Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072530
Gene name
Locationscaffold_4:1744808..1746633
Strand+
Gene length (bp)1825
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05291 Bystin Bystin 6.9E-122 143 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A9UNU6|BYST_MONBE Bystin OS=Monosiga brevicollis GN=bysl PE=3 SV=1 10 434 3.0E-103
sp|O60071|YBB9_SCHPO Uncharacterized protein C13G1.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.09 PE=1 SV=1 55 434 3.0E-101
sp|Q5E9N0|BYST_BOVIN Bystin OS=Bos taurus GN=BYSL PE=2 SV=1 12 434 8.0E-98
sp|Q13895|BYST_HUMAN Bystin OS=Homo sapiens GN=BYSL PE=1 SV=3 12 434 3.0E-96
sp|Q80WL2|BYST_RAT Bystin OS=Rattus norvegicus GN=Bysl PE=1 SV=3 12 434 3.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A9UNU6|BYST_MONBE Bystin OS=Monosiga brevicollis GN=bysl PE=3 SV=1 10 434 3.0E-103
sp|O60071|YBB9_SCHPO Uncharacterized protein C13G1.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.09 PE=1 SV=1 55 434 3.0E-101
sp|Q5E9N0|BYST_BOVIN Bystin OS=Bos taurus GN=BYSL PE=2 SV=1 12 434 8.0E-98
sp|Q13895|BYST_HUMAN Bystin OS=Homo sapiens GN=BYSL PE=1 SV=3 12 434 3.0E-96
sp|Q80WL2|BYST_RAT Bystin OS=Rattus norvegicus GN=Bysl PE=1 SV=3 12 434 3.0E-96
sp|O54825|BYST_MOUSE Bystin OS=Mus musculus GN=Bysl PE=1 SV=3 60 434 1.0E-95
sp|Q20932|BYN1_CAEEL Cell adhesion protein byn-1 OS=Caenorhabditis elegans GN=byn-1 PE=3 SV=2 13 438 6.0E-93
sp|A7S7F2|BYST_NEMVE Bystin OS=Nematostella vectensis GN=bysl PE=3 SV=1 32 434 3.0E-87
sp|P51406|BYS_DROME Bystin OS=Drosophila melanogaster GN=bys PE=1 SV=2 10 437 5.0E-87
sp|Q54IS0|BYST_DICDI Bystin OS=Dictyostelium discoideum GN=bysl PE=3 SV=1 1 434 2.0E-86
sp|P38333|ENP1_YEAST Essential nuclear protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENP1 PE=1 SV=1 1 434 1.0E-84
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072530
MPRAQSQPQKPRHAPLHVQLNEDQAQAKYGRLSQPGKRKKSRKSDDDHDVPDVTLDQQTSRKIFELAKDQQDEFE
VPDVDEEVPDDQINTLSFTQLRSQSEEEEAEEAEDESNLDDYQEFEEELEIDEEDIRTLSALLPANSTERRTLAD
VIFAKLDNAENNSAATIQRVHQDREKPDPALGLNPTVVEAYTKLGLFLHKYKSGPLPKLFKVIPSLPAWARMLAL
TSPENWSPHACRAATRIFISSMKPPQAQLFLSVVLLDAIREDIHENKKLNVQYYEALKRALYKPGAVFKGIIFPM
LEQGCTLKEAAIVASILARTKVPVLHASAALLRIAEMDYSGPNSLFIRVLIDKKFELPYKVVDALVFHYIRLSNT
YKAKTRGDSDKLPVLWHQSLLAFCQRYASDLTPEQKGALLDVVRATPHHQIGSEIRRELSCRK*
Coding >AgabiH97|072530
ATGCCTCGCGCCCAGTCCCAGCCACAGAAGCCCAGACACGCCCCCCTCCACGTCCAGCTAAATGAAGACCAGGCT
CAGGCAAAGTACGGCCGCCTTTCCCAGCCAGGAAAACGCAAAAAGTCGCGGAAATCAGACGACGACCATGACGTC
CCAGATGTCACCCTAGATCAACAAACGTCTCGCAAGATCTTTGAACTCGCCAAAGACCAACAGGATGAATTCGAG
GTACCAGATGTTGATGAAGAAGTCCCCGATGATCAAATCAATACTCTTTCGTTCACTCAACTGCGCTCACAATCT
GAGGAAGAGGAGGCAGAGGAGGCAGAGGATGAATCAAATCTTGATGACTACCAGGAATTTGAAGAAGAGCTTGAA
ATAGATGAAGAAGATATTCGAACCTTGAGTGCCCTGTTACCTGCAAACTCTACAGAACGGCGAACCTTGGCAGAC
GTTATCTTTGCCAAACTGGATAATGCTGAAAACAACTCGGCGGCCACAATTCAAAGAGTGCATCAAGATCGAGAG
AAACCTGATCCTGCCCTTGGTCTCAATCCCACAGTTGTTGAAGCTTATACCAAGCTAGGACTCTTCCTGCATAAA
TACAAGTCAGGACCCTTACCTAAACTTTTTAAAGTTATTCCTTCTCTTCCAGCATGGGCCCGAATGCTGGCACTC
ACAAGCCCTGAGAATTGGTCTCCCCATGCCTGCCGAGCCGCCACACGAATTTTTATCTCCAGTATGAAGCCCCCT
CAAGCACAGTTATTTCTTAGCGTGGTCCTATTAGATGCTATCCGGGAAGATATTCATGAAAATAAGAAACTTAAT
GTCCAATACTACGAGGCACTGAAACGAGCGTTGTACAAGCCTGGCGCAGTCTTCAAAGGGATCATTTTCCCCATG
CTCGAACAAGGATGCACTTTGAAGGAGGCTGCGATTGTTGCCTCAATTCTTGCTCGTACGAAGGTGCCTGTCTTA
CACGCCTCAGCGGCCTTGCTTCGGATTGCGGAAATGGATTATTCAGGCCCAAATTCCCTGTTTATCCGCGTTTTG
ATTGATAAGAAGTTTGAGCTGCCATACAAGGTGGTAGACGCTCTGGTCTTCCATTATATTCGGCTGTCCAACACA
TATAAAGCCAAAACAAGGGGTGACTCCGACAAACTTCCTGTTCTTTGGCACCAGAGTCTACTAGCCTTTTGCCAA
CGTTATGCGTCGGATTTGACTCCAGAACAAAAAGGTGCATTGTTAGATGTTGTAAGAGCGACCCCACACCATCAA
ATCGGTTCCGAAATTAGGAGGGAACTTTCATGTCGTAAGTAA
Transcript >AgabiH97|072530
ATGCCTCGCGCCCAGTCCCAGCCACAGAAGCCCAGACACGCCCCCCTCCACGTCCAGCTAAATGAAGACCAGGCT
CAGGCAAAGTACGGCCGCCTTTCCCAGCCAGGAAAACGCAAAAAGTCGCGGAAATCAGACGACGACCATGACGTC
CCAGATGTCACCCTAGATCAACAAACGTCTCGCAAGATCTTTGAACTCGCCAAAGACCAACAGGATGAATTCGAG
GTACCAGATGTTGATGAAGAAGTCCCCGATGATCAAATCAATACTCTTTCGTTCACTCAACTGCGCTCACAATCT
GAGGAAGAGGAGGCAGAGGAGGCAGAGGATGAATCAAATCTTGATGACTACCAGGAATTTGAAGAAGAGCTTGAA
ATAGATGAAGAAGATATTCGAACCTTGAGTGCCCTGTTACCTGCAAACTCTACAGAACGGCGAACCTTGGCAGAC
GTTATCTTTGCCAAACTGGATAATGCTGAAAACAACTCGGCGGCCACAATTCAAAGAGTGCATCAAGATCGAGAG
AAACCTGATCCTGCCCTTGGTCTCAATCCCACAGTTGTTGAAGCTTATACCAAGCTAGGACTCTTCCTGCATAAA
TACAAGTCAGGACCCTTACCTAAACTTTTTAAAGTTATTCCTTCTCTTCCAGCATGGGCCCGAATGCTGGCACTC
ACAAGCCCTGAGAATTGGTCTCCCCATGCCTGCCGAGCCGCCACACGAATTTTTATCTCCAGTATGAAGCCCCCT
CAAGCACAGTTATTTCTTAGCGTGGTCCTATTAGATGCTATCCGGGAAGATATTCATGAAAATAAGAAACTTAAT
GTCCAATACTACGAGGCACTGAAACGAGCGTTGTACAAGCCTGGCGCAGTCTTCAAAGGGATCATTTTCCCCATG
CTCGAACAAGGATGCACTTTGAAGGAGGCTGCGATTGTTGCCTCAATTCTTGCTCGTACGAAGGTGCCTGTCTTA
CACGCCTCAGCGGCCTTGCTTCGGATTGCGGAAATGGATTATTCAGGCCCAAATTCCCTGTTTATCCGCGTTTTG
ATTGATAAGAAGTTTGAGCTGCCATACAAGGTGGTAGACGCTCTGGTCTTCCATTATATTCGGCTGTCCAACACA
TATAAAGCCAAAACAAGGGGTGACTCCGACAAACTTCCTGTTCTTTGGCACCAGAGTCTACTAGCCTTTTGCCAA
CGTTATGCGTCGGATTTGACTCCAGAACAAAAAGGTGCATTGTTAGATGTTGTAAGAGCGACCCCACACCATCAA
ATCGGTTCCGAAATTAGGAGGGAACTTTCATGTCGTAAGTAA
Gene >AgabiH97|072530
ATGCCTCGCGCCCAGTCCCAGCCACAGAAGCCCAGACACGCCCCCCTCCACGTCCAGCTAAATGAAGACCAGGCT
CAGGCAAAGTACGGCCGCCTTTCCCAGCCAGGAAAACGCAAAAAGTCGCGGAAATCAGACGACGACCATGACGTC
CCAGATGTATCGCCCTTATCCATCCGAGCCCAACTTTCCCCTGATCATTGCTAAAAACAGGTCACCCTAGATCAA
CAAACGTCTCGCAAGATCTTTGAACTCGCCAAAGACCAACAGGATGAATTCGAGGTACCAGATGTTGATGAAGAA
GTCCCCGATGATCAAATCAATACTCTTTCGTTCACTCAACTGCGCTCACAATCTGAGGAAGAGGAGGCAGAGGAG
GCAGAGGATGAATCAAATCTTGATGACTACCAGGAATTTGAAGAAGAGCTTGTGAGCGACATCACGTTCTTGCCC
CCATCTTTCTTGCTGAGAGCAAGCTCAGGAAATAGATGAAGAAGATATTCGAACCTTGAGTGCCCTGTTACCTGC
AAACTCTACAGAACGGCGAACCTTGGCAGACGTTATCTTTGCCAAACTGGATAATGCTGAAAACAACTCGGCGGC
CACAATTCAAAGAGTGCATCAAGGTTCGCTCCAGGCCACTTTTCTTATCACTGGTAGCAAGCCTCTCAAACCTAC
TCTTATCCTCAGATCGAGAGAAACCTGATCCTGCCCTTGGTCTCAATCCCACAGTTGTTGAAGCTTATACCAAGT
GTGTTCCTCATACACTCATATGAAGTCATTCCTCATCTTCTTGACGCCCCCAGGCTAGGACTCTTCCTGCATAAA
TACAAGTCAGGACCCTTACCTAAACTTTTTAAAGTTATTCCTTCTCTTCCAGCATGGGCCCGAATGCTGGCACTC
ACAAGCCCTGAGAATTGGTCTCCCCATGCCTGCCGAGCCGCCACACGAATTTTTATCTCCAGTATGAAGCCCCCT
CAAGCACAGTTATTTCTTAGCGTGGTCCTATTAGATGCTATCCGGGAAGATATTCATGAAAATAAGAAACTTAAT
GTCCAATACTACGAGGCACTGAAACGAGCGTTGTACAAGCCTGGCGCAGTCTTCAAAGGGATCATTTTCCCCATG
CTCGAAGTGCGCCCGATATACAATCTAATAGGAACTATGCCGTTGCTAACCCCATTCTGAATAGCAAGGATGCAC
TTTGAAGGAGGCTGCGATTGTTGCCTCAATTCTTGCTCGTACGAAGGTGCCTGTCTTACACGCCTCAGCGGCCTT
GCTTCGGATTGCGGAAATGGATTATTCAGGTATGGCACCCATATAAACTCGCCTTCATTGACGCGAACTTCTGAT
AGGCCCAAATTCCCTGTTTATCCGCGTTTTGATTGATAAGAAGTTTGAGCTGCCATACAAGGTGGTAGACGCTCT
GGTCTTCCATTATATTCGGCTGTCCAACACATATAAAGCCAAAACAAGGGGTGACTCCGACAAACTTCCTGTTCT
TTGGCACCAGAGTCTACTAGCCTTTTGCCAACGGCAAGTATTTGCGTTAATTCCCGTTCGAAATTGCGCTCATTA
GTCCAAAAATTCCAGTTATGCGTCGGATTTGACTCCAGAACAAAAAGGTGCATTGTTAGATGTTGTAAGAGCGAC
CCCACACCATCAAATCGGTTCCGAAATTAGGAGGGAACTTGTCAATTCTGTCGAGAGAGGTGCACCAAGGACGCA
AGCGGACGGTGACATAGTCATGTCGTAAGGTGGGAGTGCCCACTCGACTTCGCCTCTTAGGGTCCCACTATCCAT
GAAATTCATTTCCCATTGGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail