Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072410
Gene name
Locationscaffold_4:1715862..1716336
Strand+
Gene length (bp)474
Transcript length (bp)255
Coding sequence length (bp)255
Protein length (aa) 85

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06522 B12D NADH-ubiquinone reductase complex 1 MLRQ subunit 2.1E-14 21 77

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3YAJ5|NDUA4_MACMU Cytochrome c oxidase subunit NDUFA4 OS=Macaca mulatta GN=NDUFA4 PE=3 SV=1 23 79 8.0E-09
sp|Q4R542|NDUA4_MACFA Cytochrome c oxidase subunit NDUFA4 OS=Macaca fascicularis GN=NDUFA4 PE=3 SV=1 23 79 8.0E-09
sp|Q0MQ99|NDUA4_PANTR Cytochrome c oxidase subunit NDUFA4 OS=Pan troglodytes GN=NDUFA4 PE=3 SV=1 23 79 5.0E-08
sp|O00483|NDUA4_HUMAN Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens GN=NDUFA4 PE=1 SV=1 23 79 5.0E-08
sp|Q0MQ97|NDUA4_PONPY Cytochrome c oxidase subunit NDUFA4 OS=Pongo pygmaeus GN=NDUFA4 PE=3 SV=1 23 79 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3YAJ5|NDUA4_MACMU Cytochrome c oxidase subunit NDUFA4 OS=Macaca mulatta GN=NDUFA4 PE=3 SV=1 23 79 8.0E-09
sp|Q4R542|NDUA4_MACFA Cytochrome c oxidase subunit NDUFA4 OS=Macaca fascicularis GN=NDUFA4 PE=3 SV=1 23 79 8.0E-09
sp|Q0MQ99|NDUA4_PANTR Cytochrome c oxidase subunit NDUFA4 OS=Pan troglodytes GN=NDUFA4 PE=3 SV=1 23 79 5.0E-08
sp|O00483|NDUA4_HUMAN Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens GN=NDUFA4 PE=1 SV=1 23 79 5.0E-08
sp|Q0MQ97|NDUA4_PONPY Cytochrome c oxidase subunit NDUFA4 OS=Pongo pygmaeus GN=NDUFA4 PE=3 SV=1 23 79 6.0E-08
sp|Q0MQ98|NDUA4_GORGO Cytochrome c oxidase subunit NDUFA4 OS=Gorilla gorilla gorilla GN=NDUFA4 PE=3 SV=1 23 79 6.0E-08
sp|Q6PBH5|NDUA4_DANRE Cytochrome c oxidase subunit NDUFA4 OS=Danio rerio GN=ndufa4 PE=3 SV=1 23 79 5.0E-07
sp|Q62425|NDUA4_MOUSE Cytochrome c oxidase subunit NDUFA4 OS=Mus musculus GN=Ndufa4 PE=1 SV=2 23 79 3.0E-06
sp|Q5RK28|NMES1_RAT Normal mucosa of esophagus-specific gene 1 protein OS=Rattus norvegicus GN=Nmes1 PE=3 SV=1 13 76 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072410
MAPRPRPTLRNSFMRNWYSVEAIPIYVIIGGVVVGASWFLGRLATGPYVVWSKSNPTPWNTIKPDEGTKIMEINQ
KFDKSWSRS*
Coding >AgabiH97|072410
ATGGCTCCTCGACCTCGACCAACGCTTCGCAACAGCTTTATGAGAAACTGGTATTCCGTGGAGGCCATTCCGATT
TATGTGATTATTGGAGGCGTCGTTGTTGGCGCTTCGTGGTTCTTGGGTCGTTTGGCTACCGGACCCTATGTCGTT
TGGTCAAAGTCCAACCCCACCCCTTGGAACACTATCAAACCTGATGAAGGCACCAAGATAATGGAGATCAACCAG
AAATTTGACAAGAGCTGGTCGCGCTCTTGA
Transcript >AgabiH97|072410
ATGGCTCCTCGACCTCGACCAACGCTTCGCAACAGCTTTATGAGAAACTGGTATTCCGTGGAGGCCATTCCGATT
TATGTGATTATTGGAGGCGTCGTTGTTGGCGCTTCGTGGTTCTTGGGTCGTTTGGCTACCGGACCCTATGTCGTT
TGGTCAAAGTCCAACCCCACCCCTTGGAACACTATCAAACCTGATGAAGGCACCAAGATAATGGAGATCAACCAG
AAATTTGACAAGAGCTGGTCGCGCTCTTGA
Gene >AgabiH97|072410
ATGGCTCCTCGACCTCGACCAACGCTTCGCAACAGCTTTATGAGAAACTGGTATTCCGTGGAGGTATGTAATTTC
TCTCACTGTATTGTGCCCGCTGAAAACTTTCGGATGCAGGCCATTCCGATGTAAGGCACTGTGTTTGCTATGTCC
GGTTTGAGACGTTGACGTCTATGGGTTAGTTATGTGATTATTGGAGGCGTCGTTGTTGGCGCTTCGTGGTTCTTG
GGTCGTTTGGCTACCGGACCCTATGGTAAGTAGTTTGGCGAGTTCTCTTCTTCCGGGCTGACGGTATACACTTCT
AGTCGTTTGGTCAAAGTCCAACCCCACCCCTTGGAACACTATCAAACCTGATGAAGGCACCAAGATAATGGAGAT
CAACCAGAAATTTGACAAGAGGTATGTTTCGTCTTTTAATGTCCTCCTAAGCTTCGAGGATATGCATTTATATCA
TTTTGTAGCTGGTCGCGCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail