2B_DICDI Ras-related protein Rab-2B OS=Dictyostelium discoideum GN=rab2B PE=3 SV=1 238 430 1.0E-30
sp|E2RQ15|RAB25_CANLF Ras-related protein Rab-25 OS=Canis lupus familiaris GN=RAB25 PE=3 SV=1 255 394 2.0E-30
sp|P36410|RAB14_DICDI Ras-related protein Rab-14 OS=Dictyostelium discoideum GN=rab14 PE=1 SV=2 261 388 2.0E-30
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 251 389 3.0E-30
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 261 383 3.0E-30
sp|Q29RR0|RAB26_BOVIN Ras-related protein Rab-26 OS=Bos taurus GN=RAB26 PE=2 SV=1 261 383 5.0E-30
sp|Q9FGK5|RAA5A_ARATH Ras-related protein RABA5a OS=Arabidopsis thaliana GN=RABA5A PE=2 SV=1 261 385 5.0E-30
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 254 386 7.0E-30
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 254 386 7.0E-30
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 254 386 7.0E-30
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 254 386 8.0E-30
sp|P32939|YPT7_YEAST GTP-binding protein YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT7 PE=1 SV=1 261 386 9.0E-30
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 254 386 9.0E-30
sp|P36586|YPT5_SCHPO GTP-binding protein ypt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt5 PE=1 SV=1 246 382 1.0E-29
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 254 384 1.0E-29
sp|Q38922|RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 261 386 1.0E-29
sp|P19892|RAA5E_ARATH Ras-related protein RABA5e OS=Arabidopsis thaliana GN=RABA5E PE=2 SV=1 261 384 1.0E-29
sp|P46629|RAB25_RABIT Ras-related protein Rab-25 OS=Oryctolagus cuniculus GN=RAB25 PE=2 SV=1 255 394 1.0E-29
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 261 386 2.0E-29
sp|P36017|VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 261 377 2.0E-29
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 250 413 2.0E-29
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 258 384 2.0E-29
sp|Q68EK7|RAB4B_DANRE Ras-related protein Rab-4B OS=Danio rerio GN=rab4b PE=2 SV=1 261 384 2.0E-29
sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 261 383 2.0E-29
sp|Q9GP33|RAB4A_ECHMU Probable Ras-related protein Rab-4A OS=Echinococcus multilocularis PE=2 SV=1 253 377 3.0E-29
sp|P59279|RAB2B_MOUSE Ras-related protein Rab-2B OS=Mus musculus GN=Rab2b PE=1 SV=1 261 383 3.0E-29
sp|P57735|RAB25_HUMAN Ras-related protein Rab-25 OS=Homo sapiens GN=RAB25 PE=1 SV=2 255 394 3.0E-29
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 261 383 3.0E-29
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 261 386 3.0E-29
sp|P61018|RAB4B_HUMAN Ras-related protein Rab-4B OS=Homo sapiens GN=RAB4B PE=1 SV=1 261 384 3.0E-29
sp|P61017|RAB4B_CANLF Ras-related protein Rab-4B OS=Canis lupus familiaris GN=RAB4B PE=2 SV=1 261 384 3.0E-29
sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 261 383 3.0E-29
sp|P51146|RAB4B_RAT Ras-related protein Rab-4B OS=Rattus norvegicus GN=Rab4b PE=2 SV=1 261 384 3.0E-29
sp|Q91ZR1|RAB4B_MOUSE Ras-related protein Rab-4B OS=Mus musculus GN=Rab4b PE=1 SV=2 261 384 3.0E-29
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 261 383 4.0E-29
sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 261 383 4.0E-29
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 261 380 4.0E-29
sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 261 383 4.0E-29
sp|Q58DW6|RAB25_BOVIN Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 PE=2 SV=1 255 394 4.0E-29
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 254 386 4.0E-29
sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 261 383 4.0E-29
sp|Q22782|RAB6B_CAEEL Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 261 386 4.0E-29
sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 261 383 4.0E-29
sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 261 383 4.0E-29
sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 261 383 4.0E-29
sp|P61105|RAB2A_CANLF Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 261 383 4.0E-29
sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 261 383 5.0E-29
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 254 386 5.0E-29
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 254 386 5.0E-29
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 261 383 5.0E-29
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 254 386 5.0E-29
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 254 386 5.0E-29
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 254 386 5.0E-29
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 254 386 6.0E-29
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 261 380 6.0E-29
sp|Q5ZLG1|RAB18_CHICK Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 261 380 8.0E-29
sp|O00194|RB27B_HUMAN Ras-related protein Rab-27B OS=Homo sapiens GN=RAB27B PE=1 SV=4 254 389 9.0E-29
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 254 386 1.0E-28
sp|Q5R5H5|RAB18_PONAB Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 261 380 1.0E-28
sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 261 380 1.0E-28
sp|P35292|RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 242 384 1.0E-28
sp|Q0IIG8|RAB18_BOVIN Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 261 380 1.0E-28
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 252 385 1.0E-28
sp|Q921E2|RAB31_MOUSE Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 261 383 1.0E-28
sp|Q6GQP4|RAB31_RAT Ras-related protein Rab-31 OS=Rattus norvegicus GN=Rab31 PE=1 SV=2 261 383 1.0E-28
sp|P17608|RYH1_SCHPO GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 261 386 1.0E-28
sp|Q9SIP0|RAA5D_ARATH Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 261 384 1.0E-28
sp|P35293|RAB18_MOUSE Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 261 380 2.0E-28
sp|Q5EB77|RAB18_RAT Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 261 380 2.0E-28
sp|Q8HZJ5|RB27B_BOVIN Ras-related protein Rab-27B OS=Bos taurus GN=RAB27B PE=2 SV=3 254 389 2.0E-28
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 261 384 2.0E-28
sp|Q13636|RAB31_HUMAN Ras-related protein Rab-31 OS=Homo sapiens GN=RAB31 PE=1 SV=1 261 383 2.0E-28
sp|Q99P74|RB27B_RAT Ras-related protein Rab-27B OS=Rattus norvegicus GN=Rab27b PE=2 SV=3 254 389 2.0E-28
sp|Q86JP3|RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 261 385 2.0E-28
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 261 386 2.0E-28
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 261 386 2.0E-28
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 261 386 2.0E-28
sp|P92963|RAB1C_ARATH Ras-related protein RABB1c OS=Arabidopsis thaliana GN=RABB1C PE=1 SV=1 261 386 3.0E-28
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 250 383 3.0E-28
sp|O94655|YPT7_SCHPO GTP-binding protein ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt7 PE=3 SV=1 261 455 3.0E-28
sp|P49104|RAB2B_MAIZE Ras-related protein Rab-2-B OS=Zea mays GN=RAB2B PE=2 SV=1 261 386 3.0E-28
sp|Q99P58|RB27B_MOUSE Ras-related protein Rab-27B OS=Mus musculus GN=Rab27b PE=1 SV=3 254 389 3.0E-28
sp|Q55ET3|RABQ_DICDI Ras-related protein RabQ OS=Dictyostelium discoideum GN=rabQ PE=3 SV=1 261 386 3.0E-28
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 254 384 4.0E-28
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 254 388 4.0E-28
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 254 388 4.0E-28
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 254 388 4.0E-28
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 261 389 4.0E-28
sp|Q9LNK1|RABA3_ARATH Ras-related protein RABA3 OS=Arabidopsis thaliana GN=RABA3 PE=2 SV=1 261 377 4.0E-28
sp|Q9WTL2|RAB25_MOUSE Ras-related protein Rab-25 OS=Mus musculus GN=Rab25 PE=1 SV=2 255 394 5.0E-28
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 254 383 5.0E-28
sp|P05714|RAB4A_RAT Ras-related protein Rab-4A OS=Rattus norvegicus GN=Rab4a PE=1 SV=3 261 384 6.0E-28
sp|Q2TBH7|RAB4A_BOVIN Ras-related protein Rab-4A OS=Bos taurus GN=RAB4A PE=2 SV=3 261 384 6.0E-28
sp|P36018|YPT52_YEAST GTP-binding protein YPT52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT52 PE=1 SV=1 261 377 6.0E-28
sp|P20338|RAB4A_HUMAN Ras-related protein Rab-4A OS=Homo sapiens GN=RAB4A PE=1 SV=3 261 384 6.0E-28
sp|P49103|RAB2A_MAIZE Ras-related protein Rab-2-A OS=Zea mays GN=RAB2A PE=2 SV=1 261 386 7.0E-28
sp|Q9H0T7|RAB17_HUMAN Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 261 384 8.0E-28
sp|O13876|YPT4_SCHPO GTP-binding protein ypt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt4 PE=3 SV=1 254 388 8.0E-28
sp|O18334|RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 261 386 9.0E-28
sp|Q28IZ3|RAB19_XENTR Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1 261 383 1.0E-27
sp|Q40520|RB11C_TOBAC Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 235 389 1.0E-27
sp|P56371|RAB4A_MOUSE Ras-related protein Rab-4A OS=Mus musculus GN=Rab4a PE=1 SV=2 261 384 1.0E-27
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 254 388 2.0E-27
sp|Q1KME6|RAB6A_CHICK Ras-related protein Rab-6A OS=Gallus gallus GN=RAB6A PE=2 SV=3 261 384 2.0E-27
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 254 388 2.0E-27
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 250 389 2.0E-27
sp|P61294|RAB6B_MOUSE Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 261 384 2.0E-27
sp|Q9NRW1|RAB6B_HUMAN Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 261 384 2.0E-27
sp|A6QR46|RAB6B_BOVIN Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 261 384 2.0E-27
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 254 388 2.0E-27
sp|Q8MXS1|RAB18_CAEEL Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 261 380 2.0E-27
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 254 388 2.0E-27
sp|Q8BHD0|RB39A_MOUSE Ras-related protein Rab-39A OS=Mus musculus GN=Rab39a PE=1 SV=1 261 391 2.0E-27
sp|Q40522|RB11D_TOBAC Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 235 389 3.0E-27
sp|Q99260|YPT6_YEAST GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 261 386 3.0E-27
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 260 385 3.0E-27
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 261 384 4.0E-27
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 261 384 4.0E-27
sp|P97950|RB33A_MOUSE Ras-related protein Rab-33A OS=Mus musculus GN=Rab33a PE=2 SV=1 235 388 4.0E-27
sp|P25766|RLGP1_ORYSJ Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 261 389 4.0E-27
sp|Q9FJN8|RAA4A_ARATH Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 261 389 4.0E-27
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 261 384 4.0E-27
sp|P35279|RAB6A_MOUSE Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 261 384 4.0E-27
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 261 389 4.0E-27
sp|Q5UQ27|RABL_MIMIV Probable Rab-related GTPase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R214 PE=3 SV=1 246 377 4.0E-27
sp|Q6PHI9|RAB4A_DANRE Ras-related protein Rab-4A OS=Danio rerio GN=rab4a PE=2 SV=2 261 384 5.0E-27
sp|Q14964|RB39A_HUMAN Ras-related protein Rab-39A OS=Homo sapiens GN=RAB39A PE=1 SV=2 261 388 5.0E-27
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 246 389 5.0E-27
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 261 389 5.0E-27
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 261 389 5.0E-27
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 261 389 5.0E-27
sp|P34213|RAB6A_CAEEL Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 261 386 5.0E-27
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 261 389 5.0E-27
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 261 389 5.0E-27
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 261 389 5.0E-27
sp|Q54FL2|RABG2_DICDI Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 261 389 6.0E-27
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 261 386 6.0E-27
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 261 453 7.0E-27
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 261 385 7.0E-27
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 254 388 7.0E-27
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 261 384 7.0E-27
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 261 389 8.0E-27
sp|Q32NQ0|RAB19_XENLA Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1 261 383 8.0E-27
sp|P36019|YPT53_YEAST GTP-binding protein YPT53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT53 PE=1 SV=1 261 377 9.0E-27
sp|Q9SID8|RAH1D_ARATH Ras-related protein RABH1d OS=Arabidopsis thaliana GN=RABH1D PE=3 SV=1 261 384 1.0E-26
sp|Q14088|RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens GN=RAB33A PE=1 SV=2 235 388 1.0E-26
sp|P34142|RAB21_DICDI Ras-related protein Rab-21 OS=Dictyostelium discoideum GN=rab21 PE=1 SV=2 261 383 1.0E-26
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 261 384 1.0E-26
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 261 384 1.0E-26
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 261 384 1.0E-26
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 261 380 1.0E-26
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 261 384 1.0E-26
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 254 388 1.0E-26
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 254 385 1.0E-26
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 250 389 2.0E-26
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 250 389 2.0E-26
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 250 389 2.0E-26
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 250 389 2.0E-26
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 250 389 2.0E-26
sp|Q9FE79|RAA4C_ARATH Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 251 389 2.0E-26
sp|Q9LFT9|RAH1E_ARATH Ras-related protein RABH1e OS=Arabidopsis thaliana GN=RABH1E PE=2 SV=1 261 384 2.0E-26
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 250 383 2.0E-26
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 250 389 2.0E-26
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 250 389 2.0E-26
sp|Q55FK2|RAB6_DICDI Ras-related protein Rab-6 OS=Dictyostelium discoideum GN=rab6 PE=3 SV=1 261 384 2.0E-26
sp|Q5ZHV1|RB33B_CHICK Ras-related protein Rab-33B OS=Gallus gallus GN=RAB33B PE=2 SV=1 261 389 2.0E-26
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 250 389 3.0E-26
sp|P35294|RAB19_MOUSE Ras-related protein Rab-19 OS=Mus musculus GN=Rab19 PE=1 SV=3 261 383 3.0E-26
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 250 389 3.0E-26
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 254 382 3.0E-26
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 250 389 3.0E-26
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 250 389 3.0E-26
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 250 389 3.0E-26
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 250 389 3.0E-26
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 261 384 3.0E-26
sp|Q5M7U5|RAB19_RAT Ras-related protein Rab-19 OS=Rattus norvegicus GN=Rab19 PE=2 SV=1 261 383 4.0E-26
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 261 389 4.0E-26
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 261 384 4.0E-26
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 254 382 4.0E-26
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 254 382 4.0E-26
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 250 389 5.0E-26
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 261 389 5.0E-26
sp|Q5R615|RB33B_PONAB Ras-related protein Rab-33B OS=Pongo abelii GN=RAB33B PE=2 SV=1 261 389 5.0E-26
sp|O35963|RB33B_MOUSE Ras-related protein Rab-33B OS=Mus musculus GN=Rab33b PE=1 SV=1 238 389 6.0E-26
sp|P22127|RAB10_DIPOM Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 261 383 6.0E-26
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 250 389 6.0E-26
sp|Q9H082|RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens GN=RAB33B PE=1 SV=1 261 389 8.0E-26
sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1 261 384 8.0E-26
sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 261 390 8.0E-26
sp|Q5KTJ7|RAB3B_MESAU Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 261 390 8.0E-26
sp|Q55FU9|RAB24_DICDI Ras-related protein Rab-24 OS=Dictyostelium discoideum GN=rab24 PE=3 SV=1 258 377 8.0E-26
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 250 389 8.0E-26
sp|P10948|RAB3B_BOVIN Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 261 390 9.0E-26
sp|O80501|RAH1B_ARATH Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 261 384 9.0E-26
sp|Q3ZC27|RAB19_BOVIN Ras-related protein Rab-19 OS=Bos taurus GN=RAB19 PE=2 SV=1 261 383 1.0E-25
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 250 389 1.0E-25
sp|Q53B90|RAB43_RAT Ras-related protein Rab-43 OS=Rattus norvegicus GN=Rab43 PE=2 SV=1 261 383 1.0E-25
sp|P36409|RAB2A_DICDI Ras-related protein Rab-2A OS=Dictyostelium discoideum GN=rab2A PE=2 SV=2 261 389 1.0E-25
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 250 389 1.0E-25
sp|Q8CG50|RAB43_MOUSE Ras-related protein Rab-43 OS=Mus musculus GN=Rab43 PE=1 SV=1 261 383 1.0E-25
sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 261 389 1.0E-25
sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 261 390 1.0E-25
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 250 389 1.0E-25
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 253 389 2.0E-25
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 261 383 2.0E-25
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 261 383 2.0E-25
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 261 383 2.0E-25
sp|P24409|RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 261 383 2.0E-25
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 250 389 2.0E-25
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 251 386 2.0E-25
sp|A4D1S5|RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2 261 383 2.0E-25
sp|O23561|RAB1A_ARATH Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 261 386 2.0E-25
sp|P35276|RAB3D_MOUSE Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 238 389 2.0E-25
sp|Q63942|RAB3D_RAT GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 238 386 3.0E-25
sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 261 381 3.0E-25
sp|Q95UJ0|RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 261 389 3.0E-25
sp|Q9SJ11|RABG2_ARATH Ras-related protein RABG2 OS=Arabidopsis thaliana GN=RABG2 PE=2 SV=2 261 377 3.0E-25
sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 261 390 3.0E-25
sp|P09527|RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 261 384 3.0E-25
sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 261 384 3.0E-25
sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 261 384 3.0E-25
sp|Q6DUB4|RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 261 383 3.0E-25
sp|P18067|RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 261 384 4.0E-25
sp|Q5R9Y4|RAB7A_PONAB Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 261 384 4.0E-25
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 250 389 4.0E-25
sp|Q3T0F5|RAB7A_BOVIN Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 261 384 4.0E-25
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 261 384 4.0E-25
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 261 384 4.0E-25
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 261 383 5.0E-25
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 261 384 5.0E-25
sp|Q9SF91|RAE1E_ARATH Ras-related protein RABE1e OS=Arabidopsis thaliana GN=RABE1E PE=1 SV=1 254 382 5.0E-25
sp|P35290|RAB24_MOUSE Ras-related protein Rab-24 OS=Mus musculus GN=Rab24 PE=1 SV=2 258 375 6.0E-25
sp|Q9LZD4|RAE1D_ARATH Ras-related protein RABE1d OS=Arabidopsis thaliana GN=RABE1D PE=1 SV=1 254 382 6.0E-25
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 261 386 6.0E-25
sp|Q5JT25|RAB41_HUMAN Ras-related protein Rab-41 OS=Homo sapiens GN=RAB41 PE=1 SV=2 254 386 6.0E-25
sp|O95755|RAB36_HUMAN Ras-related protein Rab-36 OS=Homo sapiens GN=RAB36 PE=2 SV=2 260 377 7.0E-25
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 261 386 7.0E-25
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 250 389 7.0E-25
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 261 389 8.0E-25
sp|Q969Q5|RAB24_HUMAN Ras-related protein Rab-24 OS=Homo sapiens GN=RAB24 PE=1 SV=1 258 375 9.0E-25
sp|Q9ERI2|RB27A_MOUSE Ras-related protein Rab-27A OS=Mus musculus GN=Rab27a PE=1 SV=1 254 389 9.0E-25
sp|O95716|RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 261 389 9.0E-25
sp|P23640|RB27A_RAT Ras-related protein Rab-27A OS=Rattus norvegicus GN=Rab27a PE=1 SV=1 254 389 9.0E-25
sp|Q9HDY0|YPT71_SCHPO GTP-binding protein ypt71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt71 PE=3 SV=1 261 376 1.0E-24
sp|Q05976|RB18A_LYMST Ras-related protein Rab-18A OS=Lymnaea stagnalis GN=RAB18A PE=2 SV=1 266 386 1.0E-24
sp|P62824|RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 261 386 2.0E-24
sp|P62823|RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 261 386 2.0E-24
sp|Q08CX1|RASEF_XENTR Ras and EF-hand domain-containing protein OS=Xenopus tropicalis GN=rasef PE=2 SV=1 250 379 2.0E-24
sp|Q4LE85|RB27A_PIG Ras-related protein Rab-27A OS=Sus scrofa GN=RAB27A PE=2 SV=1 254 389 2.0E-24
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 256 389 2.0E-24
sp|Q5RI75|RASEF_MOUSE Ras and EF-hand domain-containing protein homolog OS=Mus musculus GN=Rasef PE=1 SV=1 261 377 2.0E-24
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 261 385 2.0E-24
sp|P35281|RAB10_RAT Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 261 383 2.0E-24
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 250 389 2.0E-24
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 261 389 2.0E-24
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 255 389 2.0E-24
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 262 389 2.0E-24
sp|Q1HE58|RB27A_CANLF Ras-related protein Rab-27A OS=Canis lupus familiaris GN=RAB27A PE=2 SV=1 254 389 3.0E-24
sp|Q8CAM5|RAB36_MOUSE Ras-related protein Rab-36 OS=Mus musculus GN=Rab36 PE=1 SV=1 260 377 3.0E-24
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 261 383 4.0E-24
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 261 383 4.0E-24
sp|Q9LV79|RAH1A_ARATH Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 255 384 4.0E-24
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 261 383 4.0E-24
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 250 389 5.0E-24
sp|O04157|RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana GN=RABG3B PE=1 SV=1 261 377 5.0E-24
sp|P51159|RB27A_HUMAN Ras-related protein Rab-27A OS=Homo sapiens GN=RAB27A PE=1 SV=3 254 388 6.0E-24
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 261 383 7.0E-24
sp|P36411|RAB7A_DICDI Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 261 388 7.0E-24
sp|Q54E92|RABG1_DICDI Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 261 389 7.0E-24
sp|P91580|RAB33_CIOIN Putative Ras-related protein Rab-33 OS=Ciona intestinalis GN=COS41.2 PE=3 SV=1 261 397 7.0E-24
sp|Q9BZG1|RAB34_HUMAN Ras-related protein Rab-34 OS=Homo sapiens GN=RAB34 PE=1 SV=1 260 377 1.0E-23
sp|Q9XI98|RAG3E_ARATH Ras-related protein RABG3e OS=Arabidopsis thaliana GN=RABG3E PE=2 SV=1 261 377 2.0E-23
sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 OS=Glycine max PE=2 SV=1 261 364 2.0E-23
sp|Q8IZ41|RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens GN=RASEF PE=1 SV=1 261 377 2.0E-23
sp|Q64008|RAB34_MOUSE Ras-related protein Rab-34 OS=Mus musculus GN=Rab34 PE=1 SV=2 260 377 2.0E-23
sp|Q06AU4|RAB34_PIG Ras-related protein Rab-34 OS=Sus scrofa GN=RAB34 PE=2 SV=1 260 377 2.0E-23
sp|Q5U1Y1|RAB34_RAT Ras-related protein Rab-34 OS=Rattus norvegicus GN=Rab34 PE=2 SV=1 260 377 3.0E-23
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 261 364 7.0E-23
sp|Q9LS94|RAG3F_ARATH Ras-related protein RABG3f OS=Arabidopsis thaliana GN=RABG3F PE=2 SV=1 261 377 1.0E-22
sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1 261 364 1.0E-22
sp|Q08DE8|RAB7B_BOVIN Ras-related protein Rab-7b OS=Bos taurus GN=RAB7B PE=2 SV=1 258 389 2.0E-22
sp|Q8VEA8|RAB7B_MOUSE Ras-related protein Rab-7b OS=Mus musculus GN=Rab7b PE=1 SV=1 258 402 2.0E-22
sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 261 389 3.0E-22
sp|Q558I0|RABF1_DICDI Ras-related protein RabF1 OS=Dictyostelium discoideum GN=rabF1-1 PE=3 SV=1 261 389 3.0E-22
sp|Q99P75|RAB9A_RAT Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 261 389 3.0E-22
sp|Q20365|RAB33_CAEEL Ras-related protein Rab-33 OS=Caenorhabditis elegans GN=rab-33 PE=2 SV=1 245 390 4.0E-22
sp|P31022|RAB7_PEA Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 261 389 5.0E-22
sp|Q9H0N0|RAB6C_HUMAN Ras-related protein Rab-6C OS=Homo sapiens GN=RAB6C PE=1 SV=2 261 384 6.0E-22
sp|Q7Z6P3|RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens GN=RAB44 PE=1 SV=3 262 384 7.0E-22
sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1 261 389 8.0E-22
sp|P24408|RAB9A_CANLF Ras-related protein Rab-9A OS=Canis lupus familiaris GN=RAB9A PE=1 SV=2 261 389 8.0E-22
sp|Q40787|RAB7_CENCI Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2 SV=1 261 377 8.0E-22
sp|Q9C820|RAG3D_ARATH Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 261 377 1.0E-21
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 261 389 1.0E-21
sp|Q5R4W9|RAB9B_PONAB Ras-related protein Rab-9B OS=Pongo abelii GN=RAB9B PE=2 SV=1 261 389 1.0E-21
sp|P38146|YPT10_YEAST GTP-binding protein YPT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT10 PE=1 SV=2 261 384 1.0E-21
sp|Q9NP90|RAB9B_HUMAN Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1 261 389 1.0E-21
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 261 386 2.0E-21
sp|Q948K6|RABG1_ARATH Ras-related protein RABG1 OS=Arabidopsis thaliana GN=RABG1 PE=2 SV=1 261 379 2.0E-21
sp|Q5R7A4|RAB7L_PONAB Ras-related protein Rab-7L1 OS=Pongo abelii GN=RAB29 PE=2 SV=1 261 358 2.0E-21
sp|O14966|RAB7L_HUMAN Ras-related protein Rab-7L1 OS=Homo sapiens GN=RAB29 PE=1 SV=1 261 358 2.0E-21
sp|O24461|RAB7_PRUAR Ras-related protein Rab7 OS=Prunus armeniaca PE=2 SV=1 261 377 2.0E-21
sp|Q96AH8|RAB7B_HUMAN Ras-related protein Rab-7b OS=Homo sapiens GN=RAB7B PE=2 SV=1 258 381 2.0E-21
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 251 389 3.0E-21
sp|Q91YQ1|RAB7L_MOUSE Ras-related protein Rab-7L1 OS=Mus musculus GN=Rab29 PE=1 SV=1 261 358 3.0E-21
sp|Q63481|RAB7L_RAT Ras-related protein Rab-7L1 OS=Rattus norvegicus GN=Rab29 PE=1 SV=1 261 358 3.0E-21
sp|Q8BHH2|RAB9B_MOUSE Ras-related protein Rab-9B OS=Mus musculus GN=Rab9b PE=1 SV=1 261 389 4.0E-21
sp|Q9XER8|RAB7_GOSHI Ras-related protein Rab7 OS=Gossypium hirsutum GN=RAB7 PE=2 SV=1 261 377 6.0E-21
sp|Q9LW76|RAG3C_ARATH Ras-related protein RABG3c OS=Arabidopsis thaliana GN=RABG3C PE=2 SV=1 261 377 7.0E-21
sp|Q22908|RASEF_CAEEL Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans GN=tag-312 PE=3 SV=2 261 377 2.0E-20
sp|Q619T5|RASEF_CAEBR Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae GN=tag-312 PE=3 SV=1 261 377 2.0E-20
sp|P93267|RAB7_MESCR Ras-related protein Rab7A OS=Mesembryanthemum crystallinum PE=2 SV=1 261 364 3.0E-20
sp|Q54FK7|RABL_DICDI Ras-related protein RabL OS=Dictyostelium discoideum GN=rabL PE=3 SV=1 261 377 3.0E-20
sp|Q8CB87|RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus GN=Rab44 PE=1 SV=1 245 389 1.0E-19
sp|P35288|RAB23_MOUSE Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 255 358 3.0E-19
sp|Q9ULC3|RAB23_HUMAN Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 255 358 3.0E-19
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 254 384 4.0E-19
sp|Q9UBK7|RBL2A_HUMAN Rab-like protein 2A OS=Homo sapiens GN=RABL2A PE=1 SV=1 253 396 7.0E-19
sp|Q9NX57|RAB20_HUMAN Ras-related protein Rab-20 OS=Homo sapiens GN=RAB20 PE=1 SV=1 259 377 1.0E-18
sp|Q9UNT1|RBL2B_HUMAN Rab-like protein 2B OS=Homo sapiens GN=RABL2B PE=2 SV=1 253 396 1.0E-18
sp|Q41254|RAC9_GOSHI Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 261 386 3.0E-18
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 261 386 3.0E-18
sp|Q54FG4|RABP_DICDI Ras-related protein RabP OS=Dictyostelium discoideum GN=rabP PE=3 SV=2 258 385 3.0E-18
sp|Q39435|RAC1_BETVU Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 261 386 3.0E-18
sp|Q38902|RAC1_ARATH Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 261 386 4.0E-18
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 261 386 4.0E-18
sp|Q86JC8|RABH_DICDI Ras-related protein RabH OS=Dictyostelium discoideum GN=rabH PE=3 SV=1 258 380 4.0E-18
sp|Q55EF0|RABT2_DICDI Ras-related protein RabT2 OS=Dictyostelium discoideum GN=rabT2 PE=3 SV=1 261 377 5.0E-18
sp|P92978|RAC11_ARATH Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 261 386 5.0E-18
sp|Q55EG6|RABT1_DICDI Ras-related protein RabT1 OS=Dictyostelium discoideum GN=rabT1 PE=3 SV=1 261 377 5.0E-18
sp|E9Q9D5|RBL2A_MOUSE Rab-like protein 2A OS=Mus musculus GN=Rabl2 PE=1 SV=1 253 376 6.0E-18
sp|Q54P07|RB32D_DICDI Ras-related protein Rab-32D OS=Dictyostelium discoideum GN=rab32D PE=3 SV=1 261 376 7.0E-18
sp|Q5R573|RBL2A_PONAB Rab-like protein 2A OS=Pongo abelii GN=RABL2A PE=2 SV=1 261 376 7.0E-18
sp|Q9SU67|RAC8_ARATH Rac-like GTP-binding protein ARAC8 OS=Arabidopsis thaliana GN=ARAC8 PE=1 SV=2 261 391 7.0E-18
sp|Q8MXQ2|RB32C_DICDI Ras-related protein Rab-32C OS=Dictyostelium discoideum GN=rab32C PE=3 SV=2 257 354 9.0E-18
sp|Q40220|RAC2_LOTJA Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1 261 386 9.0E-18
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 261 382 1.0E-17
sp|Q6Z7L8|RAC7_ORYSJ Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 261 386 1.0E-17
sp|Q38903|RAC2_ARATH Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1 261 386 1.0E-17
sp|Q6EP31|RAC5_ORYSJ Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 261 386 2.0E-17
sp|Q54K69|RAB7B_DICDI Ras-related protein Rab-7B OS=Dictyostelium discoideum GN=rab7B PE=3 SV=1 261 354 2.0E-17
sp|P35295|RAB20_MOUSE Ras-related protein Rab-20 OS=Mus musculus GN=Rab20 PE=2 SV=2 259 381 2.0E-17
sp|Q54FK8|RABM_DICDI Ras-related protein RabM OS=Dictyostelium discoideum GN=rabM PE=3 SV=2 261 377 2.0E-17
sp|Q6ZHA3|RAC6_ORYSJ Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1 261 386 3.0E-17
sp|O04369|RAC1_LOTJA Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 261 386 3.0E-17
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 261 382 3.0E-17
sp|P48554|RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1 261 387 5.0E-17
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 261 386 5.0E-17
sp|A5D7J5|RHOU_BOVIN Rho-related GTP-binding protein RhoU OS=Bos taurus GN=RHOU PE=2 SV=1 256 390 7.0E-17
sp|Q38919|RAC4_ARATH Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1 261 386 8.0E-17
sp|Q99KL7|RAB28_MOUSE Ras-related protein Rab-28 OS=Mus musculus GN=Rab28 PE=1 SV=1 261 386 8.0E-17
sp|P51157|RAB28_HUMAN Ras-related protein Rab-28 OS=Homo sapiens GN=RAB28 PE=1 SV=2 261 383 9.0E-17
sp|Q67VP4|RAC4_ORYSJ Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 261 386 1.0E-16
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 261 386 1.0E-16
sp|Q54QR3|RB32A_DICDI Ras-related protein Rab-32A OS=Dictyostelium discoideum GN=rab32A PE=1 SV=1 251 358 2.0E-16
sp|Q5RFI2|RAB28_PONAB Ras-related protein Rab-28 OS=Pongo abelii GN=RAB28 PE=2 SV=1 261 383 2.0E-16
sp|O82480|RAC7_ARATH Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 261 386 2.0E-16
sp|Q13637|RAB32_HUMAN Ras-related protein Rab-32 OS=Homo sapiens GN=RAB32 PE=1 SV=3 261 358 2.0E-16
sp|Q03206|RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans GN=ced-10 PE=1 SV=2 261 387 2.0E-16
sp|P51158|RAB28_RAT Ras-related protein Rab-28 OS=Rattus norvegicus GN=Rab28 PE=2 SV=1 261 386 2.0E-16
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 261 386 2.0E-16
sp|Q3SWY9|RAB28_BOVIN Ras-related protein Rab-28 OS=Bos taurus GN=RAB28 PE=2 SV=1 261 383 2.0E-16
sp|Q54FK5|RABN1_DICDI Ras-related protein RabN1 OS=Dictyostelium discoideum GN=rabN1 PE=3 SV=1 261 377 3.0E-16
sp|P33153|CRL1_CANAW GTP-binding RHO-like protein OS=Candida albicans (strain WO-1) GN=CRL1 PE=3 SV=2 247 377 3.0E-16
sp|P57729|RAB38_HUMAN Ras-related protein Rab-38 OS=Homo sapiens GN=RAB38 PE=1 SV=1 261 358 3.0E-16
sp|Q2HJG3|RHOH_BOVIN Rho-related GTP-binding protein RhoH OS=Bos taurus GN=RHOH PE=2 SV=1 261 368 4.0E-16
sp|Q7L0Q8|RHOU_HUMAN Rho-related GTP-binding protein RhoU OS=Homo sapiens GN=RHOU PE=1 SV=1 261 390 4.0E-16
sp|Q8QZZ8|RAB38_MOUSE Ras-related protein Rab-38 OS=Mus musculus GN=Rab38 PE=1 SV=1 261 358 4.0E-16
sp|Q96S21|RB40C_HUMAN Ras-related protein Rab-40C OS=Homo sapiens GN=RAB40C PE=1 SV=1 254 389 4.0E-16
sp|Q8VHQ4|RB40C_MOUSE Ras-related protein Rab-40C OS=Mus musculus GN=Rab40c PE=1 SV=1 254 389 5.0E-16
sp|Q6RUV5|RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 261 387 5.0E-16
sp|P63001|RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 261 387 5.0E-16
sp|P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1 261 387 5.0E-16
sp|P62999|RAC1_CANLF Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris GN=RAC1 PE=2 SV=1 261 387 5.0E-16
sp|P62998|RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1 261 387 5.0E-16
sp|Q41253|RAC13_GOSHI Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1 261 386 5.0E-16
sp|Q9EQT3|RHOU_MOUSE Rho-related GTP-binding protein RhoU OS=Mus musculus GN=Rhou PE=2 SV=1 261 390 6.0E-16
sp|Q9D3G9|RHOH_MOUSE Rho-related GTP-binding protein RhoH OS=Mus musculus GN=Rhoh PE=1 SV=1 261 368 7.0E-16
sp|Q15669|RHOH_HUMAN Rho-related GTP-binding protein RhoH OS=Homo sapiens GN=RHOH PE=1 SV=1 261 368 8.0E-16
sp|P40792|RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster GN=Rac1 PE=1 SV=2 261 387 8.0E-16
sp|O82481|RAC10_ARATH Rac-like GTP-binding protein ARAC10 OS=Arabidopsis thaliana GN=ARAC10 PE=1 SV=1 261 391 8.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005525 GTP binding Yes
GO:0005840 ribosome Yes
GO:0003924 GTPase activity Yes
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0043603 cellular amide metabolic process No
GO:0019538 protein metabolic process No
GO:0043229 intracellular organelle No
GO:1901576 organic substance biosynthetic process No
GO:0017111 nucleoside-triphosphatase activity No
GO:0043043 peptide biosynthetic process No
GO:0016462 pyrophosphatase activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0036094 small molecule binding No
GO:0017076 purine nucleotide binding No
GO:0044238 primary metabolic process No
GO:0000166 nucleotide binding No
GO:0043604 amide biosynthetic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0032553 ribonucleotide binding No
GO:0008152 metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0043228 non-membrane-bounded organelle No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043226 organelle No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0006518 peptide metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072570
MIPKKEVNSVSKFGLVVAWSLIKMSVNNKILRTANAPTSPPDEIEIAVAQALIDLENNVPELKNELRALQISAAR
EVDVRGGKKAIVVFVPVPQLNAFHKIQARLTRELEKKFSDRHVVFIAQRRMLRKPTRNSRVKQKRPRSRTLTNVH
EKILEDLVHPTEIVGKRTRVGVDGSKLLKVFLDSKDQTSLEYKLDSFSSVYRRLTGKEVVFEFPVVSQDEPGEPA
REMMDLKGKSGYGSACSPPAMDPYVHPRYDHGIDSKIVVMGNSGVGKTSLLHRYTQNRFDPKNTTSTSGAFFVTK
KVLVNGLKVRLQLWDTAGQERFRSMAPMYYRGANAALLLYDITNSSTFEDVRGWLQELRKNCSPELIIYIVGAKA
DLHHRRQVTSDLARLSLHNWFPPPKPPPPVPPPPPPSTLSYIRPRFTSFPGLRSHSAPSCSPVSPETPAYLDLPS
SRASALQRSKTTMQTRPRTANSLTRSNASSGSRTPQSSRFGSHFGFGGGWDAHGDNSSNSIEEEDEYAVDPESDE
GEWGLSKGMELFEVSAKDDVGIQGLFDHLISAIILRKDAIEQENEARKRDSVFLSNVCTPAWSAQADEEEARQKA
QQRSGSWSCC*
Coding >AgabiH97|072570
ATGATTCCAAAAAAGGAAGTCAACTCTGTATCTAAGTTTGGCCTTGTTGTGGCCTGGTCCCTCATCAAGATGTCG
GTGAACAACAAAATCCTCCGCACGGCCAATGCGCCCACCTCTCCCCCCGATGAGATTGAAATCGCCGTCGCTCAG
GCTCTCATTGACCTCGAAAACAATGTCCCTGAACTCAAGAATGAGCTCCGTGCCCTTCAAATTTCTGCTGCCCGT
GAAGTTGATGTCCGGGGTGGCAAAAAAGCTATTGTTGTTTTTGTTCCCGTCCCACAATTGAACGCTTTCCACAAA
ATCCAGGCTAGGCTGACACGAGAATTGGAAAAGAAGTTTTCCGATCGCCACGTCGTTTTTATCGCCCAGCGCCGA
ATGTTGCGCAAACCCACGCGTAATTCGCGGGTTAAGCAGAAGAGGCCTCGTAGCCGTACGCTCACGAACGTGCAC
GAAAAGATCCTTGAGGATCTCGTCCACCCTACCGAGATCGTTGGCAAGAGGACGCGTGTAGGAGTGGACGGTTCG
AAATTGCTGAAAGTGTTCCTTGACTCAAAAGACCAAACATCACTCGAGTACAAGCTTGACTCGTTTTCGTCGGTG
TACCGCCGTCTGACAGGGAAGGAGGTTGTGTTTGAATTTCCGGTAGTGTCGCAGGACGAACCGGGCGAGCCAGCT
CGTGAGATGATGGACTTGAAAGGCAAGAGCGGATATGGCAGCGCCTGTTCGCCCCCCGCCATGGACCCCTACGTC
CACCCCCGCTACGACCATGGCATCGACTCCAAAATCGTCGTCATGGGCAACTCGGGCGTCGGCAAAACCTCCCTC
CTCCACAGATACACCCAGAACAGATTCGACCCAAAAAACACAACCTCCACCAGCGGCGCCTTCTTCGTCACCAAG
AAAGTCCTCGTTAACGGCCTCAAAGTCCGCCTCCAGCTCTGGGACACTGCTGGTCAGGAGCGTTTTCGCAGCATG
GCACCCATGTATTATCGAGGCGCAAACGCCGCTCTCCTTCTCTATGACATTACGAATTCCTCCACGTTTGAAGAC
GTCCGCGGCTGGCTGCAAGAACTAAGGAAGAATTGCTCTCCAGAGCTCATTATCTACATCGTTGGTGCCAAAGCT
GACCTCCACCATCGCCGCCAGGTCACCTCCGACCTCGCTCGTTTGTCCCTCCACAACTGGTTCCCTCCACCCAAA
CCACCACCTCCCGTCCCTCCGCCCCCTCCTCCATCTACGCTCTCTTACATCCGTCCCCGCTTCACATCCTTCCCC
GGCCTTCGATCCCACTCTGCTCCATCATGTTCCCCTGTATCCCCTGAAACACCTGCTTATCTTGACCTGCCCTCT
AGTCGGGCATCAGCACTACAGCGAAGCAAGACTACTATGCAAACCCGCCCACGTACCGCAAACTCGCTTACGCGA
TCCAATGCAAGCTCCGGCTCTCGTACACCTCAATCTTCTAGATTTGGATCACATTTTGGCTTTGGAGGAGGCTGG
GACGCCCATGGCGATAACAGCAGTAACAGCATTGAAGAAGAAGACGAATATGCCGTAGACCCGGAAAGCGACGAA
GGAGAATGGGGACTTAGTAAGGGAATGGAACTGTTCGAAGTATCTGCCAAGGATGACGTTGGCATCCAAGGTCTC
TTTGACCACCTCATATCCGCCATCATTCTCAGAAAGGATGCGATCGAGCAAGAAAACGAAGCAAGGAAACGTGAT
AGTGTATTCTTATCAAACGTTTGTACCCCCGCCTGGTCGGCCCAGGCGGATGAAGAAGAGGCTCGCCAGAAAGCC
CAGCAACGCTCTGGCAGTTGGAGTTGCTGCTAG
Transcript >AgabiH97|072570
ATGATTCCAAAAAAGGAAGTCAACTCTGTATCTAAGTTTGGCCTTGTTGTGGCCTGGTCCCTCATCAAGATGTCG
GTGAACAACAAAATCCTCCGCACGGCCAATGCGCCCACCTCTCCCCCCGATGAGATTGAAATCGCCGTCGCTCAG
GCTCTCATTGACCTCGAAAACAATGTCCCTGAACTCAAGAATGAGCTCCGTGCCCTTCAAATTTCTGCTGCCCGT
GAAGTTGATGTCCGGGGTGGCAAAAAAGCTATTGTTGTTTTTGTTCCCGTCCCACAATTGAACGCTTTCCACAAA
ATCCAGGCTAGGCTGACACGAGAATTGGAAAAGAAGTTTTCCGATCGCCACGTCGTTTTTATCGCCCAGCGCCGA
ATGTTGCGCAAACCCACGCGTAATTCGCGGGTTAAGCAGAAGAGGCCTCGTAGCCGTACGCTCACGAACGTGCAC
GAAAAGATCCTTGAGGATCTCGTCCACCCTACCGAGATCGTTGGCAAGAGGACGCGTGTAGGAGTGGACGGTTCG
AAATTGCTGAAAGTGTTCCTTGACTCAAAAGACCAAACATCACTCGAGTACAAGCTTGACTCGTTTTCGTCGGTG
TACCGCCGTCTGACAGGGAAGGAGGTTGTGTTTGAATTTCCGGTAGTGTCGCAGGACGAACCGGGCGAGCCAGCT
CGTGAGATGATGGACTTGAAAGGCAAGAGCGGATATGGCAGCGCCTGTTCGCCCCCCGCCATGGACCCCTACGTC
CACCCCCGCTACGACCATGGCATCGACTCCAAAATCGTCGTCATGGGCAACTCGGGCGTCGGCAAAACCTCCCTC
CTCCACAGATACACCCAGAACAGATTCGACCCAAAAAACACAACCTCCACCAGCGGCGCCTTCTTCGTCACCAAG
AAAGTCCTCGTTAACGGCCTCAAAGTCCGCCTCCAGCTCTGGGACACTGCTGGTCAGGAGCGTTTTCGCAGCATG
GCACCCATGTATTATCGAGGCGCAAACGCCGCTCTCCTTCTCTATGACATTACGAATTCCTCCACGTTTGAAGAC
GTCCGCGGCTGGCTGCAAGAACTAAGGAAGAATTGCTCTCCAGAGCTCATTATCTACATCGTTGGTGCCAAAGCT
GACCTCCACCATCGCCGCCAGGTCACCTCCGACCTCGCTCGTTTGTCCCTCCACAACTGGTTCCCTCCACCCAAA
CCACCACCTCCCGTCCCTCCGCCCCCTCCTCCATCTACGCTCTCTTACATCCGTCCCCGCTTCACATCCTTCCCC
GGCCTTCGATCCCACTCTGCTCCATCATGTTCCCCTGTATCCCCTGAAACACCTGCTTATCTTGACCTGCCCTCT
AGTCGGGCATCAGCACTACAGCGAAGCAAGACTACTATGCAAACCCGCCCACGTACCGCAAACTCGCTTACGCGA
TCCAATGCAAGCTCCGGCTCTCGTACACCTCAATCTTCTAGATTTGGATCACATTTTGGCTTTGGAGGAGGCTGG
GACGCCCATGGCGATAACAGCAGTAACAGCATTGAAGAAGAAGACGAATATGCCGTAGACCCGGAAAGCGACGAA
GGAGAATGGGGACTTAGTAAGGGAATGGAACTGTTCGAAGTATCTGCCAAGGATGACGTTGGCATCCAAGGTCTC
TTTGACCACCTCATATCCGCCATCATTCTCAGAAAGGATGCGATCGAGCAAGAAAACGAAGCAAGGAAACGTGAT
AGTGTATTCTTATCAAACGTTTGTACCCCCGCCTGGTCGGCCCAGGCGGATGAAGAAGAGGCTCGCCAGAAAGCC
CAGCAACGCTCTGGCAGTTGGAGTTGCTGCTAG
Gene >AgabiH97|072570
ATGATTCCAAAAAAGGAAGTCAACTCTGTATCTAAGTTTGGCCTTGTTGTGGTAAGCCAGCCCGTCTGCCTGGTC
ATCAAGAAACCTCTCATCAACGTCGTTGTCGTCGTCAAAAGGCCTGGTAAGTCCCGATTTATGCCCGTCTATGTT
GCGCGATCCAGTGAGGATGGTTCAATCATGCTGGAAAGACGAGGATTGGAAGGGTTGAGATGGATGGCGCGTTTC
GAGTGTGGATGTGGGATCTCAAGCTGATAGTGCCTTCTCTGCGTATGCCAGGTCCCTCATCAAGATGTCGGTGAA
CAACAAAATCCTCCGCACGGCCAATGCGCCCACCTCTCCCCCCGATGAGATTGAAATCGCCGTCGCTCAGGCTCT
CATTGACCTCGAAAACAATGTCCCTGAACTCAAGAATGAGCTCCGTGCCCTTCAAATTTCTGCTGCCCGTGAAGT
TGATGTCCGGGGTGGCAAAAAAGCTATTGTTGTTTTTGTTCCCGTCCCACAATTGAACGCTTTCCACAAAATCCA
GGCTAGGTGGGTTTACGGCTGCTTGATTGTGTCTATTATAGGATGATGATTGACCAGTGGAGCAGGCTGACACGA
GAATTGGAAAAGAAGTTTTCCGATCGCCACGTCGTTTTTATCGCCCAGCGCCGAATGTTGCGCAAACCCACGCGT
AATTCGCGGGTTAAGCAGAAGAGGCCTCGTAGCCGTACGCTCACGAACGTGCACGAAAAGATCCTTGAGGATCTC
GTCCACCCTACCGAGATCGTTGGCAAGAGGACGCGTGTAGGAGTGGACGGTTCGAAATTGCTGAAAGTGTATGTG
CCCAATCTGATACAGGGAAAAAGAGACGCTGACGGATTTATTGGCATCTGACAGGTTCCTTGACTCAAAAGACCA
AACATCACTCGAGTACAAGCTTGACTCGTTTTCGTCGGTGTACCGCCGTCTGACAGGGAAGGAGGTTGTGTTTGA
ATTTCCGGTAGTGTCGCAGGAGTAGATAGATAGCTGTAGCGAACATGGCATTTCTGACCTGGAGAAGCGAACCGG
GCGAGCCAGCTCGTGAGATGATGGACTTGAAAGGCAAGAGCGGATATGGCAGCGCCTGTTCGCCCCCCGCCATGG
ACCCCTACGTCCACCCCCGCTACGACCATGGCATCGACTCCAAAATCGTCGTCATGGGCAACTCGGGCGTCGGCA
AAACCTCCCTCCTCCACAGATACACCCAGAACAGATTCGACCCAAAAAACACAACCTCCACCAGCGGCGCCTTCT
TCGTCACCAAGAAAGTCCTCGTTAACGGCCTCAAAGTCCGCCTCCAGCTCTGGGACACTGCTGGTCAGGAGCGTT
TTCGCAGCATGGTAATTTCCTCTCCCCTGCGCCCCCTTTTTTACTTCTCACCAGTGTTGTCTAGGCACCCATGTA
TTATCGAGGTATCAGTTAGCCATTTGTCTTCCCTCTCCTTTCCACTCACCCGCCCTTCCAGGCGCAAACGCCGCT
CTCCTTCTCTATGACATTACGAATTCCTCCACGTTTGAAGACGTCCGCGGCTGGCTGCAAGGTGTGTGCACTACA
CCATTCCACCTGTCAAACGCTCATTCCCCCTGCAGAACTAAGGAAGAATTGCTCTCCAGAGCTCATTATCTACAT
CGTTGGTGCCAAAGCTGACCTCCACCATCGCCGCCAGGTCACCTCCGACCTCGCTCGTTTGTCCCTCCACAACTG
GTTCCCTCCACCCAAACCACCACCTCCCGTCCCTCCGCCCCCTCCTCCATCTACGCTCTCTTACATCCGTCCCCG
CTTCACATCCTTCCCCGGCCTTCGATCCCACTCTGCTCCATCATGTTCCCCTGTATCCCCTGAAACACCTGCTTA
TCTTGACCTGCCCTCTAGTCGGGCATCAGCACTACAGCGAAGCAAGACTACTATGCAAACCCGCCCACGTACCGC
AAACTCGCTTACGCGATCCAATGCAAGCTCCGGCTCTCGTACACCTCAATCTTCTAGATTTGGATCACATTTTGG
CTTTGGAGGAGGCTGGGACGCCCATGGCGATAACAGCAGTAACAGCATTGAAGAAGAAGACGAATATGCCGTAGA
CCCGGAAAGCGACGAAGGAGAATGGGGACTTAGTAAGGGAATGGAACTGTTCGAAGTATCTGCCAAGGATGACGT
TGGTACGTTTGCTTCAGGAACCAGCTGATCGACGCCCAGGCTGACGATTGTCTTTAGGCATCCAAGGTCTCTTTG
ACCACCTCATATCCGCCATCATTCTCAGAAAGGATGCGATCGAGCAAGAAAACGAAGCAAGGAAACGTGATAGTG
TATTCTTATCAAACGTTTGTACCCCCGCCTGGTCGGCCCAGGCGGATGAAGAAGAGGCTCGCCAGAAAGCCCAGC
AACGCTCTGGCAGTTGGAGTTGCTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail