Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072520
Gene name
Locationscaffold_4:1743099..1744670
Strand-
Gene length (bp)1571
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.3E-62 112 418
PF01370 Epimerase NAD dependent epimerase/dehydratase family 9.2E-47 111 344
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 3.7E-08 112 326
PF04321 RmlD_sub_bind RmlD substrate binding domain 2.2E-06 110 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R885|UXS1_PONAB UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1 92 426 9.0E-153
sp|Q8NBZ7|UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1 92 426 9.0E-153
sp|Q91XL3|UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=1 SV=1 92 426 1.0E-152
sp|Q5PQX0|UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1 92 426 2.0E-152
sp|Q6GMI9|UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2 89 426 2.0E-152
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R885|UXS1_PONAB UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1 92 426 9.0E-153
sp|Q8NBZ7|UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1 92 426 9.0E-153
sp|Q91XL3|UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=1 SV=1 92 426 1.0E-152
sp|Q5PQX0|UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1 92 426 2.0E-152
sp|Q6GMI9|UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2 89 426 2.0E-152
sp|Q6DF08|UXS1_XENTR UDP-glucuronic acid decarboxylase 1 OS=Xenopus tropicalis GN=uxs1 PE=2 SV=1 88 426 4.0E-150
sp|Q8VZC0|UXS1_ARATH UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana GN=UXS1 PE=1 SV=1 107 430 2.0E-134
sp|Q9SN95|UXS5_ARATH UDP-glucuronic acid decarboxylase 5 OS=Arabidopsis thaliana GN=UXS5 PE=2 SV=1 110 427 3.0E-133
sp|Q9ZV36|UXS6_ARATH UDP-glucuronic acid decarboxylase 6 OS=Arabidopsis thaliana GN=UXS6 PE=2 SV=1 110 427 7.0E-133
sp|Q9FIE8|UXS3_ARATH UDP-glucuronic acid decarboxylase 3 OS=Arabidopsis thaliana GN=UXS3 PE=1 SV=1 110 426 4.0E-132
sp|Q8S8T4|UXS4_ARATH UDP-glucuronic acid decarboxylase 4 OS=Arabidopsis thaliana GN=UXS4 PE=2 SV=1 71 426 9.0E-132
sp|Q9LZI2|UXS2_ARATH UDP-glucuronic acid decarboxylase 2 OS=Arabidopsis thaliana GN=UXS2 PE=1 SV=1 103 426 5.0E-131
sp|Q57664|GALE_METJA Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0211 PE=3 SV=1 111 423 3.0E-33
sp|D4GU72|AGL12_HALVD Low-salt glycan biosynthesis protein Agl12 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl12 PE=3 SV=1 111 422 4.0E-32
sp|Q9ZAE8|RMLB_ACTS5 dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbB PE=3 SV=2 110 425 2.0E-29
sp|Q9ZUY6|AXS1_ARATH UDP-D-apiose/UDP-D-xylose synthase 1 OS=Arabidopsis thaliana GN=AXS1 PE=1 SV=1 111 429 3.0E-29
sp|Q9SGE0|AXS2_ARATH UDP-D-apiose/UDP-D-xylose synthase 2 OS=Arabidopsis thaliana GN=AXS2 PE=2 SV=1 111 429 3.0E-29
sp|A0R5C5|GALE_MYCS2 UDP-glucose 4-epimerase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6142 PE=1 SV=2 110 425 2.0E-28
sp|A0KGY6|ARNA_AERHH Bifunctional polymyxin resistance protein ArnA OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=arnA PE=3 SV=1 110 407 4.0E-28
sp|Q04973|VIPB_SALTI Vi polysaccharide biosynthesis protein VipB/TviC OS=Salmonella typhi GN=vipB PE=3 SV=1 109 425 5.0E-28
sp|P29782|RMLB_STRGR dTDP-glucose 4,6-dehydratase OS=Streptomyces griseus GN=strE PE=1 SV=1 111 422 1.0E-26
sp|B7N5M0|ARNA_ECOLU Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=arnA PE=3 SV=1 107 422 5.0E-26
sp|A4TIM4|ARNA_YERPP Bifunctional polymyxin resistance protein ArnA OS=Yersinia pestis (strain Pestoides F) GN=arnA PE=3 SV=1 105 422 6.0E-26
sp|Q1CIH7|ARNA_YERPN Bifunctional polymyxin resistance protein ArnA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=arnA PE=3 SV=1 105 422 6.0E-26
sp|A9R093|ARNA_YERPG Bifunctional polymyxin resistance protein ArnA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=arnA PE=3 SV=1 105 422 6.0E-26
sp|Q8ZDX8|ARNA_YERPE Bifunctional polymyxin resistance protein ArnA OS=Yersinia pestis GN=arnA PE=3 SV=1 105 422 6.0E-26
sp|Q1C742|ARNA_YERPA Bifunctional polymyxin resistance protein ArnA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=arnA PE=3 SV=1 105 422 6.0E-26
sp|B4ETL7|ARNA_PROMH Bifunctional polymyxin resistance protein ArnA OS=Proteus mirabilis (strain HI4320) GN=arnA PE=3 SV=1 96 422 6.0E-26
sp|Q2R1V8|GME2_ORYSJ GDP-mannose 3,5-epimerase 2 OS=Oryza sativa subsp. japonica GN=GME-2 PE=2 SV=2 107 426 1.0E-25
sp|Q0TFI7|ARNA_ECOL5 Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=arnA PE=3 SV=1 107 422 1.0E-25
sp|B5R272|ARNA_SALEP Bifunctional polymyxin resistance protein ArnA OS=Salmonella enteritidis PT4 (strain P125109) GN=arnA PE=3 SV=1 107 422 1.0E-25
sp|B5RCC4|ARNA_SALG2 Bifunctional polymyxin resistance protein ArnA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=arnA PE=3 SV=1 107 422 1.0E-25
sp|B5EZH8|ARNA_SALA4 Bifunctional polymyxin resistance protein ArnA OS=Salmonella agona (strain SL483) GN=arnA PE=3 SV=1 107 422 1.0E-25
sp|A9N5B2|ARNA_SALPB Bifunctional polymyxin resistance protein ArnA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=arnA PE=3 SV=1 107 422 1.0E-25
sp|O52325|ARNA_SALTY Bifunctional polymyxin resistance protein ArnA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=arnA PE=2 SV=1 107 422 1.0E-25
sp|B4TBG6|ARNA_SALHS Bifunctional polymyxin resistance protein ArnA OS=Salmonella heidelberg (strain SL476) GN=arnA PE=3 SV=1 107 422 1.0E-25
sp|Q1R9G0|ARNA_ECOUT Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli (strain UTI89 / UPEC) GN=arnA PE=3 SV=1 107 422 2.0E-25
sp|A1ADA7|ARNA_ECOK1 Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O1:K1 / APEC GN=arnA PE=3 SV=1 107 422 2.0E-25
sp|B7MG22|ARNA_ECO45 Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=arnA PE=3 SV=1 107 422 2.0E-25
sp|P9WN67|GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=galE1 PE=1 SV=1 110 425 2.0E-25
sp|P9WN66|GALE_MYCTO UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=galE1 PE=3 SV=1 110 425 2.0E-25
sp|B7MXT6|ARNA_ECO81 Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O81 (strain ED1a) GN=arnA PE=3 SV=1 107 422 2.0E-25
sp|B7LM76|ARNA_ESCF3 Bifunctional polymyxin resistance protein ArnA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=arnA PE=3 SV=1 95 422 2.0E-25
sp|Q3YZV1|ARNA_SHISS Bifunctional polymyxin resistance protein ArnA OS=Shigella sonnei (strain Ss046) GN=arnA PE=3 SV=1 107 422 2.0E-25
sp|B1JJ30|ARNA_YERPY Bifunctional polymyxin resistance protein ArnA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=arnA PE=3 SV=1 105 422 2.0E-25
sp|Q93PD8|ARNA_YERPS Bifunctional polymyxin resistance protein ArnA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=arnA PE=2 SV=1 105 422 2.0E-25
sp|B2K5L3|ARNA_YERPB Bifunctional polymyxin resistance protein ArnA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=arnA PE=3 SV=1 105 422 2.0E-25
sp|A7FHH4|ARNA_YERP3 Bifunctional polymyxin resistance protein ArnA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=arnA PE=3 SV=1 105 422 2.0E-25
sp|B2VBI9|ARNA_ERWT9 Bifunctional polymyxin resistance protein ArnA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=arnA PE=3 SV=1 107 430 2.0E-25
sp|Q8FFM1|ARNA_ECOL6 Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=arnA PE=3 SV=1 107 422 2.0E-25
sp|B7UFR7|ARNA_ECO27 Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=arnA PE=3 SV=1 107 422 3.0E-25
sp|B7NNT4|ARNA_ECO7I Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=arnA PE=3 SV=1 107 422 3.0E-25
sp|B1LLK9|ARNA_ECOSM Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=arnA PE=3 SV=1 107 422 3.0E-25
sp|A2Z7B3|GME1_ORYSI GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp. indica GN=OsI_032456 PE=2 SV=1 106 415 4.0E-25
sp|A8A2C2|ARNA_ECOHS Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O9:H4 (strain HS) GN=arnA PE=3 SV=1 107 422 4.0E-25
sp|Q31YK2|ARNA_SHIBS Bifunctional polymyxin resistance protein ArnA OS=Shigella boydii serotype 4 (strain Sb227) GN=arnA PE=3 SV=1 107 422 4.0E-25
sp|B5FNT9|ARNA_SALDC Bifunctional polymyxin resistance protein ArnA OS=Salmonella dublin (strain CT_02021853) GN=arnA PE=3 SV=1 107 422 4.0E-25
sp|Q32DT3|ARNA_SHIDS Bifunctional polymyxin resistance protein ArnA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=arnA PE=3 SV=2 107 422 5.0E-25
sp|P77398|ARNA_ECOLI Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli (strain K12) GN=arnA PE=1 SV=1 107 422 5.0E-25
sp|B1IXT2|ARNA_ECOLC Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=arnA PE=3 SV=1 107 422 5.0E-25
sp|B1X8W8|ARNA_ECODH Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli (strain K12 / DH10B) GN=arnA PE=3 SV=1 107 422 5.0E-25
sp|C4ZU97|ARNA_ECOBW Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=arnA PE=3 SV=1 107 422 5.0E-25
sp|B6I7J8|ARNA_ECOSE Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli (strain SE11) GN=arnA PE=3 SV=1 107 422 5.0E-25
sp|B7M5T7|ARNA_ECO8A Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O8 (strain IAI1) GN=arnA PE=3 SV=1 107 422 5.0E-25
sp|B7LAS0|ARNA_ECO55 Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli (strain 55989 / EAEC) GN=arnA PE=3 SV=1 107 422 5.0E-25
sp|A7ZP73|ARNA_ECO24 Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=arnA PE=3 SV=1 107 422 5.0E-25
sp|B5YXP8|ARNA_ECO5E Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=arnA PE=3 SV=1 107 422 5.0E-25
sp|Q8XDZ3|ARNA_ECO57 Bifunctional polymyxin resistance protein ArnA OS=Escherichia coli O157:H7 GN=arnA PE=3 SV=1 107 422 5.0E-25
sp|B4SYX1|ARNA_SALNS Bifunctional polymyxin resistance protein ArnA OS=Salmonella newport (strain SL254) GN=arnA PE=3 SV=1 107 422 5.0E-25
sp|C0Q069|ARNA_SALPC Bifunctional polymyxin resistance protein ArnA OS=Salmonella paratyphi C (strain RKS4594) GN=arnA PE=3 SV=1 107 422 6.0E-25
sp|A3C4S4|GME1_ORYSJ GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp. japonica GN=GME-1 PE=1 SV=1 106 415 7.0E-25
sp|Q7BJX9|GNE_PLESH UDP-N-acetylglucosamine 4-epimerase OS=Plesiomonas shigelloides GN=wbgU PE=1 SV=1 94 422 7.0E-25
sp|A8GDR7|ARNA_SERP5 Bifunctional polymyxin resistance protein ArnA OS=Serratia proteamaculans (strain 568) GN=arnA PE=3 SV=1 105 430 9.0E-25
sp|Q7N3Q7|ARNA_PHOLL Bifunctional polymyxin resistance protein ArnA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=arnA PE=3 SV=1 89 422 9.0E-25
sp|B2TW38|ARNA_SHIB3 Putative bifunctional polymyxin resistance protein ArnA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=arnA PE=5 SV=1 107 422 9.0E-25
sp|P0C0R6|ARNA_SALCH Bifunctional polymyxin resistance protein ArnA OS=Salmonella choleraesuis (strain SC-B67) GN=arnA PE=3 SV=1 107 422 9.0E-25
sp|A8FRR2|ARNA_SHESH Bifunctional polymyxin resistance protein ArnA OS=Shewanella sediminis (strain HAW-EB3) GN=arnA PE=3 SV=1 96 422 1.0E-24
sp|B4TPI2|ARNA_SALSV Bifunctional polymyxin resistance protein ArnA OS=Salmonella schwarzengrund (strain CVM19633) GN=arnA PE=3 SV=1 107 422 1.0E-24
sp|A1JPN5|ARNA_YERE8 Bifunctional polymyxin resistance protein ArnA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=arnA PE=3 SV=1 105 422 1.0E-24
sp|Q7WTB1|GALE_LACHE UDP-glucose 4-epimerase OS=Lactobacillus helveticus GN=galE PE=2 SV=1 110 408 2.0E-24
sp|Q83QT8|ARNA_SHIFL Bifunctional polymyxin resistance protein ArnA OS=Shigella flexneri GN=arnA PE=3 SV=2 107 422 3.0E-24
sp|Q0T2M8|ARNA_SHIF8 Bifunctional polymyxin resistance protein ArnA OS=Shigella flexneri serotype 5b (strain 8401) GN=arnA PE=3 SV=1 107 422 3.0E-24
sp|A4SQW9|ARNA_AERS4 Bifunctional polymyxin resistance protein ArnA OS=Aeromonas salmonicida (strain A449) GN=arnA PE=3 SV=1 110 407 3.0E-24
sp|Q8Z540|ARNA_SALTI Bifunctional polymyxin resistance protein ArnA OS=Salmonella typhi GN=arnA PE=3 SV=1 107 422 4.0E-24
sp|B5BCP6|ARNA_SALPK Bifunctional polymyxin resistance protein ArnA OS=Salmonella paratyphi A (strain AKU_12601) GN=arnA PE=3 SV=1 107 422 4.0E-24
sp|Q5PNA6|ARNA_SALPA Bifunctional polymyxin resistance protein ArnA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=arnA PE=3 SV=1 107 422 4.0E-24
sp|A6TF98|ARNA_KLEP7 Bifunctional polymyxin resistance protein ArnA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=arnA PE=3 SV=1 89 422 4.0E-24
sp|P37761|RMLB_NEIGO dTDP-glucose 4,6-dehydratase OS=Neisseria gonorrhoeae GN=rfbB PE=3 SV=1 108 422 7.0E-24
sp|Q93VR3|GME_ARATH GDP-mannose 3,5-epimerase OS=Arabidopsis thaliana GN=At5g28840 PE=1 SV=1 106 425 1.0E-23
sp|Q8S9Z2|AXS_ORYSJ UDP-D-apiose/UDP-D-xylose synthase OS=Oryza sativa subsp. japonica GN=Os01g0969100 PE=2 SV=1 111 421 4.0E-23
sp|Q2NRV7|ARNA_SODGM Bifunctional polymyxin resistance protein ArnA OS=Sodalis glossinidius (strain morsitans) GN=arnA PE=3 SV=1 99 422 8.0E-23
sp|Q9L9E8|NOVT_STRNV dTDP-glucose 4,6-dehydratase OS=Streptomyces niveus GN=novT PE=3 SV=1 110 427 2.0E-22
sp|Q6D2F1|ARNA_PECAS Bifunctional polymyxin resistance protein ArnA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=arnA PE=3 SV=1 107 422 2.0E-22
sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1 103 423 2.0E-22
sp|C6DAW5|ARNA_PECCP Bifunctional polymyxin resistance protein ArnA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=arnA PE=3 SV=1 107 422 2.0E-22
sp|A6QLW2|TGDS_BOVIN dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1 104 423 3.0E-22
sp|Q9S642|RMLB_NEIMA dTDP-glucose 4,6-dehydratase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rfbB1 PE=3 SV=1 109 422 3.0E-22
sp|P55462|RFBB_RHISN Probable dTDP-glucose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=NGR_a03580 PE=3 SV=1 110 422 3.0E-22
sp|B5XTK9|ARNA_KLEP3 Bifunctional polymyxin resistance protein ArnA OS=Klebsiella pneumoniae (strain 342) GN=arnA PE=3 SV=1 89 422 6.0E-22
sp|A4WAM3|ARNA_ENT38 Bifunctional polymyxin resistance protein ArnA OS=Enterobacter sp. (strain 638) GN=arnA PE=3 SV=1 105 422 7.0E-22
sp|P27830|RMLB2_ECOLI dTDP-glucose 4,6-dehydratase 2 OS=Escherichia coli (strain K12) GN=rffG PE=1 SV=3 109 425 1.0E-21
sp|Q58455|Y1055_METJA Uncharacterized protein MJ1055 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1055 PE=3 SV=1 107 422 1.0E-21
sp|O34886|YTCB_BACSU Uncharacterized UDP-glucose epimerase YtcB OS=Bacillus subtilis (strain 168) GN=ytcB PE=3 SV=1 110 424 2.0E-21
sp|B0RVL0|RMLB_XANCB dTDP-glucose 4,6-dehydratase OS=Xanthomonas campestris pv. campestris (strain B100) GN=rfbB PE=3 SV=1 112 422 3.0E-21
sp|Q9LH76|RHM3_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 OS=Arabidopsis thaliana GN=RHM3 PE=1 SV=1 109 422 3.0E-21
sp|P0C7J0|RMLB_XANCP dTDP-glucose 4,6-dehydratase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rfbB PE=3 SV=1 112 422 1.0E-20
sp|Q9SYM5|RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana GN=RHM1 PE=1 SV=1 109 422 1.0E-20
sp|Q9LPG6|RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana GN=RHM2 PE=1 SV=1 109 422 3.0E-20
sp|O06485|YFNG_BACSU Putative sugar dehydratase/epimerase YfnG OS=Bacillus subtilis (strain 168) GN=yfnG PE=3 SV=2 107 422 3.0E-20
sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 104 426 4.0E-20
sp|P95780|RMLB_STRMU dTDP-glucose 4,6-dehydratase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rmlB PE=1 SV=2 105 422 4.0E-20
sp|Q45291|GALE_CORGL UDP-glucose 4-epimerase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=galE PE=3 SV=2 110 428 4.0E-20
sp|P44914|RMLB_HAEIN dTDP-glucose 4,6-dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rffG PE=3 SV=1 110 422 6.0E-20
sp|Q5SFA6|CHMD_STRBI dTDP-4-oxo-6-deoxy-D-allose reductase OS=Streptomyces bikiniensis GN=chmD PE=1 SV=1 109 423 2.0E-19
sp|C3KAD2|ARNA_PSEFS Bifunctional polymyxin resistance protein ArnA OS=Pseudomonas fluorescens (strain SBW25) GN=arnA PE=3 SV=1 107 407 3.0E-19
sp|Q9HY63|ARNA_PSEAE Bifunctional polymyxin resistance protein ArnA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=arnA PE=3 SV=1 106 422 3.0E-19
sp|P55294|RMLB_NEIMB dTDP-glucose 4,6-dehydratase OS=Neisseria meningitidis serogroup B (strain MC58) GN=rfbB1 PE=3 SV=2 109 422 3.0E-19
sp|B7VBN2|ARNA_PSEA8 Bifunctional polymyxin resistance protein ArnA OS=Pseudomonas aeruginosa (strain LESB58) GN=arnA PE=3 SV=1 106 422 3.0E-19
sp|Q3KCC1|ARNA_PSEPF Bifunctional polymyxin resistance protein ArnA OS=Pseudomonas fluorescens (strain Pf0-1) GN=arnA PE=3 SV=1 107 422 5.0E-19
sp|Q02R25|ARNA_PSEAB Bifunctional polymyxin resistance protein ArnA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=arnA PE=3 SV=1 106 422 5.0E-19
sp|Q4KC82|ARNA_PSEF5 Bifunctional polymyxin resistance protein ArnA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=arnA PE=3 SV=1 107 407 7.0E-19
sp|A6V1P0|ARNA_PSEA7 Bifunctional polymyxin resistance protein ArnA OS=Pseudomonas aeruginosa (strain PA7) GN=arnA PE=3 SV=1 107 422 1.0E-18
sp|Q48HZ1|ARNA_PSE14 Bifunctional polymyxin resistance protein ArnA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=arnA PE=3 SV=1 106 407 4.0E-18
sp|Q4ZSZ2|ARNA_PSEU2 Bifunctional polymyxin resistance protein ArnA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=arnA PE=3 SV=1 107 407 9.0E-18
sp|Q9FI17|ARAE4_ARATH Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsis thaliana GN=At5g44480 PE=3 SV=1 105 410 1.0E-17
sp|Q331Q7|GERKI_STRSQ dTDP-4-oxo-6-deoxy-D-allose reductase OS=Streptomyces sp. GN=gerKI PE=1 SV=1 109 423 7.0E-17
sp|Q9HTB6|RMD_PSEAE GDP-6-deoxy-D-mannose reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rmd PE=1 SV=1 109 428 7.0E-17
sp|P26391|RMLB_SALTY dTDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbB PE=1 SV=1 110 425 7.0E-17
sp|P33119|GALE_CORDI UDP-glucose 4-epimerase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=galE PE=3 SV=2 110 410 8.0E-17
sp|P37759|RMLB1_ECOLI dTDP-glucose 4,6-dehydratase 1 OS=Escherichia coli (strain K12) GN=rfbB PE=3 SV=2 110 422 2.0E-16
sp|P55293|RMLB1_ECOLX dTDP-glucose 4,6-dehydratase OS=Escherichia coli GN=rfbB PE=3 SV=1 110 425 2.0E-16
sp|P37777|RMLB_SHIFL dTDP-glucose 4,6-dehydratase OS=Shigella flexneri GN=rfbB PE=3 SV=2 110 425 3.0E-16
sp|P21977|GALE_STRTR UDP-glucose 4-epimerase OS=Streptococcus thermophilus GN=galE PE=3 SV=1 111 409 4.0E-16
sp|P56986|GALE_NEIMC UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup C GN=galE PE=3 SV=1 109 421 7.0E-16
sp|P39630|RMLB_BACSU dTDP-glucose 4,6-dehydratase OS=Bacillus subtilis (strain 168) GN=rfbB PE=1 SV=1 109 422 7.0E-16
sp|Q9KDV3|GALE_BACHD UDP-glucose 4-epimerase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=galE PE=3 SV=1 111 421 7.0E-16
sp|O84903|GALE_LACCA UDP-glucose 4-epimerase OS=Lactobacillus casei GN=galE PE=3 SV=1 111 409 1.0E-15
sp|Q04871|YCL2_ECO11 Uncharacterized 37.6 kDa protein in cld 5'region OS=Escherichia coli O111:H- PE=3 SV=1 110 423 2.0E-15
sp|Q54WS6|TGDS_DICDI dTDP-D-glucose 4,6-dehydratase OS=Dictyostelium discoideum GN=tgds PE=3 SV=1 109 361 3.0E-15
sp|B0M3E8|UGE1_PEA Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Pisum sativum GN=UGE1 PE=1 SV=2 105 420 3.0E-15
sp|Q652A8|UGE3_ORYSJ UDP-glucose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UGE-3 PE=2 SV=1 111 420 4.0E-15
sp|O22141|GAE4_ARATH UDP-glucuronate 4-epimerase 4 OS=Arabidopsis thaliana GN=GAE4 PE=1 SV=1 111 422 6.0E-15
sp|P96995|GALE_STRMU UDP-glucose 4-epimerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=galE PE=3 SV=2 111 409 7.0E-15
sp|Q9SUN3|ARAE3_ARATH Probable UDP-arabinose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g20460 PE=2 SV=3 111 410 9.0E-15
sp|O81312|GAE3_ARATH UDP-glucuronate 4-epimerase 3 OS=Arabidopsis thaliana GN=GAE3 PE=2 SV=1 111 422 1.0E-14
sp|Q8LNZ3|UGE1_ORYSJ UDP-glucose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UGE-1 PE=2 SV=1 109 420 2.0E-14
sp|Q43070|GALE1_PEA UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1 105 420 2.0E-14
sp|Q67WR2|FCL1_ORYSJ Probable GDP-L-fucose synthase 1 OS=Oryza sativa subsp. japonica GN=Os06g0652400 PE=2 SV=1 110 422 2.0E-14
sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 111 419 3.0E-14
sp|Q42605|UGE1_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Arabidopsis thaliana GN=UGE1 PE=1 SV=2 106 420 3.0E-14
sp|P56985|GALE_NEIMB UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=galE PE=3 SV=1 109 421 3.0E-14
sp|Q6ZDJ7|UGE2_ORYSJ UDP-glucose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UGE-2 PE=2 SV=1 109 420 4.0E-14
sp|P56997|GALE_NEIMA UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=galE PE=3 SV=1 109 421 4.0E-14
sp|Q6K2E1|UGE4_ORYSJ UDP-glucose 4-epimerase 4 OS=Oryza sativa subsp. japonica GN=UGE-4 PE=2 SV=1 109 420 5.0E-14
sp|O65781|GALE2_CYATE UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1 111 420 5.0E-14
sp|Q06952|GM4D_VIBCH GDP-mannose 4,6-dehydratase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gmd PE=3 SV=1 108 419 5.0E-14
sp|Q9HDU4|YHEB_SCHPO Uncharacterized protein PB2B2.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.11 PE=3 SV=1 112 422 6.0E-14
sp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=UGE2 PE=1 SV=1 109 420 7.0E-14
sp|O65780|GALE1_CYATE UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetragonoloba PE=2 SV=1 105 420 7.0E-14
sp|Q9LPC1|GAE2_ARATH UDP-glucuronate 4-epimerase 2 OS=Arabidopsis thaliana GN=GAE2 PE=2 SV=1 73 429 7.0E-14
sp|A0QSK6|RMLB_MYCS2 dTDP-glucose 4,6-dehydratase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rmlB PE=1 SV=1 110 339 1.0E-13
sp|Q59083|EXOB_AZOBR UDP-glucose 4-epimerase OS=Azospirillum brasilense GN=exoB PE=3 SV=1 110 408 2.0E-13
sp|O54067|LPSL_RHIME UDP-glucuronate 5'-epimerase OS=Rhizobium meliloti (strain 1021) GN=lspL PE=3 SV=2 110 422 2.0E-13
sp|P13226|GALE_STRLI UDP-glucose 4-epimerase OS=Streptomyces lividans GN=galE PE=3 SV=2 110 407 2.0E-13
sp|Q5UR12|TGDS_MIMIV Putative dTDP-D-glucose 4,6-dehydratase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R141 PE=3 SV=1 109 425 2.0E-13
sp|Q6E7F4|RMLB2_ECOLX dTDP-glucose 4,6-dehydratase OS=Escherichia coli GN=rmlB PE=1 SV=1 110 422 2.0E-13
sp|P14169|RFBE_SALTI CDP-paratose 2-epimerase OS=Salmonella typhi GN=rfbE PE=1 SV=2 110 418 3.0E-13
sp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana GN=UGE5 PE=1 SV=3 109 420 3.0E-13
sp|Q8D341|ARNA_WIGBR Bifunctional polymyxin resistance protein ArnA OS=Wigglesworthia glossinidia brevipalpis GN=arnA PE=3 SV=1 109 422 5.0E-13
sp|Q9M0B6|GAE1_ARATH UDP-glucuronate 4-epimerase 1 OS=Arabidopsis thaliana GN=GAE1 PE=1 SV=1 111 422 5.0E-13
sp|Q9SA77|ARAE1_ARATH UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1 111 410 5.0E-13
sp|P0AC91|GM4D_SHIFL GDP-mannose 4,6-dehydratase OS=Shigella flexneri GN=gmd PE=3 SV=1 109 419 6.0E-13
sp|P0AC88|GM4D_ECOLI GDP-mannose 4,6-dehydratase OS=Escherichia coli (strain K12) GN=gmd PE=1 SV=1 109 419 6.0E-13
sp|P0AC89|GM4D_ECOL6 GDP-mannose 4,6-dehydratase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gmd PE=3 SV=1 109 419 6.0E-13
sp|P0AC90|GM4D_ECO57 GDP-mannose 4,6-dehydratase OS=Escherichia coli O157:H7 GN=gmd PE=3 SV=1 109 419 6.0E-13
sp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 6 OS=Arabidopsis thaliana GN=GAE6 PE=1 SV=1 111 422 7.0E-13
sp|Q18801|GMD1_CAEEL GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis elegans GN=bre-1 PE=1 SV=3 94 419 9.0E-13
sp|Q8LDN8|UGE3_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 OS=Arabidopsis thaliana GN=UGE3 PE=1 SV=1 106 420 9.0E-13
sp|P9WN65|RMLB_MYCTU dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rmlB PE=1 SV=1 110 324 2.0E-12
sp|P9WN64|RMLB_MYCTO dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rmlB PE=3 SV=1 110 324 2.0E-12
sp|Q56872|GM4D_YERE8 GDP-mannose 4,6-dehydratase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gmd PE=3 SV=2 109 431 3.0E-12
sp|Q05026|GALE_NEIGO UDP-glucose 4-epimerase OS=Neisseria gonorrhoeae GN=galE PE=3 SV=1 111 421 3.0E-12
sp|P09147|GALE_ECOLI UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) GN=galE PE=1 SV=1 110 406 4.0E-12
sp|Q6T1X6|RMD_ANETH GDP-6-deoxy-D-mannose reductase OS=Aneurinibacillus thermoaerophilus GN=rmd PE=1 SV=1 110 423 4.0E-12
sp|Q67WR5|FCL2_ORYSJ Putative GDP-L-fucose synthase 2 OS=Oryza sativa subsp. japonica GN=Os06g0652300 PE=3 SV=1 203 422 5.0E-12
sp|Q553X7|GALE_DICDI UDP-glucose 4-epimerase OS=Dictyostelium discoideum GN=galE PE=1 SV=1 110 406 6.0E-12
sp|Q9STI6|GAE5_ARATH UDP-glucuronate 4-epimerase 5 OS=Arabidopsis thaliana GN=GAE5 PE=2 SV=1 111 422 7.0E-12
sp|Q9C7W7|UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana GN=UGE4 PE=1 SV=1 110 420 7.0E-12
sp|Q31FG4|HLDD_THICR ADP-L-glycero-D-manno-heptose-6-epimerase OS=Thiomicrospira crunogena (strain XCL-2) GN=hldD PE=3 SV=1 111 421 1.0E-11
sp|A8Y0L5|GMD1_CAEBR GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis briggsae GN=bre-1 PE=3 SV=2 98 419 1.0E-11
sp|Q8H0B6|ARAE2_ORYSJ Probable UDP-arabinose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UEL-2 PE=2 SV=1 111 360 1.0E-11
sp|Q8H930|ARAE1_ORYSJ Probable UDP-arabinose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UEL-1 PE=2 SV=2 111 360 1.0E-11
sp|P39858|CAPI_STAAU Protein CapI OS=Staphylococcus aureus GN=capI PE=3 SV=1 110 422 2.0E-11
sp|Q59678|GALE_MANHA UDP-glucose 4-epimerase OS=Mannheimia haemolytica GN=galE PE=3 SV=1 111 420 2.0E-11
sp|Q56093|GALE_SALTI UDP-glucose 4-epimerase OS=Salmonella typhi GN=galE PE=3 SV=2 110 333 2.0E-11
sp|O60547|GMDS_HUMAN GDP-mannose 4,6 dehydratase OS=Homo sapiens GN=GMDS PE=1 SV=1 108 420 2.0E-11
sp|Q56598|GM4D_VIBCL GDP-mannose 4,6-dehydratase OS=Vibrio cholerae GN=gmd PE=3 SV=2 108 419 3.0E-11
sp|O49213|FCL1_ARATH GDP-L-fucose synthase 1 OS=Arabidopsis thaliana GN=GER1 PE=1 SV=3 107 422 3.0E-11
sp|P22715|GALE_SALTY UDP-glucose 4-epimerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galE PE=3 SV=2 110 333 3.0E-11
sp|Q8K0C9|GMDS_MOUSE GDP-mannose 4,6 dehydratase OS=Mus musculus GN=Gmds PE=1 SV=1 108 420 3.0E-11
sp|Q8K3X3|GMDS_CRIGR GDP-mannose 4,6 dehydratase OS=Cricetulus griseus GN=GMDS PE=2 SV=1 108 420 4.0E-11
sp|A1VGB0|HLDD_DESVV ADP-L-glycero-D-manno-heptose-6-epimerase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hldD PE=3 SV=1 112 364 5.0E-11
sp|Q15738|NSDHL_HUMAN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens GN=NSDHL PE=1 SV=2 106 351 6.0E-11
sp|Q2SYH7|WBIB_BURTA dTDP-L-rhamnose 4-epimerase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=wbiB PE=1 SV=1 109 426 7.0E-11
sp|P24325|GALE_HAEIN UDP-glucose 4-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galE PE=3 SV=2 111 420 8.0E-11
sp|Q72ET7|HLDD_DESVH ADP-L-glycero-D-manno-heptose-6-epimerase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hldD PE=3 SV=1 112 364 9.0E-11
sp|P55353|FCL_RHISN GDP-L-fucose synthase OS=Rhizobium sp. (strain NGR234) GN=fcl PE=3 SV=1 109 428 1.0E-10
sp|Q3ZBE9|NSDHL_BOVIN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Bos taurus GN=NSDHL PE=2 SV=1 105 330 2.0E-10
sp|B8CVJ3|HLDD_SHEPW ADP-L-glycero-D-manno-heptose-6-epimerase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=hldD PE=3 SV=1 111 385 4.0E-10
sp|Q59745|EXOB_RHILT UDP-glucose 4-epimerase OS=Rhizobium leguminosarum bv. trifolii GN=exoB PE=3 SV=1 111 420 4.0E-10
sp|Q9F7D4|GALE_YERPE UDP-glucose 4-epimerase OS=Yersinia pestis GN=galE PE=3 SV=1 111 406 4.0E-10
sp|Q500U8|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1 OS=Arabidopsis thaliana GN=TKPR1 PE=1 SV=1 108 305 5.0E-10
sp|P04397|GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL10 PE=1 SV=2 106 431 5.0E-10
sp|Q9LMU0|FCL2_ARATH Putative GDP-L-fucose synthase 2 OS=Arabidopsis thaliana GN=GER2 PE=1 SV=1 105 422 7.0E-10
sp|P26503|EXOB_RHIME UDP-glucose 4-epimerase OS=Rhizobium meliloti (strain 1021) GN=exoB PE=3 SV=1 107 409 2.0E-09
sp|A9M3Q7|HLDD_NEIM0 ADP-L-glycero-D-manno-heptose-6-epimerase OS=Neisseria meningitidis serogroup C (strain 053442) GN=hldD PE=3 SV=1 111 427 2.0E-09
sp|Q8H0B2|ARAE3_ORYSJ Probable UDP-arabinose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UEL-3 PE=2 SV=1 111 410 2.0E-09
sp|A1KT78|HLDD_NEIMF ADP-L-glycero-D-manno-heptose-6-epimerase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=hldD PE=3 SV=1 111 427 3.0E-09
sp|P55354|GM4D_RHISN GDP-mannose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=gmd PE=3 SV=1 105 420 3.0E-09
sp|Q51061|HLDD_NEIGO ADP-L-glycero-D-manno-heptose-6-epimerase OS=Neisseria gonorrhoeae GN=hldD PE=3 SV=1 111 427 4.0E-09
sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Mus musculus GN=Nsdhl PE=1 SV=1 105 330 4.0E-09
sp|Q3A8K5|HLDD_PELCD ADP-L-glycero-D-manno-heptose-6-epimerase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hldD PE=3 SV=1 111 358 5.0E-09
sp|O85713|GM4D_RHIFH GDP-mannose 4,6-dehydratase OS=Rhizobium fredii (strain HH103) GN=gmd PE=3 SV=1 105 420 5.0E-09
sp|Q9K002|HLDD_NEIMB ADP-L-glycero-D-manno-heptose-6-epimerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hldD PE=3 SV=1 111 427 5.0E-09
sp|Q9JQX8|HLDD_NEIMA ADP-L-glycero-D-manno-heptose-6-epimerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hldD PE=3 SV=1 111 427 6.0E-09
sp|Q1ZXF7|GMDS_DICDI GDP-mannose 4,6 dehydratase OS=Dictyostelium discoideum GN=gmd PE=1 SV=1 107 419 8.0E-09
sp|Q57301|GALE_YEREN UDP-glucose 4-epimerase OS=Yersinia enterocolitica GN=galE PE=3 SV=1 111 351 1.0E-08
sp|P75517|GALE_MYCPN UDP-glucose 4-epimerase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=galE PE=3 SV=1 108 421 2.0E-08
sp|Q9W0P5|GALE_DROME UDP-glucose 4-epimerase OS=Drosophila melanogaster GN=Gale PE=1 SV=1 111 419 2.0E-08
sp|P9WQP7|3BHS_MYCTU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1106c PE=1 SV=1 106 422 3.0E-08
sp|P9WQP6|3BHS_MYCTO 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1137 PE=3 SV=1 106 422 3.0E-08
sp|A5UIN9|HLDD_HAEIG ADP-L-glycero-D-manno-heptose-6-epimerase OS=Haemophilus influenzae (strain PittGG) GN=hldD PE=3 SV=1 111 425 3.0E-08
sp|Q4QLI0|HLDD_HAEI8 ADP-L-glycero-D-manno-heptose-6-epimerase OS=Haemophilus influenzae (strain 86-028NP) GN=hldD PE=3 SV=1 111 425 4.0E-08
sp|P45048|HLDD_HAEIN ADP-L-glycero-D-manno-heptose-6-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hldD PE=3 SV=1 111 425 4.0E-08
sp|Q9CNY5|GALE_PASMU UDP-glucose 4-epimerase OS=Pasteurella multocida (strain Pm70) GN=galE PE=3 SV=1 111 420 4.0E-08
sp|Q0A4T8|HLDD_ALKEH ADP-L-glycero-D-manno-heptose-6-epimerase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hldD PE=3 SV=1 111 358 6.0E-08
sp|Q5PPL3|NSDHL_RAT Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Rattus norvegicus GN=Nsdhl PE=2 SV=1 105 351 7.0E-08
sp|Q9SNY3|GMD1_ARATH GDP-mannose 4,6 dehydratase 1 OS=Arabidopsis thaliana GN=GMD1 PE=1 SV=1 108 420 1.0E-07
sp|Q1R1N5|HLDD_CHRSD ADP-L-glycero-D-manno-heptose-6-epimerase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hldD PE=3 SV=2 111 358 1.0E-07
sp|Q5F9J0|HLDD_NEIG1 ADP-L-glycero-D-manno-heptose-6-epimerase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hldD PE=3 SV=1 111 427 2.0E-07
sp|Q9JRN5|GM4D_AGGAC GDP-mannose 4,6-dehydratase OS=Aggregatibacter actinomycetemcomitans GN=gmd PE=1 SV=1 109 420 2.0E-07
sp|Q9VMW9|GMDS_DROME GDP-mannose 4,6 dehydratase OS=Drosophila melanogaster GN=Gmd PE=1 SV=2 106 420 3.0E-07
sp|E8MF10|GALE_BIFL2 UDP-glucose 4-epimerase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) GN=lnpD PE=1 SV=1 111 418 3.0E-07
sp|P55579|Y4NG_RHISN Uncharacterized protein y4nG OS=Rhizobium sp. (strain NGR234) GN=NGR_a02350 PE=3 SV=1 109 427 3.0E-07
sp|A3QJB2|HLDD_SHELP ADP-L-glycero-D-manno-heptose-6-epimerase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=hldD PE=3 SV=1 111 385 5.0E-07
sp|Q3J7X9|HLDD_NITOC ADP-L-glycero-D-manno-heptose-6-epimerase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hldD PE=3 SV=1 111 358 6.0E-07
sp|A0KQV3|HLDD_AERHH ADP-L-glycero-D-manno-heptose-6-epimerase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=hldD PE=3 SV=1 111 402 1.0E-06
sp|C5BB97|HLDD_EDWI9 ADP-L-glycero-D-manno-heptose-6-epimerase OS=Edwardsiella ictaluri (strain 93-146) GN=hldD PE=3 SV=1 111 425 1.0E-06
sp|A8GLC8|HLDD_SERP5 ADP-L-glycero-D-manno-heptose-6-epimerase OS=Serratia proteamaculans (strain 568) GN=hldD PE=3 SV=1 111 369 2.0E-06
sp|P09609|GAL10_KLULA Bifunctional protein GAL10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL10 PE=2 SV=2 105 351 2.0E-06
sp|P93031|GMD2_ARATH GDP-mannose 4,6 dehydratase 2 OS=Arabidopsis thaliana GN=MUR1 PE=1 SV=3 108 420 2.0E-06
sp|P39631|SPSK_BACSU Spore coat polysaccharide biosynthesis protein SpsK OS=Bacillus subtilis (strain 168) GN=spsK PE=3 SV=3 110 371 3.0E-06
sp|Q9Y7X5|UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uge1 PE=1 SV=1 111 406 3.0E-06
sp|P51102|DFRA_ARATH Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=1 SV=2 105 359 3.0E-06
sp|Q07W60|HLDD_SHEFN ADP-L-glycero-D-manno-heptose-6-epimerase OS=Shewanella frigidimarina (strain NCIMB 400) GN=hldD PE=3 SV=1 111 326 5.0E-06
sp|Q2NQV7|HLDD_SODGM ADP-L-glycero-D-manno-heptose-6-epimerase OS=Sodalis glossinidius (strain morsitans) GN=hldD PE=3 SV=1 111 421 7.0E-06
sp|P45602|GALE_KLEPN UDP-glucose 4-epimerase (Fragment) OS=Klebsiella pneumoniae GN=galE PE=3 SV=1 110 228 9.0E-06
sp|A4SHC0|HLDD_AERS4 ADP-L-glycero-D-manno-heptose-6-epimerase OS=Aeromonas salmonicida (strain A449) GN=hldD PE=3 SV=1 111 402 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0009058 biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0016229 steroid dehydrogenase activity No
GO:0008202 steroid metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072520
MSPSYIKTFDKEGNEITTVGLDRFGFDSRVPLDVLRSLYLRSHYIISNNDTKAIVNLSDKEAEAEHAKLSSGYTL
FQPTSIYFPETASVSYSTLSRFPPVKLLPLSQRKRVLVTGGAGFVGSHLVDRLMLLGHEVTVLDNFFTGSKTTVS
HWVGHPNFELVRHDVVEPFMIECDQIYHLACPASPPHYQVNAVKTIKTSFMGTLNMLGLAKRTKARFLTSSTSEI
YGDPEVHPQHEDYWGHVNPIGPRACYDEGKRVAETLTYGFQRQDGVDVRVARIFNTYGPRMNPYDGRVVSNFIVQ
ALKGEDMTVYGDGTQTRSFQYIHDLIDGLIALMGSDESRPVNIGNGDEFTIGEFAELVREIVEKVQAEDGITHQK
RVEIVHKPMPTDDPQKRRPDTTRAKQSLGWQPRWTARMGIEEMVRYYKAKLAEGDL*
Coding >AgabiH97|072520
ATGTCTCCCTCCTATATCAAAACCTTTGATAAGGAAGGCAATGAGATCACCACGGTCGGCCTGGACCGCTTCGGT
TTCGACTCGCGAGTCCCTCTTGATGTCCTTCGATCTCTATACCTCCGCTCTCATTACATTATCTCAAATAATGAC
ACCAAAGCCATAGTGAACCTCAGTGATAAGGAAGCAGAGGCTGAACATGCCAAGCTGAGCAGTGGCTACACGCTT
TTCCAACCCACTTCAATTTACTTTCCGGAAACTGCCTCTGTATCTTACAGCACACTCTCCCGCTTCCCGCCTGTC
AAACTTCTCCCACTGTCCCAACGCAAGCGTGTCCTAGTTACTGGTGGAGCTGGTTTTGTCGGCTCCCATCTTGTT
GATCGCCTCATGCTCCTCGGCCACGAAGTCACTGTTCTCGATAATTTCTTCACCGGTTCCAAGACAACTGTCAGT
CACTGGGTTGGTCATCCCAATTTTGAATTGGTTCGCCACGATGTCGTGGAGCCATTCATGATTGAATGCGACCAA
ATCTATCACCTCGCCTGTCCTGCGTCCCCTCCGCATTATCAAGTAAATGCTGTCAAGACGATCAAAACATCGTTT
ATGGGAACGCTTAATATGCTCGGTTTGGCCAAACGTACTAAAGCACGTTTCCTCACATCGAGCACGTCTGAGATT
TATGGTGATCCTGAGGTTCATCCGCAACATGAGGACTATTGGGGTCATGTTAACCCAATTGGACCCCGTGCCTGT
TACGACGAGGGAAAGCGTGTTGCGGAAACGTTAACCTACGGCTTCCAACGGCAGGACGGAGTTGATGTCCGTGTT
GCACGTATCTTTAATACCTATGGTCCTCGTATGAACCCGTATGATGGTCGCGTCGTTTCGAATTTTATCGTCCAG
GCGCTTAAAGGCGAAGATATGACGGTTTATGGCGACGGCACACAAACCAGATCATTCCAATACATCCACGACCTG
ATCGATGGTCTCATTGCGCTTATGGGTTCGGATGAAAGTCGCCCAGTTAATATCGGCAACGGCGATGAGTTCACC
ATTGGCGAGTTCGCTGAGCTCGTCCGGGAGATCGTCGAGAAGGTACAAGCTGAAGATGGCATTACGCATCAGAAG
CGTGTCGAGATTGTACACAAGCCGATGCCTACTGATGATCCTCAGAAGCGTCGTCCTGATACGACAAGGGCAAAG
CAGTCGCTCGGTTGGCAGCCTCGCTGGACTGCACGTATGGGCATAGAGGAAATGGTCAGGTACTACAAGGCCAAG
CTAGCTGAAGGGGATTTATAA
Transcript >AgabiH97|072520
ATGTCTCCCTCCTATATCAAAACCTTTGATAAGGAAGGCAATGAGATCACCACGGTCGGCCTGGACCGCTTCGGT
TTCGACTCGCGAGTCCCTCTTGATGTCCTTCGATCTCTATACCTCCGCTCTCATTACATTATCTCAAATAATGAC
ACCAAAGCCATAGTGAACCTCAGTGATAAGGAAGCAGAGGCTGAACATGCCAAGCTGAGCAGTGGCTACACGCTT
TTCCAACCCACTTCAATTTACTTTCCGGAAACTGCCTCTGTATCTTACAGCACACTCTCCCGCTTCCCGCCTGTC
AAACTTCTCCCACTGTCCCAACGCAAGCGTGTCCTAGTTACTGGTGGAGCTGGTTTTGTCGGCTCCCATCTTGTT
GATCGCCTCATGCTCCTCGGCCACGAAGTCACTGTTCTCGATAATTTCTTCACCGGTTCCAAGACAACTGTCAGT
CACTGGGTTGGTCATCCCAATTTTGAATTGGTTCGCCACGATGTCGTGGAGCCATTCATGATTGAATGCGACCAA
ATCTATCACCTCGCCTGTCCTGCGTCCCCTCCGCATTATCAAGTAAATGCTGTCAAGACGATCAAAACATCGTTT
ATGGGAACGCTTAATATGCTCGGTTTGGCCAAACGTACTAAAGCACGTTTCCTCACATCGAGCACGTCTGAGATT
TATGGTGATCCTGAGGTTCATCCGCAACATGAGGACTATTGGGGTCATGTTAACCCAATTGGACCCCGTGCCTGT
TACGACGAGGGAAAGCGTGTTGCGGAAACGTTAACCTACGGCTTCCAACGGCAGGACGGAGTTGATGTCCGTGTT
GCACGTATCTTTAATACCTATGGTCCTCGTATGAACCCGTATGATGGTCGCGTCGTTTCGAATTTTATCGTCCAG
GCGCTTAAAGGCGAAGATATGACGGTTTATGGCGACGGCACACAAACCAGATCATTCCAATACATCCACGACCTG
ATCGATGGTCTCATTGCGCTTATGGGTTCGGATGAAAGTCGCCCAGTTAATATCGGCAACGGCGATGAGTTCACC
ATTGGCGAGTTCGCTGAGCTCGTCCGGGAGATCGTCGAGAAGGTACAAGCTGAAGATGGCATTACGCATCAGAAG
CGTGTCGAGATTGTACACAAGCCGATGCCTACTGATGATCCTCAGAAGCGTCGTCCTGATACGACAAGGGCAAAG
CAGTCGCTCGGTTGGCAGCCTCGCTGGACTGCACGTATGGGCATAGAGGAAATGGTCAGGTACTACAAGGCCAAG
CTAGCTGAAGGGGATTTATAA
Gene >AgabiH97|072520
ATGTCTCCCTCCTATGTATGTCTCTCCCCCTGCCCCCATTCCCGCCTCTGACTCAGTCCTGTTTTGTCTAGATCA
AAACCTTTGATAAGGAAGGCAATGAGATCACCACGGTCGGCCTGGACCGCTTCGGTTTCGACTCGCGAGTCCCTC
TTGATGTCCTTCGATCTCTATACCTCCGCTCTCATTACATTATCTCAAATAATGACACCAAAGCCATAGTGAACC
TCAGTGATAAGGAAGCAGAGGCTGAACATGCCAAGCTGAGCAGTGGCTACACGCTTTTCCAACCCACTTCAATTT
ACTTTCCGGAAACTGCCTCTGTATCTTACAGCACACTCTCCCGCTTCCCGCCTGTCAAACTTCTCCCACTGTCCC
AACGCAAGCGTGTCCTAGTTACTGGTGGAGCTGGTTTTGTCGGCTCCCATCTTGTTGATCGCCTCATGCTCCTCG
GCCACGAAGTCACTGTTCTCGATAATTTCTTCACCGGTTCCAAGACAACTGTCAGTCACTGGGTTGGTCATCCCA
ATTTTGAATTGGTTCGCCACGATGTCGTGGAGCCATTCATGATTGAATGCGACCGTAGGTACTTCGACCCTGCCC
CATCACGGCCCACTCATGTTATAGTTAGAAATCTATCACCTCGCCTGTCCTGCGTCCCCTCCGCATTATCAAGTA
AATGCTGTCAAGACGATCAAAACATCGTTTATGGGAACGCTTAATATGCTCGGTTTGGCCAAACGTACTAAAGCA
CGTTTCCTCACATCGAGCACGTCTGGTAAGGTTCCTTCATCGTCGAAACTCTATGGCATCAGTTAATTTGCGCCC
ATAGAGATTTATGGTGATCCTGAGGTTCATCCGCAACATGAGGACTAGTGAGTTTGGTTGCATCACACAGGGACG
GATTACGAACCACTGACACATTTTTTGATATCTCGATAGTTGGGGTCATGTTAACCCAATTGGACCCCGTGCCTG
TTACGACGAGGGAAAGCGTGTTGCGGAAACGTTAACCTACGGCTTCCAACGGCAGGACGGAGTTGATGTCCGTGT
TGCACGTATCTTTAATACCTATGGTCCTCGTAGTAAGTTTTCTATTTTCCCCACCGTGATTCGTGCTAACCCTCT
ACGTAGTGAACCCGTATGATGGTCGCGTCGTTTCGAATTTTATCGTCCAGGCGCTTAAAGGCGAAGATATGACGG
TTTATGGCGACGGCACACAAACCAGATCATTCCAATACATCCACGACCTGATCGATGGTCTCATTGCGCTTATGG
GTTCGGATGAAAGTCGCCCAGTTAATATCGGCAACGGCGATGAGTTCACCATTGGCGAGTTCGCTGAGCTCGTCC
GGGAGATCGTCGAGAAGGTACAAGCTGAAGATGGCATTACGCATCAGAAGCGTGTCGAGATTGTACACAAGCCGA
TGCCTACTGATGATCCTCAGAAGCGTCGTCCTGATACGACAAGGGCAAAGCAGTCGCTCGGTTGGCAGCCTCGCT
GGACTGCACGTATGGGCATAGAGGAAATGGTCAGGTACTACAAGGCCAAGCTAGCTGAAGGGGATTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail